Citrus Sinensis ID: 004266
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 765 | ||||||
| 359478381 | 725 | PREDICTED: zinc finger CCCH domain-conta | 0.918 | 0.969 | 0.619 | 0.0 | |
| 147805931 | 718 | hypothetical protein VITISV_043632 [Viti | 0.905 | 0.965 | 0.622 | 0.0 | |
| 255571544 | 728 | nucleic acid binding protein, putative [ | 0.913 | 0.960 | 0.593 | 0.0 | |
| 224087035 | 735 | predicted protein [Populus trichocarpa] | 0.913 | 0.951 | 0.583 | 0.0 | |
| 255571542 | 725 | nucleic acid binding protein, putative [ | 0.870 | 0.918 | 0.614 | 0.0 | |
| 294440421 | 740 | unknown [Vitis vinifera] | 0.870 | 0.9 | 0.609 | 0.0 | |
| 302398727 | 731 | C3HL domain class transcription factor [ | 0.915 | 0.957 | 0.577 | 0.0 | |
| 302398721 | 736 | C3HL domain class transcription factor [ | 0.915 | 0.951 | 0.571 | 0.0 | |
| 359487288 | 740 | PREDICTED: zinc finger CCCH domain-conta | 0.870 | 0.9 | 0.606 | 0.0 | |
| 356530657 | 701 | PREDICTED: zinc finger CCCH domain-conta | 0.874 | 0.954 | 0.598 | 0.0 |
| >gi|359478381|ref|XP_003632114.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 865 bits (2234), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 455/734 (61%), Positives = 557/734 (75%), Gaps = 31/734 (4%)
Query: 54 MCGGSEKLSSKALAPSASPPSKPSLQRNMSNPTETMKSDHSFSRLLELAADNDVEGFKQC 113
MC G +K+ K APS++P + S ++M+ PT ++S++SFS LLE AA+NDVEGF++
Sbjct: 1 MCSGPKKMDPKTPAPSSTPETNTS-TKDMNKPTGEVESENSFSSLLEFAANNDVEGFQKS 59
Query: 114 IC-DTSAICEVGLWYSFQRLSKKIVLQHRTPLMVAAEYGSVDVVKLILSLTKADVNLTCG 172
I + SAI +VGLWY +++SK++VL+HRTPLMVAA YGSVD+VKLILSL++ADVN +CG
Sbjct: 60 IALNGSAIDKVGLWYVHRKVSKQMVLEHRTPLMVAAMYGSVDIVKLILSLSEADVNRSCG 119
Query: 173 LDKSTALHCAASGGSVNAVDVVKLLLFAGADSNLTDAHGNRPFDVIVVHPNVPDSRVSLE 232
DKSTALHCA SGG+VNAVDV KLLL AGAD N TDA G+RPFDVI V P +PD + +LE
Sbjct: 120 PDKSTALHCAVSGGTVNAVDVAKLLLLAGADPNSTDAQGHRPFDVIDVSPKLPDLKATLE 179
Query: 233 DLLKNGGSVSFDELQVSSVDLRSSSSLSSSS-DDSSLSS--------LTCKSDDVHAFVA 283
+LLKN V + Q+S+V L+SSS SSS D+ SLS L + D+H
Sbjct: 180 ELLKNDDFVYQQDFQISTVSLKSSSPSLSSSPDNCSLSGVSESMSPPLASRLSDIHVSSM 239
Query: 284 PEKKEYPIDPSLPDIKDSIYASDEFRMYSFKIRPCSRAYSHDWTECPFAHPGENARRRDP 343
PEKKEYP+DPSLPDIK+SIYA+DEFRMYSFKIRPCSRAYSHDWTECPF HPGENARRRDP
Sbjct: 240 PEKKEYPVDPSLPDIKNSIYATDEFRMYSFKIRPCSRAYSHDWTECPFVHPGENARRRDP 299
Query: 344 RKFHYSCMPCPDHRKGACSRGDMCEYAHGIFESWLHPAQYRTKLCKDGTSCMRRVCFFAH 403
RKFHYSC+PCP+ RKGAC RGD+CEYAHG+FE WLHPAQYRT+LCKDGTSCMRRVCFFAH
Sbjct: 300 RKFHYSCVPCPEFRKGACRRGDLCEYAHGVFECWLHPAQYRTRLCKDGTSCMRRVCFFAH 359
Query: 404 ALDELRPLYASTGSGMPSPQS-------ATAMNMLPGSPSAVSAMLPSPFTPPMSPSN-D 455
ELRPLY STGSG+ SP+S A+A+++ PGSPSAVSAM PSPFTPPMSP+
Sbjct: 360 TSKELRPLYMSTGSGVASPRSAANAMDMASALSLFPGSPSAVSAMSPSPFTPPMSPAGVA 419
Query: 456 ILCLSMAWPQQNIPTLHLPSSNLQASRLRSSLNARDIPVEDLGMLRDFEM-QNQLINEFS 514
I SMAWPQQ+IPTLHLP SNLQ SRLRSSL+ARD+ VE+ +L+DF++ Q QL+N+ S
Sbjct: 420 ISHSSMAWPQQSIPTLHLPGSNLQTSRLRSSLSARDMLVEEFNVLQDFDVQQQQLLNDLS 479
Query: 515 H-SQPQFGTSSGGNMSVRLNRLTPTKLDQLSYPEISSPQYSDQFAASNVFSPSHKSMVLN 573
H +QP +S+ GN+SVR LTP+ LD+L E+SSP+Y+D AAS +FSPSHKS+VLN
Sbjct: 480 HFTQPNL-SSASGNLSVRSKALTPSNLDELFSAEMSSPRYADHVAASTMFSPSHKSVVLN 538
Query: 574 QLQQQQQNMSSPINTNVFSPMNVDHPLLQASFGISSPGRMSPRKMEPISPMSPRVSTLTP 633
Q Q QQ M SPI TNVFSP NVDHPLLQASFG+SSPGRMSPR +EP+SP+S R S+L
Sbjct: 539 QF-QHQQGMLSPIKTNVFSPKNVDHPLLQASFGVSSPGRMSPRGIEPLSPLSSRFSSLAH 597
Query: 634 REKLLQQLHSLSLREHGPRLSCDLKSDSPIGSVLNSWSKLESPSMKIDWSIQADELNHLR 693
REK Q L SLS R+ G + S NSWSK ESP+ KIDWS+Q +EL R
Sbjct: 598 REKQQQHLRSLSSRDLGS------NGAGIVNSPANSWSKWESPNGKIDWSVQGEELAWHR 651
Query: 694 RSHSFGRNGEGLDVSTVQSHMRETPSKMKETTPAPPSSMSFPTEGANLNPQSESGDH--L 751
++ S +N EG D+S VQS ++E+P ++ET P S M+ +G+N + +S DH L
Sbjct: 652 KTFSIEQNREGPDLSWVQSLVKESPPGIQETPTLPVSGMTVSADGSNSISRIDSIDHAVL 711
Query: 752 GAWLDQLQLDQIVA 765
GAWL+Q+QLDQIVA
Sbjct: 712 GAWLEQMQLDQIVA 725
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147805931|emb|CAN74402.1| hypothetical protein VITISV_043632 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255571544|ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533907|gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224087035|ref|XP_002308038.1| predicted protein [Populus trichocarpa] gi|222854014|gb|EEE91561.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255571542|ref|XP_002526717.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533906|gb|EEF35631.1| nucleic acid binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|294440421|gb|ADE74631.1| unknown [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302398727|gb|ADL36658.1| C3HL domain class transcription factor [Malus x domestica] gi|302398729|gb|ADL36659.1| C3HL domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|302398721|gb|ADL36655.1| C3HL domain class transcription factor [Malus x domestica] | Back alignment and taxonomy information |
|---|
| >gi|359487288|ref|XP_002279202.2| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356530657|ref|XP_003533897.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 765 | ||||||
| TAIR|locus:2182250 | 706 | AT5G12850 [Arabidopsis thalian | 0.850 | 0.922 | 0.518 | 1.6e-175 | |
| TAIR|locus:2064647 | 716 | OXS2 "OXIDATIVE STRESS 2" [Ara | 0.854 | 0.913 | 0.528 | 2.1e-171 | |
| TAIR|locus:2178843 | 607 | AT5G58620 [Arabidopsis thalian | 0.315 | 0.397 | 0.573 | 2.2e-111 | |
| TAIR|locus:2065058 | 597 | CZF1 [Arabidopsis thaliana (ta | 0.330 | 0.423 | 0.520 | 1.5e-106 | |
| TAIR|locus:2082068 | 580 | SZF1 "salt-inducible zinc fing | 0.308 | 0.406 | 0.541 | 1.6e-73 | |
| TAIR|locus:2043565 | 315 | ATCTH [Arabidopsis thaliana (t | 0.304 | 0.739 | 0.479 | 9.2e-52 | |
| UNIPROTKB|Q9FU27 | 386 | LOC_Os01g09620 "Zinc finger CC | 0.286 | 0.567 | 0.493 | 2.3e-48 | |
| TAIR|locus:2052005 | 359 | OZF1 "Oxidation-related Zinc F | 0.250 | 0.534 | 0.490 | 1.2e-47 | |
| TAIR|locus:2024112 | 393 | SOM "SOMNUS" [Arabidopsis thal | 0.346 | 0.674 | 0.403 | 1.6e-47 | |
| TAIR|locus:2118209 | 356 | OZF2 "oxidation-related zinc f | 0.213 | 0.457 | 0.528 | 3.7e-47 |
| TAIR|locus:2182250 AT5G12850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1705 (605.2 bits), Expect = 1.6e-175, P = 1.6e-175
Identities = 370/714 (51%), Positives = 460/714 (64%)
Query: 81 NMSNP-TETMKSDHSFSRLLELAADNDVEGFKQCICDTSAICEVGLWYSFQRLSKKIVLQ 139
