Citrus Sinensis ID: 004279


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760----
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
ccccccHHHHHHHHHHHHcccccccHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHcHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHHHccccccccc
ccccccEHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHcHHHHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHccccccEEEHHHHHHHHHHcccHHHHHHHHHHHHHcccccccEHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHccc
MYRPLLRTRFQLIADSFckskfhkherrnvANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHahhslgaddFFHILNycarspdplfVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLgerygiypilpvynsFLGACAKLHSMVHANLCLDLmdsrmvgknevTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYInrtsegrlrssrldipiplnalpVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQslglqpsshtydGFIRAIVSDRGLRNGMEVLKIMQqnnlkpqdstiATLSVECSKALELDLAEALLDQisrctnpkpfsAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLfgnvnapyeegnmfsqvDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFcdsktplgtptynTVLHSLVEAQESHRAMEIFKQmktcgippnaatynimIDCCSIIRCFKSASALVSMMVrdgfypqtMTYTALIKILLDYGDFDEALNLLdlvslegiphdVLLYNTILKKACEKGRIDVIEFIIEQMhqnkvqpdpstchfvfsgyvncgfhnSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTivgfpiswsldrasgledsqtnsnsrkqeia
myrpllrtrfQLIADSfckskfhkherrnvanklelsrtltttmglneesiskATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQqnnlkpqdsTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDrasgledsqtnsnsrkqeia
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEqlmlqmqslglqpssHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKaleldlaealldQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
****LLRTRFQLIADSFCKSKFHKH****V***L*L**TLT*************TQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNL***DSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLE*****FEDLILA******SRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLD********************
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRA******************
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRASGLEDSQTNSNSRKQEIA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query764 2.2.26 [Sep-21-2011]
Q9SGQ6773 Pentatricopeptide repeat- yes no 0.882 0.871 0.543 0.0
Q9SXD1630 Pentatricopeptide repeat- no no 0.451 0.547 0.248 3e-23
Q9CAN0630 Pentatricopeptide repeat- no no 0.679 0.823 0.219 7e-23
Q9LQ16632 Pentatricopeptide repeat- no no 0.668 0.808 0.220 7e-22
Q9SH26577 Pentatricopeptide repeat- no no 0.450 0.596 0.239 1e-20
Q9LQ14629 Pentatricopeptide repeat- no no 0.450 0.546 0.237 1e-20
Q9LSL9 915 Pentatricopeptide repeat- no no 0.698 0.583 0.226 2e-20
Q9SIC9 918 Pentatricopeptide repeat- no no 0.341 0.284 0.281 2e-20
Q9LFF1754 Pentatricopeptide repeat- no no 0.560 0.567 0.213 4e-20
Q9LVQ5 1096 Pentatricopeptide repeat- no no 0.683 0.476 0.211 1e-19
>sp|Q9SGQ6|PP126_ARATH Pentatricopeptide repeat-containing protein At1g76280 OS=Arabidopsis thaliana GN=At1g76280 PE=2 SV=2 Back     alignment and function desciption
 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/756 (54%), Positives = 535/756 (70%), Gaps = 82/756 (10%)

Query: 37  SRTLTTTMGLNE----ESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFH 92
           SR++TT +G NE    +  SK  Q+QIVDAL  GER  AS LL  L   ++SL ADDF  
Sbjct: 43  SRSVTTMIG-NEFIRCQDESKILQLQIVDALRSGERQGASALLFKLIQGNYSLSADDFHD 101

Query: 93  ILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERY 152
           IL YCARSPDP+FVMET+ +M +KEI L+++  L ++++LC GG+L++AS  I+ + E  
Sbjct: 102 ILYYCARSPDPVFVMETYSVMCKKEISLDSRSLLFIVKSLCNGGHLDKASEFIHAVREDD 161

Query: 153 GIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAV 212
            I P+LP+YN FLGACA+  S+ HA+ CL+LMD R VGKN +TY  LLKLAV+Q+NLS V
Sbjct: 162 RISPLLPIYNFFLGACARTRSVYHASKCLELMDQRRVGKNGITYVALLKLAVFQRNLSTV 221

Query: 213 HEIWEDYIKHYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRL 272
           ++IW+ Y+ HY+L I SLR+F+WSFTRL DLKSAYE LQHMV LA+ G+ ++ +++ G+L
Sbjct: 222 NDIWKHYVNHYNLDILSLRRFIWSFTRLGDLKSAYELLQHMVYLALRGEFFV-KSNRGKL 280

Query: 273 RSSRLDIPIPLN-------------------------ALP-------VMKVLRWSFSDVI 300
            S+RL IP+P                           ALP        ++VLRWSF+DVI
Sbjct: 281 HSTRLYIPVPSKDETGSEKFAFGVTDRIVDCNSSSKVALPKGHNKILAIRVLRWSFNDVI 340

Query: 301 HACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLK 360
           HACG+++NS LAEQLMLQ                                LK+MQQ NLK
Sbjct: 341 HACGQSKNSELAEQLMLQ--------------------------------LKVMQQQNLK 368

Query: 361 PQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAK 420
           P DST+AT++  CSKAL++DLAE LLDQIS C+   PF+  LAA D++D+PERA+++ A+
Sbjct: 369 PYDSTLATVAAYCSKALQVDLAEHLLDQISECSYSYPFNNLLAAYDSLDQPERAVRVLAR 428

Query: 421 MRQ-KLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHIS 479
           M++ KLRPD+RTYELLFSLFGNVNAPYEEGNM SQVD  KRINAIEMDM RN  QHS IS
Sbjct: 429 MKELKLRPDMRTYELLFSLFGNVNAPYEEGNMLSQVDCCKRINAIEMDMMRNGFQHSPIS 488

Query: 480 MKNLLKALGAEGMIRELIQYF-------CDSKTPLGTPTYNTVLHSLVEAQESHRAMEIF 532
             N+L+ALGAEGM+ E+I++          S   LGTPTYN VLHSL+EA E+   + IF
Sbjct: 489 RLNVLRALGAEGMVNEMIRHLQKAENLSAHSNMYLGTPTYNIVLHSLLEANETDMVINIF 548

Query: 533 KQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDY 592
           K+MK+CG P + ATYNIMIDCCS+I  +KSA ALVSMM+RDGF P+ +T+TAL+KILL+ 
Sbjct: 549 KRMKSCGCPADVATYNIMIDCCSLIHSYKSACALVSMMIRDGFSPKAVTFTALMKILLND 608

Query: 593 GDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTC 652
            +F+EALNLLD  +LE I  DVL YNTIL+KA EKG IDVIE+I+EQMH+ KV PDP+TC
Sbjct: 609 ANFEEALNLLDQAALEEIHLDVLSYNTILRKAFEKGMIDVIEYIVEQMHREKVNPDPTTC 668

Query: 653 HFVFSGYVNCGFHNSAMEALQVLSMRMLCEE-VSTLEEKRSDFED-LILAEDSEAESRIL 710
           H+VFS YV  G+H +A+EAL VLS+RML EE   +L++K+ + E+  +++ED EAE++I+
Sbjct: 669 HYVFSCYVEKGYHATAIEALNVLSLRMLNEEDKESLQDKKIELEENFVMSEDPEAETKII 728

Query: 711 QFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRA 746
           +    S E+LA  AALL LRWC ++G  I WS D++
Sbjct: 729 ELFRKSEEHLA--AALLNLRWCAMLGGRIIWSEDQS 762





