Citrus Sinensis ID: 004307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760--
MQYESEFEVPSGFGEIGAILVENEHHKEMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRDKFFWFRDEEFSRQTLAGLNPYSIRLITEWPLKSTLDPEIYGPPESAITTELIEKEIGGMISVEEAIKQKKLFILDYHDLFLPYVEKVRQLKSTTLYGSRTIFFLTPAGTLRPIAIELTRPPMNGKPQWKQVFLPSWHSTECWLWKLAKAHVLAHDAGYHQLVSHWLRTHCCTEPYVIATNRQLSVMHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHEALPKDLISRGLAVEDPSAPHGLKLTIEDYPFANDGLDLWDAIKQWVTDYVNHYYPDKSLVESDEELQAWWTEIRTVGHGDKKHEPWWPVLKTPKDLIEIITTIVWVTSGHHAAVNFGQYTYGGYFPNRPTTARCNIATEDPSDEQWKFFLEKPENALLNTFPSQIQATKVMAILDVLSTHSPDEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVPYSISI
cEEEEEEEEcccccccEEEEEEEccccEEEEEEEEEEccccccEEEEEcccccccccccccEEEEcccccccccccHHHHHHHHHHHHHHHccccccccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHccccccccccccccccccccccccccccccEEEEEEccccccccEEEEEccccccccccccEEEccccccccccHHHHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHcccccccccHHHcccccHHHHcccHHHHHHHccccccEEEEEcccccHHHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHEEEcccccccccccccccccccccccccccccccccccccHHHHHHHcccHHHHHcccccHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccCCcccccccccccccccccccc
MQYESEFEVPSGFGEIGAILVENEHHKEMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTG***********KR*GNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRDKFFWFRDEEFSRQTLAGLNPYSIRLITEWPLKSTLDPEIYGPPESAITTELIEKEIGGMISVEEAIKQKKLFILDYHDLFLPYVEKVRQLKSTTLYGSRTIFFLTPAGTLRPIAIELTRPPMNGKPQWKQVFLPSWHSTECWLWKLAKAHVLAHDAGYHQLVSHWLRTHCCTEPYVIATNRQLSVMHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHEALPKDLISRGLAVEDPSAPHGLKLTIEDYPFANDGLDLWDAIKQWVTDYVNHYYPDKSLVESDEELQAWWTEIRTVGHGDKKHEPWWPVLKTPKDLIEIITTIVWVTSGHHAAVNFGQYTYGGYFPNRPTTARCNIATEDPSDEQWKFFLEKPENALLNTFPSQIQATKVMAILDVLSTHSPDEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNAD*K***RNGAGMVPYELLKPFSEPGVTGKGVPYSISI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQYESEFEVPSGFGEIGAILVENEHHKEMYLKDIVLDGLPNGPVNVTCNSWLHSKHDNKQKRVFFTNKLYLPSQTPDGLKRYRAEELTILRGNGQGERKTYDRIYDYDVYNDLGDPDKKPELARPVLGGKQNPYPRRCRTGRPRCDTDQFSEKREGNFYVPRDEAFSEVKQLTFSAKTVYSVLHALVPSLETAFVDPDLGFPYFSAIDALFNEGVNLPPLKQEGFWNTLLPRLVKAIEDTGDNILLFETPETMDRDKFFWFRDEEFSRQTLAGLNPYSIRLITEWPLKSTLDPEIYGPPESAITTELIEKEIGGMISVEEAIKQKKLFILDYHDLFLPYVEKVRQLKSTTLYGSRTIFFLTPAGTLRPIAIELTRPPMNGKPQWKQVFLPSWHSTECWLWKLAKAHVLAHDAGYHQLVSHWLRTHCCTEPYVIATNRQLSVMHPIYRLLDPHFRYTMEINGLARQALVNADGIIESSFSPGKYSMEFSSVAYDKQWRFDHEALPKDLISRGLAVEDPSAPHGLKLTIEDYPFANDGLDLWDAIKQWVTDYVNHYYPDKSLVESDEELQAWWTEIRTVGHGDKKHEPWWPVLKTPKDLIEIITTIVWVTSGHHAAVNFGQYTYGGYFPNRPTTARCNIATEDPSDEQWKFFLEKPENALLNTFPSQIQATKVMAILDVLSTHSPDEEYLGKEIEPAWREDPVINAAFEKFRGKLMELEGIIDARNADPKLRNRNGAGMVPYELLKPFSEPGVTGKGVPYSISI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lipoxygenase 2, chloroplastic 13S-lipoxygenase that can use linolenic acid as substrates. Plant lipoxygenases may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Required for the wound-induced synthesis of jasmonic acid (JA) in leaves.probableP38418
Linoleate 13S-lipoxygenase 2-1, chloroplastic Plant lipoxygenase involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence. May not be involved in the bulk production of jasmonate upon wounding. Catalyzes the hydroperoxidation of lipids containing a cis,cis-1,4-pentadiene structure. Linolenic acid is the preferred substrate, before linoleic and arachidonic acids. Has also some activity with phosphatidylglycerol, but not with galactolipids.probableO24370
Lipoxygenase 2.1, chloroplastic Plant lipoxygenase may be involved in a number of diverse aspects of plant physiology including growth and development, pest resistance, and senescence or responses to wounding. This enzyme is possibly involved in jasmonic acid synthesis. It exhibits linoleate 13-lipoxygenase and arachidonate 15-lipoxygenase activity.probableP93184

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.13.-.-Acting on single donors with incorporation of molecular oxygen.probable
1.13.11.-With incorporation of two atoms of oxygen.probable
1.13.11.12Transferred entry: 1.13.11.12.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IUJ, chain A
Confidence level:very confident
Coverage over the Query: 2-762
View the alignment between query and template
View the model in PyMOL