+++ P + + +HSFS LLE AADNDVEGF++ + D S I ++GLWY QR +++VL+
Sbjct: 24 SLAKPMNDAAEWEHSFSALLEFAADNDVEGFRRQLSDVSCINQMGLWYRRQRFVRRMVLE 83
Query: 140 HRTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLF 199
RTPLMVA+ YGS+DVVK ILS +A++NL+CG DKSTALHCAASG SVN++DVVKLLL
Sbjct: 84 QRTPLMVASLYGSLDVVKFILSFPEAELNLSCGPDKSTALHCAASGASVNSLDVVKLLLS 143
Query: 200 AGADSNLTDAHGNRPFDVIVVHPNVPDSRVSLEDLLKNGGSVSFDELQVXXXXXXXXXXX 259
GAD N+ DAHGNRP DV+VV P+ P R LE++LK +S ++L
Sbjct: 144 VGADPNIPDAHGNRPVDVLVVSPHAPGLRTILEEILKKDEIIS-EDLHASSSSLGSSFRS 202
Query: 260 XXXX----XXXXXXXXXXXXXXVHAF---VAPEKKEYPIDPSLPDIKDSIYASDEFRMYS 312
H A EKKEYPIDPSLPDIK IY++DEFRM+S
Sbjct: 203 LSSSPDNGSSLLSLDSVSSPTKPHGTDVTFASEKKEYPIDPSLPDIKSGIYSTDEFRMFS 262
Query: 313 FKIRPCSRAYSHDWTECPFAHPGENARRRDPRKFHYSCMPCPDHRKGACSRGDMCEYAHG 372
FKIRPCSRAYSHDWTECPFAHPGENARRRDPRKFHY+C+PCPD +KG+C +GDMCEYAHG
Sbjct: 263 FKIRPCSRAYSHDWTECPFAHPGENARRRDPRKFHYTCVPCPDFKKGSCKQGDMCEYAHG 322
Query: 373 IFESWLHPAQYRTKLCKDGTSCMRRVCFFAHALDELRPLYASTGSGMPSPQSATA----- 427
+FE WLHPAQYRT+LCKDG C RRVCFFAHA +ELRPLY STGSG+PSP++++A
Sbjct: 323 VFECWLHPAQYRTRLCKDGMGCNRRVCFFAHANEELRPLYPSTGSGLPSPRASSAVSAST 382
Query: 428 ------MNMLPGSPSAVSAMLPSPFTPPMSPSND--ILCLSMAWPQQNIPTLHLPSSNLQ 479
+NMLPGSPSA FTPP+SPS + + SM WPQQNIP L+LP SN+Q
Sbjct: 383 MDMASVLNMLPGSPSAAQ----HSFTPPISPSGNGSMPHSSMGWPQQNIPALNLPGSNIQ 438
Query: 480 ASRLRSSLNARDIPVEDLGMLRDFEMQNQLINEFSHSQPQFGTSSGGNMSVRLNRLTPTK 539
SRLRSSLNARDIP E L ML +FEMQ QL + HS P+F N S R L P+
Sbjct: 439 LSRLRSSLNARDIPSEQLSMLHEFEMQRQLAGDM-HS-PRFM-----NHSARPKTLNPSN 491
Query: 540 LDQLSYPEISSPQYSDQFAASNVFSPSHKSMVXXXXXXXXXXMSSPINTNVFS-PMNVD- 597
L++L E++SP++SDQ A S+V SPSHKS + M SPI TN+ S P NV+
Sbjct: 492 LEELFSAEVASPRFSDQLAVSSVLSPSHKSALLNQLQNNKQSMLSPIKTNLMSSPKNVEQ 551
Query: 598 HPLLQASFGISSPGRMSPRKMEPISPMSPRVSTLTPREKLLQQLHSLSL--REHGPRLSC 655
H LLQ + SPR EPISPM+ R+ QQLHS SL R+ G L
Sbjct: 552 HSLLQQA--------SSPRGGEPISPMNARMK---------QQLHSRSLSSRDFGSSLPR 594
Query: 656 DLK-SDSPIGSVLNSWSKLESP-SMKIDWSIQADELNHLRRSHSFGRN-GEGLDVSTVQS 712
DL +DS GS L+ WS + K+DWS+Q+DEL LR+SHS N DVS Q
Sbjct: 595 DLMPTDS--GSPLSPWSSWDQTHGSKVDWSVQSDELGRLRKSHSLANNPNREADVSWAQQ 652
Query: 713 HMRETPSKMKETTPAPPSSMSFPTEG-ANLNPQSES---GDHLGAWLDQLQLDQ 762
++++ S + T+G +++NP + D L AWL+QL LD+
Sbjct: 653 MLKDSSSPRNGNRVVNMNGARPLTQGGSSVNPHNSDTRESDILDAWLEQLHLDR 706
|
|
| TAIR|locus:2064647 OXS2 "OXIDATIVE STRESS 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178843 AT5G58620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2065058 CZF1 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082068 SZF1 "salt-inducible zinc finger 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043565 ATCTH [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9FU27 LOC_Os01g09620 "Zinc finger CCCH domain-containing protein 2" [Oryza sativa Japonica Group (taxid:39947)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052005 OZF1 "Oxidation-related Zinc Finger 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024112 SOM "SOMNUS" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118209 OZF2 "oxidation-related zinc finger 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00024607001 | SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (684 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 765 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-15 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 8e-15 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 6e-14 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 6e-13 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 5e-09 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 9e-07 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-05 | |
| smart00356 | 27 | smart00356, ZnF_C3H1, zinc finger | 3e-05 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 8e-05 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 9e-05 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-04 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 0.001 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 0.001 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 74.0 bits (182), Expect = 1e-15
Identities = 36/77 (46%), Positives = 46/77 (59%), Gaps = 5/77 (6%)
Query: 141 RTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLFA 200
RTPL +AA+ G +++VKL+L ADVN D +T LH AA G+ +DVVKLLL
Sbjct: 41 RTPLHLAAKNGHLEIVKLLLE-KGADVNAR-DKDGNTPLHLAARNGN---LDVVKLLLKH 95
Query: 201 GADSNLTDAHGNRPFDV 217
GAD N D G P +
Sbjct: 96 GADVNARDKDGRTPLHL 112
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 100.0 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.97 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.96 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.96 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.96 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.96 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.96 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.95 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.94 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.94 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.94 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.93 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.93 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.93 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.93 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.93 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.91 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.91 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.9 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.9 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.9 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.89 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.89 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.88 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.88 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.87 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.86 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.86 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.85 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.84 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.84 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.82 