Arabidopsis thaliana (taxid: 3702)
>sp|Q9SXD1|PPR91_ARATH Pentatricopeptide repeat-containing protein At1g62670, mitochondrial OS=Arabidopsis thaliana GN=At1g62670 PE=2 SV=2 Back     alignment and function description
>sp|Q9CAN0|PPR99_ARATH Pentatricopeptide repeat-containing protein At1g63130, mitochondrial OS=Arabidopsis thaliana GN=At1g63130 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protein At1g62910 OS=Arabidopsis thaliana GN=At1g62910 PE=2 SV=1 Back     alignment and function description
>sp|Q9SH26|PP102_ARATH Pentatricopeptide repeat-containing protein At1g63400 OS=Arabidopsis thaliana GN=At1g63400 PE=2 SV=1 Back     alignment and function description
>sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protein At1g62930, chloroplastic OS=Arabidopsis thaliana GN=At1g62930 PE=2 SV=2 Back     alignment and function description
>sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protein At5g65560 OS=Arabidopsis thaliana GN=At5g65560 PE=2 SV=1 Back     alignment and function description
>sp|Q9SIC9|PP178_ARATH Pentatricopeptide repeat-containing protein At2g31400, chloroplastic OS=Arabidopsis thaliana GN=At2g31400 PE=2 SV=1 Back     alignment and function description
>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein At3g53700, chloroplastic OS=Arabidopsis thaliana GN=MEE40 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protein At5g55840 OS=Arabidopsis thaliana GN=At5g55840 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
302141664804 unnamed protein product [Vitis vinifera] 0.968 0.920 0.631 0.0
225459866728 PREDICTED: pentatricopeptide repeat-cont 0.869 0.912 0.626 0.0
298111984805 pentatricopeptide repeat-containing prot 0.918 0.872 0.58 0.0
297842383800 pentatricopeptide repeat-containing prot 0.917 0.876 0.575 0.0
255572759802 pentatricopeptide repeat-containing prot 0.954 0.908 0.564 0.0
224057555705 predicted protein [Populus trichocarpa] 0.858 0.930 0.593 0.0
334183937801 pentatricopeptide repeat-containing prot 0.918 0.876 0.564 0.0
449503243806 PREDICTED: pentatricopeptide repeat-cont 0.951 0.901 0.558 0.0
6573717800 T23E18.21 [Arabidopsis thaliana] 0.905 0.865 0.543 0.0
449443982834 PREDICTED: pentatricopeptide repeat-cont 0.963 0.882 0.536 0.0
>gi|302141664|emb|CBI18867.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1003 bits (2594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/785 (63%), Positives = 610/785 (77%), Gaps = 45/785 (5%)

Query: 1   MYRPLLRTRFQLIADSFCKSKFHKHERRNVANKLELSRTLTTT-----MGLNEESISKAT 55
           M+R + R   + I+DS   SK   ++++N+  KLE  RT TT+      G   +SI++  
Sbjct: 1   MHRYVSRVPLRSISDSLYLSKSSVYDQKNLVRKLESLRTFTTSRDHDCFGYGRKSITRLL 60

Query: 56  QMQIVDALCRGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEE 115
           Q+QIVDAL   ERSRAS LL  LG  ++SL ADDF +IL +C++SPDPLFVME WR+M+E
Sbjct: 61  QVQIVDALRSNERSRASSLLSELGRGNYSLRADDFIYILEHCSKSPDPLFVMEIWRIMDE 120

Query: 116 KEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACAKLHSMV 175
           KE+ +NN+CY+L +QALCKGGYLEEA NL+ F+GE + I+PILP+YN+FL  C +  S++
Sbjct: 121 KEVHVNNRCYMLSIQALCKGGYLEEAFNLLNFVGENHDIHPILPMYNNFLRGCVQTRSLL 180

Query: 176 HANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYSLSIFSLRKFVW 235
           HAN CLDLM+ +++GKNEVTY++ LKLAV Q+NLSA H+IW++Y+ +YS+SI SLRKF+W
Sbjct: 181 HANQCLDLMEHQVLGKNEVTYSQFLKLAVLQQNLSAAHKIWKEYMTYYSMSIISLRKFIW 240

Query: 236 SFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLN----------- 284
           SFTRLRDL+SAY  LQHMV L   G ++IN+++EGRL SSRLDIPIP N           
Sbjct: 241 SFTRLRDLESAYAALQHMVDLVFKGSIFINKSAEGRLCSSRLDIPIPKNGDMGLKRCMEE 300

Query: 285 -------------------ALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQ 325
                              ++PVMKVLRWSFSDVI+AC +TQN GLAEQL+LQMQ+LGL+
Sbjct: 301 NEHSLPSVSDNSKKIDSHASMPVMKVLRWSFSDVIYACAQTQNCGLAEQLILQMQNLGLE 360

Query: 326 PSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEAL 385
           PS HTYDG I+AIVSDRG  +GMEVLK MQ  NLKP DST+A LS+  SKAL+LDLAE+L
Sbjct: 361 PSCHTYDGLIKAIVSDRGFSDGMEVLKTMQLRNLKPYDSTLAALSIGSSKALQLDLAESL 420

Query: 386 LDQISRCTNPKPFSAFLAACDTMDKPERAIKIFAKMRQ-KLRPDIRTYELLFSLFGNVNA 444
           LDQISR +   PF+AFLAACDT+D+PERA+ I +KM+Q KL+P++ TYELLFSLFGNVNA
Sbjct: 421 LDQISRISYVHPFNAFLAACDTLDQPERAVPILSKMKQLKLQPNVGTYELLFSLFGNVNA 480

Query: 445 PYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQY----- 499
           PYEEGNM SQVD A+RI AIEMDM  N IQHSH+SMKNLLKALGAEGMIREL+QY     
Sbjct: 481 PYEEGNMLSQVDVARRIKAIEMDMMNNGIQHSHLSMKNLLKALGAEGMIRELMQYLHVAE 540

Query: 500 --FCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSII 557
             F  + T LGTP YNTVLHSLVEA+ESH A+EIFK M +  +P +AATYNIMIDCCS I
Sbjct: 541 NQFFRTNTYLGTPIYNTVLHSLVEAKESHIAIEIFKNMISRSLPRDAATYNIMIDCCSTI 600

Query: 558 RCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLY 617
           +C+KSA ALVSMM+RDGF P T+TYTALIKILL+  DFDEALNLLD   LE IP DVLLY
Sbjct: 601 KCYKSACALVSMMMRDGFLPWTLTYTALIKILLEREDFDEALNLLDQARLEEIPSDVLLY 660

Query: 618 NTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSM 677
           NTIL+KAC KGRID+IE + EQMHQ K+QPDPSTC++VFS YV+ GF ++A+E+LQVLSM
Sbjct: 661 NTILQKACLKGRIDLIELVAEQMHQEKIQPDPSTCYYVFSSYVDGGFFSTALESLQVLSM 720

Query: 678 RMLCEEVSTLEEKRSDFEDLILAEDSEAESRILQFCEDSNENLAFTAALLQLRWCTIVGF 737
           RM+ E+ STLEEKR++ ED I +ED +AES+ILQF + S+ENLA   ALL LRWC I G 
Sbjct: 721 RMISEDNSTLEEKRTELEDFIHSEDKDAESQILQFFKGSDENLAI--ALLNLRWCAISGS 778

Query: 738 PISWS 742
           PISW+
Sbjct: 779 PISWT 783




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225459866|ref|XP_002284840.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|298111984|gb|ADI58371.1| pentatricopeptide repeat-containing protein [Capsicum annuum] Back     alignment and taxonomy information
>gi|297842383|ref|XP_002889073.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297334914|gb|EFH65332.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|255572759|ref|XP_002527312.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533312|gb|EEF35064.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224057555|ref|XP_002299265.1| predicted protein [Populus trichocarpa] gi|222846523|gb|EEE84070.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334183937|ref|NP_001185409.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|332197699|gb|AEE35820.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449503243|ref|XP_004161905.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|6573717|gb|AAF17637.1|AC009978_13 T23E18.21 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449443982|ref|XP_004139754.1| PREDICTED: pentatricopeptide repeat-containing protein At1g76280-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query764
TAIR|locus:2015208630 AT1G63130 [Arabidopsis thalian 0.679 0.823 0.212 3.1e-19
TAIR|locus:2026192630 RPF2 "rna processing factor 2" 0.447 0.542 0.232 1.8e-17
TAIR|locus:2031301577 AT1G63400 [Arabidopsis thalian 0.401 0.532 0.246 8.4e-17
TAIR|locus:2061310 918 GUN1 "AT2G31400" [Arabidopsis 0.341 0.284 0.281 1.2e-16
TAIR|locus:2015494629 RPF3 "RNA processing factor 3" 0.447 0.543 0.237 2.2e-16
TAIR|locus:2015228614 AT1G63080 [Arabidopsis thalian 0.678 0.843 0.205 7.3e-16
TAIR|locus:21167721112 PGR3 "AT4G31850" [Arabidopsis 0.430 0.295 0.212 8.8e-16
TAIR|locus:2098495 880 AT3G07290 "AT3G07290" [Arabido 0.445 0.386 0.211 9.2e-16
TAIR|locus:2173403730 AT5G64320 "AT5G64320" [Arabido 0.320 0.335 0.247 1.3e-15
TAIR|locus:2083976754 MEE40 "maternal effect embryo 0.578 0.586 0.202 2.3e-15
TAIR|locus:2015208 AT1G63130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 3.1e-19, P = 3.1e-19
 Identities = 116/546 (21%), Positives = 221/546 (40%)

