Citrus Sinensis ID: 004418

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750----

MAHDIQLPCNLDEQCMRCKVKPRPEETITCSTCVTPWHVACLTKPPETLASSLSWLCPDCSGVDGPALPSGGTAGDGGDLVAAIRAIEADEKLTDKEKARKRQELLSGKVEEEMKENENEKKSKGKERERESDSDVLDLLDGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKWIGQGKRTCAKCRHIIPPKMASQPRINSALVTAIRMAKLSKSNLAAVPTKVYHFMRNQDRPDKAFTTERAQKTGKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRSHKEKRSSYAPEKGVRYDGVYRIEKCWRKIGIQGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSLPGIPELKMATDVTERKESPAWDFDEEDSRWKWKKPPPLSKKPIGTGKPEDGKKVRRAIRQAQNTSVREKLLKEFSCLICRQVMNLPITTPCAHNFCKSCLEGAFAGKTFVRERSRGGRTLRSQKNVMQCPSCPTDISEFLQNPQVNRELMDVIESLKHKTEENEDPPEELSDEEINGMENPNPTSGITGTAATENSENADVKEDLQNSPAKPKPKRASKRMKLDSGGSSSFDGGNEEENRISVEKPGCSNGDSKVKKVESGVPKGLTNDGDGSVKQNVGLQSRSRKFPAATADEGDSPASTLQLQSSDEDFE

ccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHcccccccccccccccccccccccccccccccccccccHHHHHcHccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHcccccccccccEEccccccccccccccccccccccccccEEccHHHHHHHccccccccccccccccccEEEEEccccccccccccEEEEECcccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEccccccccccccccEEEEccEEEEEcEEEEEcccccEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccHHcHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccHHHHccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHcccccccccccccccccccccccccccccc

****IQLPCNLDEQCMRCKVKPRPEETITCSTCVTPWHVACLTKPPETLASSLSWLCPDCSGV******************A***A*************************************************VLDLLDGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKWIGQGKRTCAKCRHIIPPKMASQPRINSALVTAIRMAKLSKSNLAAVPTKVYHFMRNQDRPDKAFTTERAQ*TGKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSG**********************MNEALRVSCKKGYPVRVVRSHKE*****APEKGVRYDGVYRIEKCWRKIGIQGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSLPGIPELKMATDVTERKESPAWDFDEEDSRWKWKKPPPLSKKPIGTGKPEDGKKVRRAIRQAQNTSVREKLLKEFSCLICRQVMNLPITTPCAHNFCKSCLEGAFAGKTFVRERSRGGRTLRSQKNVMQCPSCPTDISEFLQNPQVNRELMDVI********************************GITGT**************************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAHDIQLPCNLDEQCMRCKVKPRPEETITCSTCVTPWHVACLTKPPETLASSLSWLCPDCSGVDGPALPSGGTAGDGGDLVAAIRAIEADEKLTDxxxxxxxxxxxxxxxxxxxxxxxxxKKSKGKERERESDSDVLDLLDGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKWIGQGKRTCAKCRHIIPPKMASQPRINSALVTAIRMAKLSKSNLAAVPTKVYHFMRNQDRPDKAFTTERAQKTGKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRSHKEKRSSYAPEKGVRYDGVYRIEKCWRKIGIQGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSLPGIPELKMATDVTERKESPAWDFDEEDSRWKWKKPPPLSKKPIGTGKPEDGKKVRRAIRQAQNTSVREKLLKEFSCLICRQVMNLPITTPCAHNFCKSCLEGAFAGKTFVRERSRGGRTLRSQKNVMQCPSCPTDISEFLQNPQVNRELMDVIESLKHKTEENEDPPEELSDEEINGMENPNPTSGITGTAATENSENADVKEDLQNSPAKPKPKRASKRMKLDSGGSSSFDGGNEEENRISVEKPGCSNGDSKVKKVESGVPKGLTNDGDGSVKQNVGLQSRSRKFPAATADEGDSPASTLQLQSSDEDFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase ORTHRUS 2	E3 ubiquitin-protein ligase. Participates in CpG methylation-dependent transcriptional regulation and epigenetic transcriptional silencing. Mediates ubiquitination with the E2 ubiquitin-conjugating enzyme UBC11. Promotes methylation-mediated gene silencing leading, for example, to early flowering. Associates with methylated DNA, and can binds to CpG, CpNpG, and CpNpN DNA motifs, with a strong preference for methylated forms, and with highest affinity for CpG substrate. Probably acts at the DNA methylation?histone interface to maintain centromeric heterochromatin.	confident	Q8VYZ0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PB7, chain A
Confidence level:very confident
Coverage over the Query: 255-338,350-453
View the alignment between query and template
View the model in PyMOL

Template: 1Z6U, chain A
Confidence level:very confident
Coverage over the Query: 486-549,568-601
View the alignment between query and template
View the model in PyMOL

Template: 3FL2, chain A
Confidence level:very confident
Coverage over the Query: 135-211
View the alignment between query and template
View the model in PyMOL

Template: 1JM7, chain B
Confidence level:very confident
Coverage over the Query: 134-216
View the alignment between query and template
View the model in PyMOL

Template: 2E6R, chain A
Confidence level:confident
Coverage over the Query: 7-62
View the alignment between query and template
View the model in PyMOL

Template: 4EPO, chain C
Confidence level:probable
Coverage over the Query: 135-199
View the alignment between query and template
View the model in PyMOL