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.82 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.81 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.81 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.81 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.8 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.78 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.78 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.77 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.76 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.76 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.75 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.75 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.74 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.74 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.73 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.72 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.71 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.71 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.69 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.69 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.69 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.68 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.63 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.59 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.59 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.57 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.57 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.42 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.4 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.38 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.38 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.36 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.34 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.34 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.28 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.25 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.19 | |
| KOG1595 | 528 | consensus CCCH-type Zn-finger protein [General fun | 99.14 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.14 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.07 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.73 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.66 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 98.61 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.6 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.53 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.49 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.47 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.46 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.46 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.44 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.41 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.4 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.34 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.33 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.26 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.26 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.11 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.09 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.95 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.9 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.86 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 97.79 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 97.79 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.78 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.76 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.7 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 97.69 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 97.56 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 96.83 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 96.53 | |
| KOG1677 | 332 | consensus CCCH-type Zn-finger protein [General fun | 96.51 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 96.42 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.34 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 96.3 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.28 | |
| COG5063 | 351 | CTH1 CCCH-type Zn-finger protein [General function | 95.92 | |
| PF00642 | 27 | zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si | 95.41 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 94.97 | |
| KOG3702 | 681 | consensus Nuclear polyadenylated RNA binding prote | 94.9 | |
| smart00356 | 27 | ZnF_C3H1 zinc finger. | 92.52 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 92.15 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 91.9 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 91.86 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 89.33 | |
| PF14608 | 19 | zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | 88.54 | |
| KOG2494 | 331 | consensus C3H1-type Zn-finger protein [Transcripti | 86.95 | |
| KOG2333 | 614 | consensus Uncharacterized conserved protein [Gener | 85.47 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 85.32 | |
| KOG3702 | 681 | consensus Nuclear polyadenylated RNA binding prote | 84.69 | |
| KOG1040 | 325 | consensus Polyadenylation factor I complex, subuni | 84.53 | |
| KOG4791 | 667 | consensus Uncharacterized conserved protein [Funct | 84.03 | |
| COG5252 | 299 | Uncharacterized conserved protein, contains CCCH-t | 81.93 | |
| KOG1492 | 377 | consensus C3H1-type Zn-finger protein [General fun | 80.41 |
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Probab=100.00 E-value=5.9e-81 Score=682.91 Aligned_cols=495 Identities=42% Similarity=0.584 Sum_probs=384.3
Q ss_pred HHHHcCCHHHHHHHHH-CCCCCcccchhhhhhchhhhccCCCChHHHHHHHcCCHHHHHHHHhcCCCCcccccCCCCCcH
Q 004266 100 ELAADNDVEGFKQCIC-DTSAICEVGLWYSFQRLSKKIVLQHRTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTA 178 (765)
Q Consensus 100 ~Aa~~G~~e~Vk~LLe-~gadvn~~~L~~a~~~g~~~id~~G~TPLH~Aa~~G~~evVk~LL~~~GAdVN~~~d~~G~Tp 178 (765)
.-++.++++-+|.+++ ....++..++||..+.+.+.+..+.+|||++|+.+|.++++.+++...-.++|..|..++.