Query:   155 YPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHE 214
             +P +  ++  L A AK++         + M +  +  N  TY+ L+     +  LS    
Sbjct:    78 FPSIVEFSKLLSAIAKMNKFDLVISLGEQMQNLGISHNLYTYSILINCFCRRSQLSLALA 137

Query:   215 IWEDYIK-HYSLSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLY-INRTSEGRL 272
             +    +K  Y   I +L   +  F     +  A   +  MV +      +  N    G  
Sbjct:   138 VLAKMMKLGYEPDIVTLNSLLNGFCHGNRISDAVSLVGQMVEMGYQPDSFTFNTLIHGLF 197

Query:   273 RSSRLDIPIPLNALPVMKVLR---WSFSDVIHACGRTQNSGLAEXXXXXXXXXXXXXXXH 329
             R +R    + L    V+K  +    ++  V++   +  +  LA                 
Sbjct:   198 RHNRASEAVALVDRMVVKGCQPDLVTYGIVVNGLCKRGDIDLALSLLKKMEQGKIEPGVV 257

Query:   330 TYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATL-SVECSKXXXXXXXXXXXXQ 388
              Y+  I A+ + + + + + +   M    ++P   T  +L    C+              
Sbjct:   258 IYNTIIDALCNYKNVNDALNLFTEMDNKGIRPNVVTYNSLIRCLCNYGRWSDASRLLSDM 317

Query:   389 ISRCTNPK--PFSAFLAACDTMDKPERAIKIFAKM-RQKLRPDIRTYELLFSLFGNVNAP 445
             I R  NP    FSA + A     K   A K++ +M ++ + PDI TY  L + F      
Sbjct:   318 IERKINPNVVTFSALIDAFVKEGKLVEAEKLYDEMIKRSIDPDIFTYSSLINGFC----- 372

Query:   446 YEEGNMFSQVDSAKRINA--IEMDMARNNIQHSHISMKNLLKALGA-EGMIRELIQYFCD 502
                  M  ++D AK +    I  D   N + ++ + +K   KA    EGM  EL +    
Sbjct:   373 -----MHDRLDEAKHMFELMISKDCFPNVVTYNTL-IKGFCKAKRVDEGM--ELFREMSQ 424

Query:   503 SKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMID-CCSIIRCFK 561
                   T TY T++H   +A+E   A  +FKQM + G+ P+  TY+I++D  C+  +  +
Sbjct:   425 RGLVGNTVTYTTLIHGFFQARECDNAQIVFKQMVSDGVLPDIMTYSILLDGLCNNGKV-E 483

Query:   562 SASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTIL 621
             +A  +   + R    P   TY  +I+ +   G  ++  +L   +SL+G+  +V+ Y T++
Sbjct:   484 TALVVFEYLQRSKMEPDIYTYNIMIEGMCKAGKVEDGWDLFCSLSLKGVKPNVVTYTTMM 543

Query:   622 KKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSMRMLC 681
                C KG  +  + +  +M +    PD  T + +   ++  G   ++ E ++ +      
Sbjct:   544 SGFCRKGLKEEADALFREMKEEGPLPDSGTYNTLIRAHLRDGDKAASAELIREMRSCRFV 603

Query:   682 EEVSTL 687
              + ST+
Sbjct:   604 GDASTI 609


GO:0005739 "mitochondrion" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2026192 RPF2 "rna processing factor 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2031301 AT1G63400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2061310 GUN1 "AT2G31400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015494 RPF3 "RNA processing factor 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015228 AT1G63080 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116772 PGR3 "AT4G31850" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098495 AT3G07290 "AT3G07290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2173403 AT5G64320 "AT5G64320" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083976 MEE40 "maternal effect embryo arrest 40" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SGQ6PP126_ARATHNo assigned EC number0.54360.88210.8719yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015570001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (768 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 2e-12
pfam1304150 pfam13041, PPR_2, PPR repeat family 5e-12
PLN03218 1060 PLN03218, PLN03218, maturation of RBCL 1; Provisio 3e-07
pfam1304150 pfam13041, PPR_2, PPR repeat family 9e-06
TIGR0075635 TIGR00756, PPR, pentatricopeptide repeat domain (P 1e-04
pfam1381234 pfam13812, PPR_3, Pentatricopeptide repeat domain 7e-04
pfam1304150 pfam13041, PPR_2, PPR repeat family 0.001
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
 Score = 71.1 bits (174), Expect = 2e-12
 Identities = 82/378 (21%), Positives = 165/378 (43%), Gaps = 53/378 (14%)

Query: 285 ALPVMKVLRWS--------FSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSSHTYDGFIR 336
           AL V+++++ +        ++ +I  C ++       ++  +M + G++ + HT+   I 
Sbjct: 456 ALRVLRLVQEAGLKADCKLYTTLISTCAKSGKVDAMFEVFHEMVNAGVEANVHTFGALI- 514

Query: 337 AIVSDRGLRNGMEVLK------IMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQIS 390
               D   R G +V K      IM+  N+KP       L   C ++  +D A  +L ++ 
Sbjct: 515 ----DGCARAG-QVAKAFGAYGIMRSKNVKPDRVVFNALISACGQSGAVDRAFDVLAEMK 569

Query: 391 RCTNP-KP----FSAFLAACDTMDKPERAIKIFAKMRQ---KLRPDIRTYELLFSLFGNV 442
             T+P  P      A + AC    + +RA +++  + +   K  P++ T          V
Sbjct: 570 AETHPIDPDHITVGALMKACANAGQVDRAKEVYQMIHEYNIKGTPEVYTIA--------V 621

Query: 443 NAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCD 502
           N+  ++G+     D A    +I  DM +  ++   +    L+   G  G + +  +   D
Sbjct: 622 NSCSQKGD----WDFAL---SIYDDMKKKGVKPDEVFFSALVDVAGHAGDLDKAFEILQD 674

Query: 503 SKT---PLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRC 559
           ++     LGT +Y++++ +   A+   +A+E+++ +K+  + P  +T N +I        
Sbjct: 675 ARKQGIKLGTVSYSSLMGACSNAKNWKKALELYEDIKSIKLRPTVSTMNALITALCEGNQ 734

Query: 560 FKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNT 619
              A  ++S M R G  P T+TY+ L+       D D  L+LL     +GI  ++++   
Sbjct: 735 LPKALEVLSEMKRLGLCPNTITYSILLVASERKDDADVGLDLLSQAKEDGIKPNLVMCRC 794