T Consensus 17 e~~~~~~~~~~k~~~~e~~~~~~~~~~~~r~~~~~k~~~~~qR~~~~v~~~~Gs~~~~~~i~~~~~~e~~~~C~~~~~-- 94 (528)
T KOG1595|consen 17 EFEAPNDYAYLKEFRVEQPLFLQHKCLQHRPFVCFKWHFLNQRRRRPVARRDGSFNYSPDIYCTKYDEVTGICPDGDE-- 94 (528)
T ss_pred hhccccHHHHHHHHHHhchhhhhhhhcccccchhhhhhhhccccccchhhhcCccccccceeecchhhccccCCCCcc--
Confidence 5566788888988887 8888999999999999999999999999999999999999999998767889998655554
Q ss_pred HHHHHhCCCCCHHHHHHHHHHCCCCCCCCCCCCCCHHHH---HHhCCCCCCHHHHHHHHHHCCCCCCCcccccccccccC
Q 004266 179 LHCAASGGSVNAVDVVKLLLFAGADSNLTDAHGNRPFDV---IVVHPNVPDSRVSLEDLLKNGGSVSFDELQVSSVDLRS 255 (765)
Q Consensus 179 LH~Aa~~G~~~~~eiVklLL~~GAdvn~~D~~G~TPLh~---Aa~~g~~~~~~~ive~LL~~GAdvn~~n~~~~t~~~~~ 255 (765)
|+|+.+...+..+++..|+..++..+++|..|+-+... |... .......+++.|++.+. .. +
T Consensus 95 -~C~~~g~s~~~~e~~~hL~~~k~~~~~tda~g~~~~~v~~~~~~~-~~~~~r~~~~~l~e~~~-~~-----~------- 159 (528)
T KOG1595|consen 95 -HCAVLGRSVGDTERTYHLRYYKTLPCVTDARGNCVKNVLHCAFAH-GPNDLRPPVEDLLELQG-GS-----G------- 159 (528)
T ss_pred -cchhcccccCCcceeEeccccccccCccccCCCcccCcccccccC-CccccccHHHHHHhccc-cc-----C-------
Confidence 88888877666899999999999999999999876544 3433 23356778898988873 11 0
Q ss_pred CccccCCcCCCCCCcccCCCCCccccccccCCCcCCCCCCCCcccccccccchhcccccccccccccCCCCCCCCCCCCC
Q 004266 256 SSSLSSSSDDSSLSSLTCKSDDVHAFVAPEKKEYPIDPSLPDIKDSIYASDEFRMYSFKIRPCSRAYSHDWTECPFAHPG 335 (765)
Q Consensus 256 ~s~l~~a~~~~~d~n~~dk~G~TPLHlAaekk~ypvdp~LpDi~n~iy~sDefrmy~fKv~~Csr~~shdw~eCpfaH~g 335 (765)
+.+.+++-..-.+. -.|++||+||||+ ++|.+|+|+||.||+++|.|.++|||++|||+|||
T Consensus 160 ---------------~~~~e~~~~~~~~~--~~y~~Dp~~pdi~-~~ys~DeFrMy~fKir~C~R~~shDwteCPf~Hpg 221 (528)
T KOG1595|consen 160 ---------------LPDDEPEVESKLDV--TEYPEDPSWPDIN-GIYSSDEFRMYSFKIRRCSRPRSHDWTECPFAHPG 221 (528)
T ss_pred ---------------ccCCCccccccccc--ccccCCCCccccc-ccccccceEEEeeeecccCCccCCCcccCCccCCC
Confidence 11111111111111 1999999999999 99999999999999999999999999999999999
Q ss_pred CCcccCCCCCCCCCcCCCCCccCCcCCCCCCcccCcCccccccCccccccccCCCCCCCCCCccCCCCCcCCccccccCC
Q 004266 336 ENARRRDPRKFHYSCMPCPDHRKGACSRGDMCEYAHGIFESWLHPAQYRTKLCKDGTSCMRRVCFFAHALDELRPLYAST 415 (765)
Q Consensus 336 E~arRR~p~~~~Y~~~~Cp~~~~g~C~~gd~C~~aH~~~E~~~hP~~ykt~~C~~~~~C~~~~C~faH~~~e~r~~~~~~ 415 (765)
||||||+||+|+|++++||+|++|.|.+||.|+|||||||||+||++|||++|+++++|+|++|||||.++|||+++.++
T Consensus 222 EkARRRDPRkyhYs~tpCPefrkG~C~rGD~CEyaHgvfEcwLHPa~YRT~~CkDg~~C~RrvCfFAH~~eqLR~l~~s~ 301 (528)
T KOG1595|consen 222 EKARRRDPRKYHYSSTPCPEFRKGSCERGDSCEYAHGVFECWLHPARYRTRKCKDGGYCPRRVCFFAHSPEQLRPLPPST 301 (528)
T ss_pred cccccCCcccccccCccCcccccCCCCCCCccccccceehhhcCHHHhccccccCCCCCccceEeeecChHHhcccCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCCC-ccccccccCCCCCCCcccCCCCCCCCCCCCC-CC--CCccCCCCCCCCCCCCcCCCCCcccc-ccccccccCC
Q 004266 416 GSGMPS-PQSATAMNMLPGSPSAVSAMLPSPFTPPMSP-SN--DILCLSMAWPQQNIPTLHLPSSNLQA-SRLRSSLNAR 490 (765)
Q Consensus 416 ~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~-~~--~~~~~~~~~~~~~~p~~~~~~~~~~~-~~~~~~~~~~ 490 (765)
|+..++ |+++.+++....- ...+-+|++.+||++| ++ .++..++.|.+.+++.+..|+.+|+. |||+|.++++
T Consensus 302 ~s~~~~sp~~s~~sp~~~~~--~~~~~s~~~~~~p~sp~~~~~~~~~~~~~s~~~~~~~~~~p~~~~~~~Srl~s~~~a~ 379 (528)
T KOG1595|consen 302 GSDRPSSPSSSSASPMMASL--RSLPFSPSPGSPPLSPSANGVSSPIASGGSRSLNSNSPSSPAAPLRSFSRLSSSLSAA 379 (528)
T ss_pred CCCCCCCcccccCCCCcccc--ccCCCCCCCCCCCCCccccccccccccccccccCCCCCCCcccccccccccccccccc
Confidence 999885 7665433322111 1123345568999999 43 46667888999999888889999988 9999999999
Q ss_pred CCChhhhhhhhhhhhHHHhhhhhccCCCCCCCCCCCCccccCCCCCCCCccccccCCCCCCCccccccccccccccchhh
Q 004266 491 DIPVEDLGMLRDFEMQNQLINEFSHSQPQFGTSSGGNMSVRLNRLTPTKLDQLSYPEISSPQYSDQFAASNVFSPSHKSM 570 (765)
Q Consensus 491 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~ 570 (765)
+|.... . ++. -+|+++|++++++ +
T Consensus 380 ~i~~~~-----~-----------------------~~~---------~~l~~~f~s~~ss-------------------s 403 (528)
T KOG1595|consen 380 DISMSS-----P-----------------------MNL---------GNLSELFSSPDSS-------------------S 403 (528)
T ss_pred cccccc-----c-----------------------ccc---------ccchhhhcCcccc-------------------c
Confidence 983311 0 111 0899999999875 1
Q ss_pred hhhHHHHHhhhcCCCCCcCcCCCCCCCCcccccccCCCCCCCCCCCCCCCCCCCcchh-hcchhhHHHHHhhhccccccC
Q 004266 571 VLNQLQQQQQNMSSPINTNVFSPMNVDHPLLQASFGISSPGRMSPRKMEPISPMSPRV-STLTPREKLLQQLHSLSLREH 649 (765)
Q Consensus 571 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~-~a~~~r~~~~~~~~~~~~~~~ 649 (765)
.-+|+|+.++.+.+|++|++++ ..+++..+..|.-+ ..+|++|. .+|++|+-+ ++ .+.
T Consensus 404 l~~~~~~~~~~~tsP~~~~~~~----------~~~~~e~s~~~~~~----~~~~~~r~l~~~l~~~~~------~s-~~~ 462 (528)
T KOG1595|consen 404 LNPQLQVLSSAPTSPVFTDTAS----------FGSSVESSPAMEGR----SQVMSSRELRASLKRSST------LS-DKP 462 (528)
T ss_pred cchhhhhcccCCcCCcCCcccc----------cccccccchhhhcc----cccccchhhhhhhccccc------cc-ccc
Confidence 1245554435567777665222 12233333333322 25888888 777777321 11 111
Q ss_pred CCCCccCCCCCCCCCCCCCCC-CCCCCCCC-CcccccChhhhccccccCCCCC-CCCCCCcchhhhcccCCC
Q 004266 650 GPRLSCDLKSDSPIGSVLNSW-SKLESPSM-KIDWSIQADELNHLRRSHSFGR-NGEGLDVSTVQSHMRETP 718 (765)
Q Consensus 650 ~~~~~~~~~~~~~~~~~~~~~-s~wgs~~g-k~dw~~~~~el~~~r~s~s~~~-~~~epd~swv~~~vk~~~ 718 (765)
..+.+ ...+.| +|||+.+| ++||++|+|||+|+|++.||+. ...||||||||+||||.+
T Consensus 463 ~~~~~----------~~~~~~~~d~g~~~g~~~d~~~~~~~l~~~r~~~s~~~~~~~~pd~swv~~ll~~~~ 524 (528)
T KOG1595|consen 463 AMNSS----------GQFSFNNSDWGPRAGELLDWGVQSDLLNKLRESTSFELGSAGEPDVSWVQSLLKEPA 524 (528)
T ss_pred cccCc----------cccccccCCcCcccCcccchhhhHHHHhhcccCcccccCCCCCcCcchhhhhccccc
Confidence 11111 011233 79999999 9999999999999999999998 345999999999999986
|
|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3702 consensus Nuclear polyadenylated RNA binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >smart00356 ZnF_C3H1 zinc finger | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type | Back alignment and domain information |
|---|
| >KOG2494 consensus C3H1-type Zn-finger protein [Transcription] | Back alignment and domain information |
|---|
| >KOG2333 consensus Uncharacterized conserved protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG3702 consensus Nuclear polyadenylated RNA binding protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1040 consensus Polyadenylation factor I complex, subunit, Yth1 (CPSF subunit) [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4791 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1492 consensus C3H1-type Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 765 | ||||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 1e-07 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-07 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-07 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 2e-07 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-07 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-07 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-06 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-06 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 4e-06 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-05 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 3e-05 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 5e-05 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 6e-05 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 7e-05 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 7e-05 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 8e-05 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 1e-04 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 1e-04 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 1e-04 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 1e-04 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 1e-04 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 1e-04 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 1e-04 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 2e-04 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 2e-04 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-04 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 2e-04 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 3e-04 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 3e-04 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 3e-04 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 3e-04 | ||
| 4g8k_A | 337 | Intact Sensor Domain Of Human Rnase L In The Inacti | 3e-04 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 4e-04 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 4e-04 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-04 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 5e-04 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 6e-04 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 6e-04 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 7e-04 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 7e-04 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-04 |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
|
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 765 | |||
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-18 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-16 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 2e-14 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-12 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 4e-04 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 4e-18 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-16 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 8e-11 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 3e-06 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 5e-18 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-15 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 3e-14 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 6e-11 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 2e-04 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-17 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-15 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 8e-15 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-11 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 6e-08 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-05 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-17 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-16 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 6e-16 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-14 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-14 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 1e-12 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-09 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-17 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-17 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 3e-16 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 7e-15 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 4e-17 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 1e-16 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 3e-16 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 6e-15 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 4e-17 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-16 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 5e-09 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 4e-06 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 7e-17 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 8e-14 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 8e-07 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 8e-17 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 9e-16 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-15 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-14 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-12 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 3e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 5e-08 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-16 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-15 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-13 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 9e-06 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-16 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-12 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 8e-08 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-16 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-15 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-13 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 3e-13 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 1e-08 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 8e-05 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 2e-16 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-16 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-15 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-14 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 2e-14 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 8e-13 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 1e-10 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-08 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-16 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-16 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 6e-15 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-14 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-13 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-12 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 4e-05 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-16 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 4e-15 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 1e-14 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-14 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 7e-04 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 8e-04 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-16 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-15 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-14 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-12 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-12 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 9e-12 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 1e-04 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 3e-16 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 5e-16 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-13 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-08 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-16 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 5e-16 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-15 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-15 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-15 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 6e-13 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 9e-11 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 5e-04 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-16 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 6e-15 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-14 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 4e-13 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-06 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-05 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 5e-16 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 5e-15 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 4e-14 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-07 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-16 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-14 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-14 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-13 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-10 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 9e-09 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 1e-08 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 6e-04 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 8e-16 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-16 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 3e-15 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-15 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-15 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-13 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 4e-13 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-05 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-15 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 1e-15 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-06 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-15 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 6e-15 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-14 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 1e-12 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-15 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 7e-15 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-12 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 4e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 4e-10 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-09 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-07 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 2e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 3e-15 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 8e-13 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 7e-12 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 6e-11 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 2e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 4e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 6e-15 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 3e-11 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 1e-06 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-15 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 2e-13 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-12 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-12 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 1e-11 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-15 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-14 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 1e-14 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 3e-10 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 4e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 9e-15 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 2e-13 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 1e-12 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 8e-10 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 7e-15 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 9e-13 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-12 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-13 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-13 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 8e-13 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-11 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 5e-11 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-09 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-08 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-04 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 7e-14 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-13 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-12 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 5e-11 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 1e-06 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 1e-14 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-14 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 3e-13 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 4e-10 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 6e-04 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-14 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-13 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-12 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-10 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 8e-04 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-14 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-13 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-13 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 2e-10 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 4e-07 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-14 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 8e-14 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 1e-13 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-13 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 2e-12 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 5e-08 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 7e-14 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-11 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-11 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-10 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 7e-10 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 8e-14 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-12 