Query: 620 I-------LKKACEKGRI 630
           I        +KAC  G  
Sbjct: 795 ITGLCLRRFEKACALGEP 812


Length = 1060

>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|215636 PLN03218, PLN03218, maturation of RBCL 1; Provisional Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information
>gnl|CDD|213555 TIGR00756, PPR, pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>gnl|CDD|205985 pfam13812, PPR_3, Pentatricopeptide repeat domain Back     alignment and domain information
>gnl|CDD|205222 pfam13041, PPR_2, PPR repeat family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 764
PLN03077857 Protein ECB2; Provisional 100.0
PLN03077 857 Protein ECB2; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN032181060 maturation of RBCL 1; Provisional 100.0
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.96
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.9
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.85
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.85
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
PRK11788389 tetratricopeptide repeat protein; Provisional 99.84
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.8
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.8
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.8
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.8
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.79
KOG4422625 consensus Uncharacterized conserved protein [Funct 99.78
PRK15174656 Vi polysaccharide export protein VexE; Provisional 99.78
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.75
PRK14574 822 hmsH outer membrane protein; Provisional 99.74
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.72
KOG2076895 consensus RNA polymerase III transcription factor 99.7
KOG2003840 consensus TPR repeat-containing protein [General f 99.67
KOG2076895 consensus RNA polymerase III transcription factor 99.63
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.63
KOG4318 1088 consensus Bicoid mRNA stability factor [RNA proces 99.61
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.61
KOG1915677 consensus Cell cycle control protein (crooked neck 99.52
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.51
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.51
KOG2003840 consensus TPR repeat-containing protein [General f 99.48
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.44
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.44
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.43
KOG1915677 consensus Cell cycle control protein (crooked neck 99.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.37
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.34
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.34
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.34
KOG1126638 consensus DNA-binding cell division cycle control 99.33
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.33
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.33
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.31
PF1304150 PPR_2: PPR repeat family 99.31
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.3
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.29
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 99.29
KOG0547606 consensus Translocase of outer mitochondrial membr 99.26
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 99.26
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.24
PF1304150 PPR_2: PPR repeat family 99.23
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.23
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.21
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.21
KOG1129478 consensus TPR repeat-containing protein [General f 99.19
KOG0547606 consensus Translocase of outer mitochondrial membr 99.19
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.18
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.15
KOG2376652 consensus Signal recognition particle, subunit Srp 99.13
PRK12370553 invasion protein regulator; Provisional 99.11
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.11
PRK12370553 invasion protein regulator; Provisional 99.09
KOG1129478 consensus TPR repeat-containing protein [General f 99.04
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.03
KOG2376652 consensus Signal recognition particle, subunit Srp 98.99
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.97
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.97
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.96
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.94
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.94
KOG09851666 consensus Vesicle coat protein clathrin, heavy cha 98.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.93
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.91
PRK11189296 lipoprotein NlpI; Provisional 98.89
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.88
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 98.85
PRK11189296 lipoprotein NlpI; Provisional 98.84
KOG4162799 consensus Predicted calmodulin-binding protein [Si 98.84
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.83
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.82
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.76
KOG11271238 consensus TPR repeat-containing protein [RNA proce 98.72
cd05804355 StaR_like StaR_like; a well-conserved protein foun 98.66
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.63
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.63
PF1285434 PPR_1: PPR repeat 98.62
KOG4340459 consensus Uncharacterized conserved protein [Funct 98.59
PF1285434 PPR_1: PPR repeat 98.57
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.56
PRK04841903 transcriptional regulator MalT; Provisional 98.52
KOG1125579 consensus TPR repeat-containing protein [General f 98.5
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.49
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.48
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.42
PRK04841903 transcriptional regulator MalT; Provisional 98.42
KOG1125579 consensus TPR repeat-containing protein [General f 98.39
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.36
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.35
KOG1914656 consensus mRNA cleavage and polyadenylation factor 98.35
PLN02789320 farnesyltranstransferase 98.33
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.33
PLN02789320 farnesyltranstransferase 98.32
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.32
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.31
KOG1128777 consensus Uncharacterized conserved protein, conta 98.27
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.25
KOG1128777 consensus Uncharacterized conserved protein, conta 98.24
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 98.24
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.2
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.1
PRK10370198 formate-dependent nitrite reductase complex subuni 98.1
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.09
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.04
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.03
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 98.03
PRK10370198 formate-dependent nitrite reductase complex subuni 98.01
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.01
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.01
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.99
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 97.98
PRK15359144 type III secretion system chaperone protein SscB; 97.96
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.95
PRK15359144 type III secretion system chaperone protein SscB; 97.94
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.9
PF1381234 PPR_3: Pentatricopeptide repeat domain 97.9
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.9
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.81
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.76
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 97.76
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.76
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.74
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.71
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.69
PF10037429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.68
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.66
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.66
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.64
PF10037 429 MRP-S27: Mitochondrial 28S ribosomal protein S27; 97.63
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 97.62
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.59
PF08579120 RPM2: Mitochondrial ribonuclease P subunit (RPM2); 97.58
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 97.56
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.56
KOG20411189 consensus WD40 repeat protein [General function pr 97.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.5
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.42
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.36
PF04840319 Vps16_C: Vps16, C-terminal region; InterPro: IPR00 97.14
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.13
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.13
KOG20411189 consensus WD40 repeat protein [General function pr 97.12
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.1
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.09
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 97.08
PF06239228 ECSIT: Evolutionarily conserved signalling interme 97.06
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.05
KOG2280829 consensus Vacuolar assembly/sorting protein VPS16 97.02
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.02
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.02
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.01
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.99
PF06239228 ECSIT: Evolutionarily conserved signalling interme 96.94
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.91
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.91
KOG15381081 consensus Uncharacterized conserved protein WDR10, 96.9
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.9
COG4700251 Uncharacterized protein conserved in bacteria cont 96.88
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.85
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.85
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.81
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.8
KOG0553304 consensus TPR repeat-containing protein [General f 96.77
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.69
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.66
KOG0553304 consensus TPR repeat-containing protein [General f 96.65
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.63
PF12688120 TPR_5: Tetratrico peptide repeat 96.62
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.6
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 96.53
COG3898531 Uncharacterized membrane-bound protein [Function u 96.52
PF12688120 TPR_5: Tetratrico peptide repeat 96.5
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.5
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.43
KOG2796366 consensus Uncharacterized conserved protein [Funct 96.43
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.41
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 96.36
COG4700251 Uncharacterized protein conserved in bacteria cont 96.35
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 96.22
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.21
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 96.19
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 96.18
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.15
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 96.15
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.1
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.07
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 96.07
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 96.02
KOG1130639 consensus Predicted G-alpha GTPase interaction pro 95.99
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 95.93
PRK10803263 tol-pal system protein YbgF; Provisional 95.83
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.79
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.78
PRK10803263 tol-pal system protein YbgF; Provisional 95.77
PF12921126 ATP13: Mitochondrial ATPase expression; InterPro: 95.71
PF1337173 TPR_9: Tetratricopeptide repeat 95.55
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.55
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.48
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.41
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.33
KOG3941406 consensus Intermediate in Toll signal transduction 95.31
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.28
PF1337173 TPR_9: Tetratricopeptide repeat 95.05
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 95.04
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 94.84
KOG1585308 consensus Protein required for fusion of vesicles 94.82
PF13170297 DUF4003: Protein of unknown function (DUF4003) 94.7
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.67
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 94.51
COG3898531 Uncharacterized membrane-bound protein [Function u 94.42
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 94.14
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 94.08
COG3118304 Thioredoxin domain-containing protein [Posttransla 93.94
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.85
PF13512142 TPR_18: Tetratricopeptide repeat 93.84
KOG2610 491 consensus Uncharacterized conserved protein [Funct 93.83
PRK15331165 chaperone protein SicA; Provisional 93.76
PRK15331165 chaperone protein SicA; Provisional 93.69
KOG3941406 consensus Intermediate in Toll signal transduction 93.63
PF13170297 DUF4003: Protein of unknown function (DUF4003) 93.58
smart00299140 CLH Clathrin heavy chain repeat homology. 93.56
PF13512142 TPR_18: Tetratricopeptide repeat 93.54
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.46
KOG4555175 consensus TPR repeat-containing protein [Function 93.34
COG1747711 Uncharacterized N-terminal domain of the transcrip 93.34
smart00299140 CLH Clathrin heavy chain repeat homology. 93.18
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 93.05
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 93.01
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.97
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 92.85
KOG1941518 consensus Acetylcholine receptor-associated protei 92.76
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.71
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 92.6
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 92.5
COG3118304 Thioredoxin domain-containing protein [Posttransla 92.38
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.08
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 91.85
PF07035167 Mic1: Colon cancer-associated protein Mic1-like; I 91.84
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 91.78
KOG4555175 consensus TPR repeat-containing protein [Function 91.37
KOG1550552 consensus Extracellular protein SEL-1 and related 90.79
KOG1585308 consensus Protein required for fusion of vesicles 90.76
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 90.17
KOG1941518 consensus Acetylcholine receptor-associated protei 90.0
COG3629280 DnrI DNA-binding transcriptional activator of the 89.84
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 89.79
PF1342844 TPR_14: Tetratricopeptide repeat 89.45
PF1342844 TPR_14: Tetratricopeptide repeat 89.25
COG0457291 NrfG FOG: TPR repeat [General function prediction 89.15
PRK11906458 transcriptional regulator; Provisional 88.99
KOG4570418 consensus Uncharacterized conserved protein [Funct 88.8
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.62
KOG2610491 consensus Uncharacterized conserved protein [Funct 88.41
COG3629280 DnrI DNA-binding transcriptional activator of the 88.26
PRK11906458 transcriptional regulator; Provisional 88.14
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 88.13
COG4649221 Uncharacterized protein conserved in bacteria [Fun 87.46
KOG4570 418 consensus Uncharacterized conserved protein [Funct 87.41
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 87.38
PF00637143 Clathrin: Region in Clathrin and VPS; InterPro: IP 86.86
KOG1920 1265 consensus IkappaB kinase complex, IKAP component [ 86.5
PF1343134 TPR_17: Tetratricopeptide repeat 86.5
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 86.2
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 86.09
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 85.6
PF1343134 TPR_17: Tetratricopeptide repeat 85.49
PF04097 613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 84.91
KOG1586288 consensus Protein required for fusion of vesicles 84.9
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.67
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.64
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 84.36
COG4649221 Uncharacterized protein conserved in bacteria [Fun 84.34
COG0457291 NrfG FOG: TPR repeat [General function prediction 84.23
cd00923103 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va. 83.58
PF02284108 COX5A: Cytochrome c oxidase subunit Va; InterPro: 82.69
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 82.67
PF13929292 mRNA_stabil: mRNA stabilisation 82.37
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 81.34
KOG2066846 consensus Vacuolar assembly/sorting protein VPS41 81.08
KOG1550552 consensus Extracellular protein SEL-1 and related 81.06
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 80.86
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.2e-88  Score=779.38  Aligned_cols=658  Identities=15%  Similarity=0.154  Sum_probs=609.9