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-12 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-06 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 4e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 2e-13 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-13 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 5e-10 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-06 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-13 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 7e-12 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 9e-05 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 6e-13 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 2e-12 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-11 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 7e-10 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-13 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-12 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-05 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 7e-04 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 8e-12 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-11 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-10 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 6e-07 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-11 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-09 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 4e-04 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 1e-11 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 9e-08 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-04 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 5e-11 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-10 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 4e-09 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 1e-06 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-08 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 4e-08 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 7e-07 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 5e-08 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 1e-06 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 7e-08 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 6e-04 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 9e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 9e-07 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 3e-06 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 7e-06 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-04 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 1e-04 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 2e-04 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 2e-04 |
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
Score = 82.5 bits (205), Expect = 2e-18
Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 4/77 (5%)
Query: 141 RTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLFA 200
RT L+ A GS V+L+ AD++ TALH AA +VV+ L+
Sbjct: 77 RTALLFVAGLGSDKCVRLLAEA-GADLDHRDMRGGLTALHMAAGYVR---PEVVEALVEL 132
Query: 201 GADSNLTDAHGNRPFDV 217
GAD + D G ++
Sbjct: 133 GADIEVEDERGLTALEL 149
|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Length = 70 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Length = 80 | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.98 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.98 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.98 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.97 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.97 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.97 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.97 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.97 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.97 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.97 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.97 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.97 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.97 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.97 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.97 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.97 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.97 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.97 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.97 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.97 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.97 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.97 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.96 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.96 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.96 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.96 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.96 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.96 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.96 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.96 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.96 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.96 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.96 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.96 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.96 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.95 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.95 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.95 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.95 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.95 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.95 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.95 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.95 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.95 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.95 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.94 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.94 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.94 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.94 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.94 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.94 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.94 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.93 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.93 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.93 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.93 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.93 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.93 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.92 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.92 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.92 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.92 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.91 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.9 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.9 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.89 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.89 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.89 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.89 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.89 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.88 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.88 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.87 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.87 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.86 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.85 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.85 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.85 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.85 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.85 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.84 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.84 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.83 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.83 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.82 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.82 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.82 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.81 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.8 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.79 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.78 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.77 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.75 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.71 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.69 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 99.02 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 98.64 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 98.17 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 98.11 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 98.1 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 97.88 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 97.88 | |
| 1m9o_A | 77 | Tristetraproline; Cys3His type zinc finger, metal | 97.79 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 97.34 | |
| 2d9m_A | 69 | Zinc finger CCCH-type domain containing protein 7A | 97.15 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 96.93 | |
| 2cqe_A | 98 | KIAA1064 protein; CCCH zinc-finger, structural gen | 96.05 | |
| 2d9n_A | 77 | Cleavage and polyadenylation specificity factor, 3 | 95.98 | |
| 3d2q_A | 70 | Muscleblind-like protein 1; tandem zinc finger dom | 94.97 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 92.33 | |
| 2e5s_A | 98 | Otthump00000018578; ZF-CCCHX2 domain, muscleblind- | 92.97 | |
| 2lhn_A | 80 | Nuclear polyadenylated RNA-binding protein NAB2; n | 91.63 | |
| 2rhk_C | 72 | Cleavage and polyadenylation specificity factor su | 92.24 | |
| 3d2n_A | 83 | Muscleblind-like protein 1; tandem zinc finger dom | 90.51 | |
| 2rpp_A | 89 | Muscleblind-like protein 2; zinc finger domain, C3 | 89.52 |
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
Probab=100.00 E-value=1.7e-34 Score=299.59 Aligned_cols=225 Identities=15% Similarity=0.049 Sum_probs=174.7
Q ss_pred CcccCCCCCcHHHHH--------HHHHHHCCCC---cccccCCCCCCcHHHHHHHhcCceeccCccccccccCCCCCCCC
Q 004266 5 PAVTMRNKSSPLKIS--------ISIFQKHTQN---VFLVDFAINDRTLLILLFFQNYLIMCGGSEKLSSKALAPSASPP 73 (765)
Q Consensus 5 p~vt~~ng~TPLH~A--------V~lLl~~gAd---Vn~~D~~~~G~TPLhlA~~~~~~i~c~~~e~lkl~~~~t~s~~~ 73 (765)
-+..+.+|+||||+| +++|+++|++ ++..|. .|+||||+|+. .+.+.+.