Q ss_pred             HHHHHHHHhhcccchhhhhccccccchhhhhccccCCchhhhHHHHHHHHHHHHhcCCcchHHHHHHHhhhccCCCCcch
Q 004279           10 FQLIADSFCKSKFHKHERRNVANKLELSRTLTTTMGLNEESISKATQMQIVDALCRGERSRASHLLLNLGHAHHSLGADD   89 (764)
Q Consensus        10 ~~~~~~~~~~~g~~~~a~~~~~~~~~~~r~~~~~~~~~p~~~~~~~~~~i~~~~~~~~~~~A~~~~~~~~~~~~~~~~~~   89 (764)
                      ...++..|++.|+.++|. .+|+++             |+++..+|+.+|.+|++.|++++|+++|++|...|+.||..|
T Consensus       124 ~n~li~~~~~~g~~~~A~-~~f~~m-------------~~~d~~~~n~li~~~~~~g~~~~A~~~f~~M~~~g~~Pd~~t  189 (857)
T PLN03077        124 GNAMLSMFVRFGELVHAW-YVFGKM-------------PERDLFSWNVLVGGYAKAGYFDEALCLYHRMLWAGVRPDVYT  189 (857)
T ss_pred             HHHHHHHHHhCCChHHHH-HHHhcC-------------CCCCeeEHHHHHHHHHhCCCHHHHHHHHHHHHHcCCCCChhH
Confidence            456788899999999999 555555             345678899999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCChhHHHHHHHHHHHcCccccHHHHHHHHHHHHccCCHHHHHHHHHHHhhhcCCCCChhhhHHHHHHHh
Q 004279           90 FFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNLIYFLGERYGIYPILPVYNSFLGACA  169 (764)
Q Consensus        90 ~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~~~li~~~~  169 (764)
                      |+.++++|+..+++..+.+++..|.+.|+.||..+|++||.+|++.|++++|.++|++|.+     ||.++||+||.+|+
T Consensus       190 ~~~ll~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~lf~~m~~-----~d~~s~n~li~~~~  264 (857)
T PLN03077        190 FPCVLRTCGGIPDLARGREVHAHVVRFGFELDVDVVNALITMYVKCGDVVSARLVFDRMPR-----RDCISWNAMISGYF  264 (857)
T ss_pred             HHHHHHHhCCccchhhHHHHHHHHHHcCCCcccchHhHHHHHHhcCCCHHHHHHHHhcCCC-----CCcchhHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999963     68899999999999


Q ss_pred             ccCCHHHHHHHHHHHHhcCCCCChhhHHHHHHHHHhccChhHHHHHHHHHHc-cCCCCHHhHHHHHHHhhccCCHHHHHH
Q 004279          170 KLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIK-HYSLSIFSLRKFVWSFTRLRDLKSAYE  248 (764)
Q Consensus       170 ~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~-~~~~~~~~~~~li~~~~~~g~~~~A~~  248 (764)
                      +.|++++|+++|++|.+.|+.||..||+.+|.+|.+.|+++.+.+++..+.+ +..||..+|+.|+.+|++.|++++|.+
T Consensus       265 ~~g~~~eAl~lf~~M~~~g~~Pd~~ty~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~d~~~~n~Li~~y~k~g~~~~A~~  344 (857)
T PLN03077        265 ENGECLEGLELFFTMRELSVDPDLMTITSVISACELLGDERLGREMHGYVVKTGFAVDVSVCNSLIQMYLSLGSWGEAEK  344 (857)
T ss_pred             hCCCHHHHHHHHHHHHHcCCCCChhHHHHHHHHHHhcCChHHHHHHHHHHHHhCCccchHHHHHHHHHHHhcCCHHHHHH
Confidence            9999999999999999999999999999999999999999999999999997 699999999999999999999999999


Q ss_pred             HHHHHHHhhhcccchhcccccccccccccCCCccCCcccchhhhHhhHHHHHHHHHccCCHHHHHHHHHHHHHCCCCCCc
Q 004279          249 TLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACGRTQNSGLAEQLMLQMQSLGLQPSS  328 (764)
Q Consensus       249 ~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~g~~p~~  328 (764)
                      +|++|.+    |+.                               .+||++|.+|++.|++++|+++|++|.+.|+.||.
T Consensus       345 vf~~m~~----~d~-------------------------------~s~n~li~~~~~~g~~~~A~~lf~~M~~~g~~Pd~  389 (857)
T PLN03077        345 VFSRMET----KDA-------------------------------VSWTAMISGYEKNGLPDKALETYALMEQDNVSPDE  389 (857)
T ss_pred             HHhhCCC----CCe-------------------------------eeHHHHHHHHHhCCCHHHHHHHHHHHHHhCCCCCc
Confidence            9999964    444                               69999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCchhHHHHHHHHHHhcCCHHHHHHHHHHHhhCCCCcchHHHHHHHhcC
Q 004279          329 HTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDLAEALLDQISRCTNPKPFSAFLAACDTM  408 (764)
Q Consensus       329 ~t~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~li~~~~~~  408 (764)
                      .||+.++.+|++.|+++.|.++++.|.+.|+.|+..++++||++|+++|++++|.++|++|.+. |.++||++|.+|++.
T Consensus       390 ~t~~~ll~a~~~~g~~~~a~~l~~~~~~~g~~~~~~~~n~Li~~y~k~g~~~~A~~vf~~m~~~-d~vs~~~mi~~~~~~  468 (857)
T PLN03077        390 ITIASVLSACACLGDLDVGVKLHELAERKGLISYVVVANALIEMYSKCKCIDKALEVFHNIPEK-DVISWTSIIAGLRLN  468 (857)
T ss_pred             eeHHHHHHHHhccchHHHHHHHHHHHHHhCCCcchHHHHHHHHHHHHcCCHHHHHHHHHhCCCC-CeeeHHHHHHHHHHC
Confidence            9999999999999999999999999999999999999999999999999999999999999987 999999999999999


Q ss_pred             CCHHHHHHHHHHHhhccCCCHHhHHHHHHHhcCCCCchhhchhhhhhhhHHHHHHHHHHHHHCCCCCcHHHHHHHHHHHh
Q 004279          409 DKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAKRINAIEMDMARNNIQHSHISMKNLLKALG  488 (764)
Q Consensus       409 g~~~~a~~l~~~m~~~~~p~~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~  488 (764)
                      |+.++|+.+|++|..+++||..||+.+|.+|++.|.+             +....++..+.+.|+.++..++|+|+++|+
T Consensus       469 g~~~eA~~lf~~m~~~~~pd~~t~~~lL~a~~~~g~l-------------~~~~~i~~~~~~~g~~~~~~~~naLi~~y~  535 (857)
T PLN03077        469 NRCFEALIFFRQMLLTLKPNSVTLIAALSACARIGAL-------------MCGKEIHAHVLRTGIGFDGFLPNALLDLYV  535 (857)
T ss_pred             CCHHHHHHHHHHHHhCCCCCHhHHHHHHHHHhhhchH-------------HHhHHHHHHHHHhCCCccceechHHHHHHH
Confidence            9999999999999889999999999999999998765             566778889999999999999999999999