T Consensus 2 ~~~~d~~g~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~~~--~g~t~L~~A~~-~g~~~~v----------------- 61 (282)
T 1oy3_D 2 FGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQND--LGQTALHLAAI-LGEASTV----------------- 61 (282)
T ss_dssp CCCCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCT--TSCCHHHHHHH-HTCHHHH-----------------
T ss_pred CCccCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccccccCC--CCCCHHHHHHH-cCCHHHH-----------------
Confidence 467889999999995 5689999998 889999 99999999954 4433332
Q ss_pred ChhHHHhccCCCCccCCCCCCchHHHHHHHcCCHHHHHHHHHCCCCCcccc-------------------hhhhhh----
Q 004266 74 SKPSLQRNMSNPTETMKSDHSFSRLLELAADNDVEGFKQCICDTSAICEVG-------------------LWYSFQ---- 130 (765)
Q Consensus 74 ~~~~Ll~~~~~l~~~~~d~~G~TpLh~Aa~~G~~e~Vk~LLe~gadvn~~~-------------------L~~a~~---- 130 (765)
..|++.+.++ +..+..|.||||+|+..|+.+++++|++.|++.+... ++++..
T Consensus 62 --~~Ll~~ga~~--~~~~~~g~tpL~~A~~~~~~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 137 (282)
T 1oy3_D 62 --EKLYAAGAGV--LVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPE 137 (282)
T ss_dssp --HHHHHTTCCS--SCCCTTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC-----------------------------
T ss_pred --HHHHHcCCCC--CCCCCCCCCHHHHHHHcCCcchhHhhhccCCCCchhhHHHHhhcccccCcchhcchhhhccccccc
Confidence 5677777777 7889999999999999999999999999887643211 000000
Q ss_pred -----------chhhhccCCCChHHHHHHHcCCHHHHHHHHhcCCCCcccccCCCCCcHHHHHHhCCCCCHHHHHHHHHH
Q 004266 131 -----------RLSKKIVLQHRTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLF 199 (765)
Q Consensus 131 -----------~g~~~id~~G~TPLH~Aa~~G~~evVk~LL~~~GAdVN~~~d~~G~TpLH~Aa~~G~~~~~eiVklLL~ 199 (765)
......+..|.||||+|+..|+.++|++||++ |+++|...+..|.||||+|+..|+ .++|++||+
T Consensus 138 ~~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~-g~~~~~~~~~~g~tpL~~A~~~~~---~~~v~~Ll~ 213 (282)
T 1oy3_D 138 NEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDA-GADLNKPEPTCGRTPLHLAVEAQA---ASVLELLLK 213 (282)
T ss_dssp ------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHH-TCCTTCCCTTTCCCHHHHHHHTTC---HHHHHHHHH
T ss_pred hhhhhhhhhhhhcCCCcCCCCcCHHHHHHHcCCHHHHHHHHHc-CCCCCCCCCCCCcCHHHHHHHcCC---HHHHHHHHH
Confidence 01122367899999999999999999999999 999999933459999999999999 999999999
Q ss_pred CCCCCCCCCCCCCCHHHHHHhCCCCCCHHHHHHHHHHCCCCCCCcccccccccccCCccccCCcCCCCCCcccCCCCCcc
Q 004266 200 AGADSNLTDAHGNRPFDVIVVHPNVPDSRVSLEDLLKNGGSVSFDELQVSSVDLRSSSSLSSSSDDSSLSSLTCKSDDVH 279 (765)
Q Consensus 200 ~GAdvn~~D~~G~TPLh~Aa~~g~~~~~~~ive~LL~~GAdvn~~n~~~~t~~~~~~s~l~~a~~~~~d~n~~dk~G~TP 279 (765)
+|+|++.+|..|+||||+|+.. +..+++++|+++|++++ .+|..|.||
T Consensus 214 ~gad~~~~d~~g~tpL~~A~~~----~~~~~v~~Ll~~ga~~~----------------------------~~~~~g~tp 261 (282)
T 1oy3_D 214 AGADPTARMYGGRTPLGSALLR----PNPILARLLRAHGAPEP----------------------------EDGGDKLSP 261 (282)
T ss_dssp TTCCTTCCCTTSCCHHHHHHTS----SCHHHHHHHHHTTCCCC----------------------------CCC------
T ss_pred cCCCCcccccCCCCHHHHHHHc----CCcHHHHHHHHcCCCcC----------------------------cCCCccccc
Confidence 9999999999999999999999 56779999999999999 789999999
Q ss_pred ccccccCCCc
Q 004266 280 AFVAPEKKEY 289 (765)
Q Consensus 280 LHlAaekk~y 289 (765)
|++|....+-
T Consensus 262 l~~a~~~~~~ 271 (282)
T 1oy3_D 262 CSSSGSDSDS 271 (282)
T ss_dssp ----------
T ss_pred ccccCCcccc
Confidence 9999765543
|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 | Back alignment and structure |
|---|
| >2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 765 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-14 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-11 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-08 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-07 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 5e-12 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 4e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 1e-07 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 0.002 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-11 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 4e-07 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 9e-07 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-06 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-10 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-05 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 1e-04 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 6e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-08 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 4e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-08 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 7e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-04 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 4e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.002 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-06 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 6e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 8e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 2e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 9e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 9e-04 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-05 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-04 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 7e-05 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 5e-04 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 1e-04 | |
| d1rgoa1 | 36 | g.66.1.1 (A:151-186) Butyrate response factor 2 (T | 2e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 4e-04 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.002 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 6e-04 | |
| d1m9oa_ | 40 | g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 | 8e-04 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 73.1 bits (178), Expect = 3e-14
Identities = 26/91 (28%), Positives = 36/91 (39%), Gaps = 5/91 (5%)
Query: 142 TPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLFAG 201
TPL VA+ G + +VK +L A N++ T LH AA G +V K LL