Q ss_pred             ccCcHHHHHHHHHhcCCCCChhhHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCChhHHHHHHH
Q 004279          489 AEGMIRELIQYFCDSKTPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVS  568 (764)
Q Consensus       489 ~~g~~~~a~~~~~~~~~~~~~~~~~~li~~~~~~~~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~  568 (764)
                      ++|++++|.++|+.+  .+|.++||+||.+|+++|+.++|+++|++|.+.|+.||..||+.+|.+|++.|++++|.++|+
T Consensus       536 k~G~~~~A~~~f~~~--~~d~~s~n~lI~~~~~~G~~~~A~~lf~~M~~~g~~Pd~~T~~~ll~a~~~~g~v~ea~~~f~  613 (857)
T PLN03077        536 RCGRMNYAWNQFNSH--EKDVVSWNILLTGYVAHGKGSMAVELFNRMVESGVNPDEVTFISLLCACSRSGMVTQGLEYFH  613 (857)
T ss_pred             HcCCHHHHHHHHHhc--CCChhhHHHHHHHHHHcCCHHHHHHHHHHHHHcCCCCCcccHHHHHHHHhhcChHHHHHHHHH
Confidence            999999999999998  889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHH-HCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCC
Q 004279          569 MMV-RDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQP  647 (764)
Q Consensus       569 ~~~-~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~p~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p  647 (764)
                      .|. +.|+.|+..+|++++++|++.|++++|.+++++|   +++||..+|++|+.+|..+|+.+.++...+++.+  +.|
T Consensus       614 ~M~~~~gi~P~~~~y~~lv~~l~r~G~~~eA~~~~~~m---~~~pd~~~~~aLl~ac~~~~~~e~~e~~a~~l~~--l~p  688 (857)
T PLN03077        614 SMEEKYSITPNLKHYACVVDLLGRAGKLTEAYNFINKM---PITPDPAVWGALLNACRIHRHVELGELAAQHIFE--LDP  688 (857)
T ss_pred             HHHHHhCCCCchHHHHHHHHHHHhCCCHHHHHHHHHHC---CCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHh--hCC
Confidence            999 6799999999999999999999999999999998   4799999999999999999999999999999985  677


Q ss_pred             CHhhHHHH-HHHHHhcCChHHHHHHHHHHHHhhhcccc-CchHhhHHHHHHhhhhccHHHH-------------------
Q 004279          648 DPSTCHFV-FSGYVNCGFHNSAMEALQVLSMRMLCEEV-STLEEKRSDFEDLILAEDSEAE-------------------  706 (764)
Q Consensus       648 ~~~~~~~l-l~~~~~~g~~~~a~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~-------------------  706 (764)
                      +...++.+ .+.|+..|+|++|.++.+.|+.+|+.+.+ ++|+++.+.++.|+.++..++.                   
T Consensus       689 ~~~~~y~ll~n~ya~~g~~~~a~~vr~~M~~~g~~k~~g~s~ie~~~~~~~f~~~d~~h~~~~~i~~~l~~l~~~~~~~g  768 (857)
T PLN03077        689 NSVGYYILLCNLYADAGKWDEVARVRKTMRENGLTVDPGCSWVEVKGKVHAFLTDDESHPQIKEINTVLEGFYEKMKASG  768 (857)
T ss_pred             CCcchHHHHHHHHHHCCChHHHHHHHHHHHHcCCCCCCCccEEEECCEEEEEecCCCCCcchHHHHHHHHHHHHHHHhCC
Confidence            76655554 56999999999999999999999998765 7887776666666555433211                   


Q ss_pred             -------------HHHHHHhhhcchhhHHHHhhhhhhhhhccCCccccccccc
Q 004279          707 -------------SRILQFCEDSNENLAFTAALLQLRWCTIVGFPISWSLDRA  746 (764)
Q Consensus       707 -------------~~~~~~~~~~~e~~a~~~~l~~~~~~~~~~~~~~~~~~~~  746 (764)
                                   .+--+.+..|+|+||+++||+++    ++|.||++.|+-.
T Consensus       769 ~~~~~~~~~~~~~~~k~~~~~~hse~la~a~~l~~~----~~~~~i~i~knlr  817 (857)
T PLN03077        769 LAGSESSSMDEIEVSKDDIFCGHSERLAIAFGLINT----VPGMPIWVTKNLY  817 (857)
T ss_pred             cCCCcchhccccHHHHHHHHHhccHHHHHHHhhhcC----CCCCeEEEeCCCE
Confidence                         11223466799999999999999    9999999998754



>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG4318 consensus Bicoid mRNA stability factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF10037 MRP-S27: Mitochondrial 28S ribosomal protein S27; InterPro: IPR019266 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08579 RPM2: Mitochondrial ribonuclease P subunit (RPM2); InterPro: IPR013888 Ribonuclease P (RNase P) generates mature tRNA molecules by cleaving their 5' ends Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04840 Vps16_C: Vps16, C-terminal region; InterPro: IPR006925 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG2280 consensus Vacuolar assembly/sorting protein VPS16 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF06239 ECSIT: Evolutionarily conserved signalling intermediate in Toll pathway; InterPro: IPR010418 Activation of NF-kappaB as a consequence of signalling through the Toll and IL-1 receptors is a major element of innate immune responses Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12921 ATP13: Mitochondrial ATPase expression; InterPro: IPR024319 ATPase expression protein 2 (also known as ATP13 in some species) is necessary for the expression of subunit 9 of mitochondrial ATPase Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG3941 consensus Intermediate in Toll signal transduction pathway (ECSIT) [Signal transduction mechanisms] Back     alignment and domain information
>PF13170 DUF4003: Protein of unknown function (DUF4003) Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF07035 Mic1: Colon cancer-associated protein Mic1-like; InterPro: IPR009755 This entry represents the C terminus (approximately 160 residues) of a number of proteins that resemble colon cancer-associated protein Mic1 Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4570 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF00637 Clathrin: Region in Clathrin and VPS; InterPro: IPR000547 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>cd00923 Cyt_c_Oxidase_Va Cytochrome c oxidase subunit Va Back     alignment and domain information
>PF02284 COX5A: Cytochrome c oxidase subunit Va; InterPro: IPR003204 Cytochrome c oxidase (1 Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF13929 mRNA_stabil: mRNA stabilisation Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2066 consensus Vacuolar assembly/sorting protein VPS41 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query764
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-12
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 3e-09
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
 Score = 70.6 bits (171), Expect = 1e-12
 Identities = 19/172 (11%), Positives = 45/172 (26%), Gaps = 7/172 (4%)

Query: 463 AIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYF------CDSKTPLGTPTYNTVL 516
           A     ++  +      +    K       +                +  L    YN V+
Sbjct: 113 APSGQHSQAQLSGQQQRLLAFFKCCLLTDQLPLAHHLLVVHHGQRQKRKLLTLDMYNAVM 172

Query: 517 HSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCS-IIRCFKSASALVSMMVRDGF 575
                       + +   +K  G+ P+  +Y   + C     +   +    +  M ++G 
Sbjct: 173 LGWARQGAFKELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGL 232

Query: 576 YPQTMTYTALIKILLDYGDFDEALNLLDLVSLEGIPHDVLLYNTILKKACEK 627
             Q +    L+              +    SL       +  + +L+    K
Sbjct: 233 KLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAK 284