Sbjct: 2 TPLHVASFMGHLPIVKNLLQR-GASPNVSNV-KVETPLHMAARAGH---TEVAKYLLQNK 56
Query: 202 ADSNLTDAHGNRPFDVIVVHPNVPDSRVSLE 232
A N P + ++ LE
Sbjct: 57 AKVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 765 | |||
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.97 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.97 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.96 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.95 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.95 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.95 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.95 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.94 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.94 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.94 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.93 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.92 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.91 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.91 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.91 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.9 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.9 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.9 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.89 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.89 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.89 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.88 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.88 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.87 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.87 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.86 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.85 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.84 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.83 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.82 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.76 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 98.51 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 98.5 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 98.33 | |
| d1m9oa_ | 40 | Tristetraproline (ttp, tis11, nup475) {Mouse (Mus | 98.14 | |
| d1rgoa1 | 36 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 98.13 | |
| d1rgoa2 | 34 | Butyrate response factor 2 (Tis11D) {Human (Homo s | 97.85 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 93.39 | |
| d2cqea2 | 29 | Zinc finger CCCH domain-containing protein C19orf7 | 82.99 | |
| d2cqea1 | 56 | Zinc finger CCCH domain-containing protein C19orf7 | 80.04 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97 E-value=1.6e-30 Score=264.36 Aligned_cols=205 Identities=17% Similarity=0.088 Sum_probs=166.0
Q ss_pred cccCCCCCcHHHHH--------HHHHHHCCCC---cccccCCCCCCcHHHHHHHhcCceeccCccccccccCCCCCCCCC
Q 004266 6 AVTMRNKSSPLKIS--------ISIFQKHTQN---VFLVDFAINDRTLLILLFFQNYLIMCGGSEKLSSKALAPSASPPS 74 (765)
Q Consensus 6 ~vt~~ng~TPLH~A--------V~lLl~~gAd---Vn~~D~~~~G~TPLhlA~~~~~~i~c~~~e~lkl~~~~t~s~~~~ 74 (765)
...+.+|+||||+| +++|+++|++ ++..|. +|+||||+|+. .+...+.
T Consensus 3 ~~i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~--~g~TpL~~A~~-~g~~~iv------------------ 61 (255)
T d1oy3d_ 3 GYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQND--LGQTALHLAAI-LGEASTV------------------ 61 (255)
T ss_dssp CCCCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCT--TSCCHHHHHHH-HTCHHHH------------------
T ss_pred ccCCcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCC--CCCCccchHHh-hcccccc------------------
Confidence 34578999999995 5789999998 666677 89999999944 4433222
Q ss_pred hhHHHhccCCCCccCCCCCCchHHHHHHHcCCHHHHHHHHHCCCCCcccc----hhh------------hh---------
Q 004266 75 KPSLQRNMSNPTETMKSDHSFSRLLELAADNDVEGFKQCICDTSAICEVG----LWY------------SF--------- 129 (765)
Q Consensus 75 ~~~Ll~~~~~l~~~~~d~~G~TpLh~Aa~~G~~e~Vk~LLe~gadvn~~~----L~~------------a~--------- 129 (765)
+.|+..+.++ +..|.+|.||||+|+..|+.+++++|++.+...+... +.. ..
T Consensus 62 -~~Ll~~ga~i--~~~d~~g~tpL~~A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 138 (255)
T d1oy3d_ 62 -EKLYAAGAGV--LVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPEN 138 (255)
T ss_dssp -HHHHHTTCCS--SCCCTTSCCHHHHHTTTTCHHHHHHHSSSCCSSCCCC------------------------------
T ss_pred -cccccccccc--cccccccchhhhhhhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhH
Confidence 5677778777 7889999999999999999999999998543322110 000 00
Q ss_pred ---------hchhhhccCCCChHHHHHHHcCCHHHHHHHHhcCCCCcccccCCCCCcHHHHHHhCCCCCHHHHHHHHHHC
Q 004266 130 ---------QRLSKKIVLQHRTPLMVAAEYGSVDVVKLILSLTKADVNLTCGLDKSTALHCAASGGSVNAVDVVKLLLFA 200 (765)
Q Consensus 130 ---------~~g~~~id~~G~TPLH~Aa~~G~~evVk~LL~~~GAdVN~~~d~~G~TpLH~Aa~~G~~~~~eiVklLL~~ 200 (765)
.......+.+|.||||+||..|+.++|++||+. +++++...+..|.||||+|+..|+ .++|++||++
T Consensus 139 ~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~-~~~~~~~~~~~g~TpL~~A~~~~~---~~~v~~Ll~~ 214 (255)
T d1oy3d_ 139 EEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDA-GADLNKPEPTCGRTPLHLAVEAQA---ASVLELLLKA 214 (255)
T ss_dssp -----CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHH-TCCTTCCCTTTCCCHHHHHHHTTC---HHHHHHHHHT
T ss_pred HHHHHhhhcCcccccccccCcccccccccccccccccchhcc-cccccccccccccccccccccccH---HHHHHHHHHC
Confidence 001112357899999999999999999999999 999997657889999999999999 9999999999
Q ss_pred CCCCCCCCCCCCCHHHHHHhCCCCCCHHHHHHHHHHCCCCCC
Q 004266 201 GADSNLTDAHGNRPFDVIVVHPNVPDSRVSLEDLLKNGGSVS 242 (765)
Q Consensus 201 GAdvn~~D~~G~TPLh~Aa~~g~~~~~~~ive~LL~~GAdvn 242 (765)
|+|+|.+|.+|+||||+|+.. +..+++++|+++||+-+
T Consensus 215 gadin~~d~~g~t~L~~A~~~----~~~~i~~~Ll~~Ga~~~ 252 (255)
T d1oy3d_ 215 GADPTARMYGGRTPLGSALLR----PNPILARLLRAHGAPEP 252 (255)
T ss_dssp TCCTTCCCTTSCCHHHHHHTS----SCHHHHHHHHHTTCCCC
T ss_pred CCCCCCCCCCCCCHHHHHHHC----CCHHHHHHHHHcCCCCC
Confidence 999999999999999999999 66789999999999743
|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqea1 g.66.1.1 (A:458-513) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|