>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Length = 1134 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.97
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 99.96
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.94
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.89
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.87
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.87
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.86
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.84
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.79
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.77
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.74
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.73
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.73
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.72
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.71
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.71
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.7
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.69
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.69
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.67
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.66
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.63
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.59
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.57
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.51
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.49
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.48
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.47
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.46
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.44
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.43
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.43
3u4t_A272 TPR repeat-containing protein; structural genomics 99.42
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.42
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.42
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.41
3u4t_A272 TPR repeat-containing protein; structural genomics 99.41
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.4
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.39
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.39
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.38
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.36
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.34
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.34
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.33
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.32
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.31
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.3
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.29
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.27
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.25
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.23
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.23
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.2
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.2
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.12
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.11
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.08
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.05
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.04
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.03
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.03
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.97
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.96
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.96
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.93
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.85
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.8
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.79
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.79
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.78
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.78
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.74
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.71
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.69
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.69
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.67
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.66
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.66
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.64
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.63
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.62
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.62
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.62
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.6
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.59
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.59
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.58
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.58
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.58
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.51
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 98.49
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.49
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.43
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.35
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.35
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.33
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.29
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.27
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.27
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.26
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.26
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.25
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.25
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.24
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.24
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.23
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.22
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.22
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.2
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.19
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.19
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.18
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.17
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.16
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.15
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.12
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.11
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.11
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.06
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.03
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.02
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.0
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.0
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.98
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.97
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.97
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 97.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 97.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.91
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.91
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.86
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 97.86
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.86
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 97.85
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 97.83
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.82
3k9i_A117 BH0479 protein; putative protein binding protein, 97.8
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.79
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.79
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.79
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.77
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.73
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 97.72
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.72
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.68
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.61
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.61
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.53
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.51
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.48
3k9i_A117 BH0479 protein; putative protein binding protein, 97.45
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.38
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.35
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.3
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.29
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.29
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.27
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.25
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.24
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.23
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.23
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.22
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.2
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.15
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.08
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.06
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.96
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.92
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.88
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.87
2kat_A115 Uncharacterized protein; NESG, structure, structur 96.75
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.7
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.7
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 96.67
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 96.55
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 96.42
3lvg_A624 Clathrin heavy chain 1; SELF assembly, coated PIT, 96.23
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.09
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 95.87
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 95.66
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.62
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.18
3qww_A433 SET and MYND domain-containing protein 2; methyltr 95.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 95.02
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.91
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.86
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.61
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 94.55
1pc2_A152 Mitochondria fission protein; unknown function; NM 94.55
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.2
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 94.2
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 94.15
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.86
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.71
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 93.35
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.19
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 92.87
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 92.12
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 92.06
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 91.73
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 91.69
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 91.07
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 90.46
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 90.14
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.15
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.69
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.12
1v54_E109 Cytochrome C oxidase polypeptide VA; oxidoreductas 87.04
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 84.4
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 83.64
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 82.23
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 81.18
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 80.99
2y69_E152 Cytochrome C oxidase subunit 5A; electron transpor 80.6
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.07
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=3e-37  Score=345.01  Aligned_cols=500  Identities=12%  Similarity=-0.026  Sum_probs=291.7

Q ss_pred             cCCcchHHHHHHHhhhccCCCCcchHHHHHHHhhCCCChhHHHHHHHHHHHcCccccHHHHHHHHHHHHccCCHHHHHHH
Q 004279           65 RGERSRASHLLLNLGHAHHSLGADDFFHILNYCARSPDPLFVMETWRMMEEKEIGLNNKCYLLMMQALCKGGYLEEASNL  144 (764)
Q Consensus        65 ~~~~~~A~~~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~  144 (764)
                      .|....+...+..+.    .++...|+.++..|.+.|+++.|+.+|++|...  .|+..++..++.+|.+.|++++|..+
T Consensus        66 ~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~p~~~~~~~l~~~~~~~g~~~~A~~~  139 (597)
T 2xpi_A           66 DGSFLKERNAQNTDS----LSREDYLRLWRHDALMQQQYKCAAFVGEKVLDI--TGNPNDAFWLAQVYCCTGDYARAKCL  139 (597)
T ss_dssp             --------------------CHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--HCCHHHHHHHHHHHHHTTCHHHHHHH
T ss_pred             cCccCCCCCccccch----HHHHHHHHHHHHHHHHccCchHHHHHHHHHHhh--CCCchHHHHHHHHHHHcCcHHHHHHH
Confidence            344444444444332    244556777777777777777777777777743  45666777777777777777777777


Q ss_pred             HHHHhhhcCCCCChhhhHHHHHHHhccCCHHHHHHHHHHHHhcCCCCChhhHHHHHHHHHhccChhHHHHHHHHHHccCC
Q 004279          145 IYFLGERYGIYPILPVYNSFLGACAKLHSMVHANLCLDLMDSRMVGKNEVTYTELLKLAVWQKNLSAVHEIWEDYIKHYS  224 (764)
Q Consensus       145 ~~~~~~~~~~~~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~~~  224 (764)
                      |+.+..   .+++..+++.++.+|.+.|++++|.++|+++..     +..    ...++...+          ....+.+
T Consensus       140 ~~~~~~---~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~-----~~~----~~~~~~~~~----------~~~~~~~  197 (597)
T 2xpi_A          140 LTKEDL---YNRSSACRYLAAFCLVKLYDWQGALNLLGETNP-----FRK----DEKNANKLL----------MQDGGIK  197 (597)
T ss_dssp             HHHTCG---GGTCHHHHHHHHHHHHHTTCHHHHHHHHCSSCT-----TC------------------------CCCSSCC
T ss_pred             HHHHhc---cccchhHHHHHHHHHHHHhhHHHHHHHHhccCC-----ccc----ccccccccc----------ccccccc
Confidence            776642   245666777777777777777777777764211     110    000000000          0001123


Q ss_pred             CCHHhHHHHHHHhhccCCHHHHHHHHHHHHHhhhcccchhcccccccccccccCCCccCCcccchhhhHhhHHHHHHHHH
Q 004279          225 LSIFSLRKFVWSFTRLRDLKSAYETLQHMVALAMMGKLYINRTSEGRLRSSRLDIPIPLNALPVMKVLRWSFSDVIHACG  304 (764)
Q Consensus       225 ~~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~  304 (764)
                      .+..+|+.++.+|.+.|++++|.++|++|.+.  .|+..                              ..|..+...+.
T Consensus       198 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~--~p~~~------------------------------~~~~~l~~~~~  245 (597)
T 2xpi_A          198 LEASMCYLRGQVYTNLSNFDRAKECYKEALMV--DAKCY------------------------------EAFDQLVSNHL  245 (597)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHH--CTTCH------------------------------HHHHHHHHTTC
T ss_pred             hhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--Cchhh------------------------------HHHHHHHHhhc
Confidence            34555555555555555555555555555552  23221                              23444443333


Q ss_pred             ccCCHHHHHH--H-HHHHHHCCCCCCcccHHHHHHHHHhcCChhHHHHHHHHHHHCCCCCchhHHHHHHHHHHhcCCHHH
Q 004279          305 RTQNSGLAEQ--L-MLQMQSLGLQPSSHTYDGFIRAIVSDRGLRNGMEVLKIMQQNNLKPQDSTIATLSVECSKALELDL  381 (764)
Q Consensus       305 ~~g~~~~a~~--~-~~~m~~~g~~p~~~t~~~li~~~~~~~~~~~a~~~~~~m~~~~~~~~~~~~~~li~~~~~~g~~~~  381 (764)
                      ..+..+.+..  + +..+...+..++..+|+.++..|.+.|++++|.++|+++.+.  .++..++..++.+|.+.|++++
T Consensus       246 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~A~~~~~~~~~~--~~~~~~~~~l~~~~~~~g~~~~  323 (597)
T 2xpi_A          246 LTADEEWDLVLKLNYSTYSKEDAAFLRSLYMLKLNKTSHEDELRRAEDYLSSINGL--EKSSDLLLCKADTLFVRSRFID  323 (597)
T ss_dssp             SCHHHHHHHHHHSCTHHHHGGGHHHHHHHHHTTSCTTTTHHHHHHHHHHHHTSTTG--GGCHHHHHHHHHHHHHTTCHHH
T ss_pred             ccchhHHHHHHhcCCcccccchHHHHHHHHHHHHHHHcCcchHHHHHHHHHHhhcC--CchHHHHHHHHHHHHHhcCHHH
Confidence            3322222111  1 334443333334444555555555555555555555555443  2455555555566666666666


Q ss_pred             HHHHHHHHhhCC--CCcchHHHHHHHhcCCCHHHHHHHHHHHhhccCCCHHhHHHHHHHhcCCCCchhhchhhhhhhhHH
Q 004279          382 AEALLDQISRCT--NPKPFSAFLAACDTMDKPERAIKIFAKMRQKLRPDIRTYELLFSLFGNVNAPYEEGNMFSQVDSAK  459 (764)
Q Consensus       382 A~~~~~~~~~~~--~~~~~~~li~~~~~~g~~~~a~~l~~~m~~~~~p~~~t~~~ll~~~~~~~~~~~~~~~~~~~~~~~  459 (764)
                      |..+|+++....  +..+|+.++.+|.+.|++++|..+|+++... .|                                
T Consensus       324 A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~-~~--------------------------------  370 (597)
T 2xpi_A          324 VLAITTKILEIDPYNLDVYPLHLASLHESGEKNKLYLISNDLVDR-HP--------------------------------  370 (597)
T ss_dssp             HHHHHHHHHHHCTTCCTTHHHHHHHHHHHTCHHHHHHHHHHHHHH-CT--------------------------------
T ss_pred             HHHHHHHHHHcCcccHHHHHHHHHHHHHhCCHHHHHHHHHHHHhh-Cc--------------------------------
Confidence            666665554322  5555666666666666666666666666541 11                                


Q ss_pred             HHHHHHHHHHHCCCCCcHHHHHHHHHHHhccCcHHHHHHHHHhcC--CCCChhhHHHHHHHHHHcCChhHHHHHHHHHHh
Q 004279          460 RINAIEMDMARNNIQHSHISMKNLLKALGAEGMIRELIQYFCDSK--TPLGTPTYNTVLHSLVEAQESHRAMEIFKQMKT  537 (764)
Q Consensus       460 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~a~~~~~~~~--~~~~~~~~~~li~~~~~~~~~~~A~~l~~~m~~  537 (764)
                                     .+..+++.++..|.+.|++++|.+.|+++.  .+.+..+|+.++.+|.+.|++++|+++|++|.+
T Consensus       371 ---------------~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~  435 (597)
T 2xpi_A          371 ---------------EKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFAIEGEHDQAISAYTTAAR  435 (597)
T ss_dssp             ---------------TSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCHHHHHHHHHHHHH
T ss_pred             ---------------ccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH
Confidence                           122333444555566666666666665431  233456777777777788888888888887776


Q ss_pred             CCCCCCHHHHHHHHHHHHccCChhHHHHHHHHHHHCCCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHC----CCCCC
Q 004279          538 CGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKILLDYGDFDEALNLLDLVSLE----GIPHD  613 (764)
Q Consensus       538 ~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~p~~~~~~~li~~~~~~g~~~~A~~~~~~m~~~----~~~p~  613 (764)
                      .+ +.+..+|..+..+|.+.|++++|.++|+++.+.. +.+..+|+.++.+|.+.|++++|.++|+++.+.    +..|+
T Consensus       436 ~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~p~  513 (597)
T 2xpi_A          436 LF-QGTHLPYLFLGMQHMQLGNILLANEYLQSSYALF-QYDPLLLNELGVVAFNKSDMQTAINHFQNALLLVKKTQSNEK  513 (597)
T ss_dssp             TT-TTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHC-CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHSCCCSG
T ss_pred             hC-ccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHHhhhccccchh
Confidence            54 3466777777778888888888888887777653 336677778888888888888888888777654    55676


Q ss_pred             --HHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCCHhhHHHHHHHHHhcCChHHHHHHHHHHHH
Q 004279          614 --VLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPDPSTCHFVFSGYVNCGFHNSAMEALQVLSM  677 (764)
Q Consensus       614 --~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~~~~~~~ll~~~~~~g~~~~a~~~~~~~~~  677 (764)
                        ..+|..++.+|.+.|++++|.++++++.+.+ +.+..+|..+..+|.+.|++++|.++++++..
T Consensus       514 ~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~-p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~  578 (597)
T 2xpi_A          514 PWAATWANLGHAYRKLKMYDAAIDALNQGLLLS-TNDANVHTAIALVYLHKKIPGLAITHLHESLA  578 (597)
T ss_dssp             GGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHS-SCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhC-CCChHHHHHHHHHHHHhCCHHHHHHHHHHHHh
Confidence              6677888888888888888888888777643 23566777777788888888888888777654



>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3lvg_A Clathrin heavy chain 1; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} PDB: 3lvh_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1v54_E Cytochrome C oxidase polypeptide VA; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: a.118.11.1 PDB: 1oco_E* 1occ_E* 1ocz_E* 1ocr_E* 1v55_E* 2dyr_E* 2dys_E* 2eij_E* 2eik_E* 2eil_E* 2eim_E* 2ein_E* 2occ_E* 2ybb_P* 2zxw_E* 3abk_E* 3abl_E* 3abm_E* 3ag1_E* 3ag2_E* ... Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2y69_E Cytochrome C oxidase subunit 5A; electron transport, complex IV, proton pumps, membrane prote; HET: TPO HEA CHD PEK PGV DMU; 1.95A {Bos taurus} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query764
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.85
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.84
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.47
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.4
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.95
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.94
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.88
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.87
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.81
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.74
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.71
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.44
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.27
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.15
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.14
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.09
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 98.06
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 97.97
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.94
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.9
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.85
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.79
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.77
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.72
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.65
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.6
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.59
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.36
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.31
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.31
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.29
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.25
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.22
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.18
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.11
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.07
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.03
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.96
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 96.81
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.78
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.7
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.64
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 96.59
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.98
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 95.81
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.57
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.18
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 94.66
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 94.46
d1wy6a1161 Hypothetical protein ST1625 {Archaeon Sulfolobus t 93.33
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 93.17
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.82
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.27
d1v54e_105 Cytochrome c oxidase subunit E {Cow (Bos taurus) [ 86.17
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 85.62
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 83.48
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.85  E-value=1.7e-17  Score=171.00  Aligned_cols=150  Identities=9%  Similarity=0.038  Sum_probs=102.3

Q ss_pred             hhhHHHHHHHHHHcCChhHHHHHHHHHHhCCCCCCHHHHHHHHHHHHccCChhHHHHHHHHHHHCCCCCCHHHHHHHHHH
Q 004279          509 TPTYNTVLHSLVEAQESHRAMEIFKQMKTCGIPPNAATYNIMIDCCSIIRCFKSASALVSMMVRDGFYPQTMTYTALIKI  588 (764)
Q Consensus       509 ~~~~~~li~~~~~~~~~~~A~~l~~~m~~~g~~p~~~t~~~ll~~~~~~~~~~~a~~~~~~~~~~g~~p~~~~~~~li~~  588 (764)
                      ...+..+...+.+.|++++|+..|++..+.. +-+..++..+...+...|++++|...++...... +.+...+..+...
T Consensus       237 ~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~-p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~-~~~~~~~~~l~~~  314 (388)
T d1w3ba_         237 AVVHGNLACVYYEQGLIDLAIDTYRRAIELQ-PHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC-PTHADSLNNLANI  314 (388)
T ss_dssp             HHHHHHHHHHHHHTTCHHHHHHHHHHHHHTC-SSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC-TTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCHHHHHHHHHHHHHhC-CCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC-CccchhhhHHHHH
Confidence            3345555666667777777777777776653 2245667777777777777777777777776642 4456667777777


Q ss_pred             HHhcCCHHHHHHHHHHHHHCCCCC-CHHHHHHHHHHHHHcCCHHHHHHHHHHHHHCCCCCC-HhhHHHHHHHHHhcCC
Q 004279          589 LLDYGDFDEALNLLDLVSLEGIPH-DVLLYNTILKKACEKGRIDVIEFIIEQMHQNKVQPD-PSTCHFVFSGYVNCGF  664 (764)
Q Consensus       589 ~~~~g~~~~A~~~~~~m~~~~~~p-~~~~~~~li~~~~~~g~~~~a~~~~~~m~~~~~~p~-~~~~~~ll~~~~~~g~  664 (764)
                      +.+.|++++|++.+++..+.  .| +..++..+...|.+.|++++|+..|++.++  +.|+ ...|..+..+|.+.||
T Consensus       315 ~~~~~~~~~A~~~~~~al~~--~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~--l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         315 KREQGNIEEAVRLYRKALEV--FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIR--ISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHTTTCHHHHHHHHHHHTTS--CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHT--TCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHCCCHHHHHHHHHHHHHh--CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHH--hCCCCHHHHHHHHHHHHHcCC
Confidence            78888888888888877643  34 456677777778888888888888887774  4564 4455666666666654



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1wy6a1 a.118.20.1 (A:7-167) Hypothetical protein ST1625 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v54e_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure