Citrus Sinensis ID: 004418
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 754 | 2.2.26 [Sep-21-2011] | |||||||
| Q8VYZ0 | 645 | E3 ubiquitin-protein liga | yes | no | 0.806 | 0.942 | 0.727 | 0.0 | |
| Q9FKA7 | 617 | E3 ubiquitin-protein liga | no | no | 0.763 | 0.933 | 0.657 | 0.0 | |
| Q9C8E1 | 622 | Putative E3 ubiquitin-pro | no | no | 0.758 | 0.919 | 0.655 | 0.0 | |
| Q680I0 | 623 | E3 ubiquitin-protein liga | no | no | 0.758 | 0.918 | 0.653 | 0.0 | |
| Q9FVS2 | 660 | E3 ubiquitin-protein liga | no | no | 0.773 | 0.883 | 0.617 | 0.0 | |
| Q681I0 | 465 | E3 ubiquitin-protein liga | no | no | 0.561 | 0.909 | 0.553 | 1e-140 | |
| F6UA42 | 775 | E3 ubiquitin-protein liga | yes | no | 0.436 | 0.424 | 0.356 | 1e-51 | |
| E7EZF3 | 776 | E3 ubiquitin-protein liga | yes | no | 0.436 | 0.423 | 0.354 | 1e-50 | |
| B6CHA3 | 772 | E3 ubiquitin-protein liga | N/A | no | 0.438 | 0.428 | 0.355 | 1e-50 | |
| Q7TPK1 | 774 | E3 ubiquitin-protein liga | yes | no | 0.437 | 0.426 | 0.355 | 5e-50 |
| >sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 924 bits (2388), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 451/620 (72%), Positives = 509/620 (82%), Gaps = 12/620 (1%)
Query: 1 MAHDIQLPCNLDEQCMRCKVKPRPEETITCSTCVTPWHVACLTKPPETLASSLSWLCPDC 60
MA DIQLPC+ D CMRCK P PEE++TC TCVTPWHV+CL+ PP+TLAS+L W CPDC
Sbjct: 1 MARDIQLPCDGDGVCMRCKSNPPPEESLTCGTCVTPWHVSCLSSPPKTLASTLQWHCPDC 60
Query: 61 SGVDGPALPSGGTAG---DGGDLVAAIRAIEADEKLTDKEKARKRQELLSGKVEEEMKEN 117
SG P SGG G G DLVAAIRAIEADE L+ +EKA+ RQ LLSGK EE E
Sbjct: 61 SGEIDPLPVSGGATGFESAGSDLVAAIRAIEADESLSTEEKAKMRQRLLSGKGVEEDDEE 120
Query: 118 ENEKKSKGKERERESDSDVLDLLDGSLNCSFCMQLPERPVTTPCGHNFCLKCFQKWIGQG 177
E KK + + DVL L +L CSFCMQLPERPVT PCGHN CLKCF+KW+GQG
Sbjct: 121 EKRKKKGKGK---NPNLDVLSALGDNLMCSFCMQLPERPVTKPCGHNACLKCFEKWMGQG 177
Query: 178 KRTCAKCRHIIPPKMASQPRINSALVTAIRMAKLSKSNLAAVPTKVYHFMRNQDRPDKAF 237
KRTC KCR IIP KMA PRINS+LV AIR+AK+SKS AA +KV+HF+ NQDRPDKAF
Sbjct: 178 KRTCGKCRSIIPEKMAKNPRINSSLVAAIRLAKVSKS-AAATTSKVFHFISNQDRPDKAF 236
Query: 238 TTERAQKTGKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAH 297
TTERA+KTGKANAASGKI+VTIPPDHFGPIPAENDP RNQG+LVGE WEDRLECRQWGAH
Sbjct: 237 TTERAKKTGKANAASGKIYVTIPPDHFGPIPAENDPVRNQGLLVGESWEDRLECRQWGAH 296
Query: 298 FPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKF 357
FPHVAGIAGQS YG+QSVALSGGY+DDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKF
Sbjct: 297 FPHVAGIAGQSTYGAQSVALSGGYKDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKF 356
Query: 358 EKMNEALRVSCKKGYPVRVVRSHKEKRSSYAPEKGVRYDGVYRIEKCWRKIGIQG-FKVC 416
EK N AL++SCK GYPVRVVRSHKEKRS+YAPE+GVRYDGVYRIEKCWRK+G+QG FKVC
Sbjct: 357 EKSNAALKLSCKLGYPVRVVRSHKEKRSAYAPEEGVRYDGVYRIEKCWRKVGVQGSFKVC 416
Query: 417 RYLFVRCDNEPAPWTSDEFGDRPRSLPGIPELKMATDVTERKESPAWDFDEEDSRWKWKK 476
RYLFVRCDNEPAPWTSDE GDRPR +P IPEL MATD+ ERKE+P+WDFDE + WKW K
Sbjct: 417 RYLFVRCDNEPAPWTSDENGDRPRPIPNIPELNMATDLFERKETPSWDFDEGEGCWKWMK 476
Query: 477 PPPLSKKPIGTGKPEDGKKVRRAIRQAQNTSVREKLLKEFSCLICRQVMNLPITTPCAHN 536
PPP SKK + PE+ K +R+AI+ A + ++R +LLKEF C IC+QV+ LP+TTPCAHN
Sbjct: 477 PPPASKKSVNVLAPEERKNLRKAIKAAHSNTMRARLLKEFKCQICQQVLTLPVTTPCAHN 536
Query: 537 FCKSCLEGAFAGKTFVRERSRGGRTLRSQKNVMQCPSCPTDISEFLQNPQVNRELMDVIE 596
FCK+CLE FAGKT VRERS GGRTLRS+KNV+ CP CPTDIS+FLQNPQVNRE+ +VIE
Sbjct: 537 FCKACLEAKFAGKTLVRERSTGGRTLRSRKNVLNCPCCPTDISDFLQNPQVNREVAEVIE 596
Query: 597 SLKHKTEENEDPPEELSDEE 616
LK + E+ EL DE+
Sbjct: 597 KLKTQEEDT----AELEDED 612
|
E3 ubiquitin-protein ligase. Participates in CpG methylation-dependent transcriptional regulation and epigenetic transcriptional silencing. Mediates ubiquitination with the E2 ubiquitin-conjugating enzyme UBC11. Promotes methylation-mediated gene silencing leading, for example, to early flowering. Associates with methylated DNA, and can binds to CpG, CpNpG, and CpNpN DNA motifs, with a strong preference for methylated forms, and with highest affinity for CpG substrate. Probably acts at the DNA methylation?histone interface to maintain centromeric heterochromatin. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=2 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 754 | ||||||
| 255577358 | 752 | zinc finger protein, putative [Ricinus c | 0.945 | 0.948 | 0.644 | 0.0 | |
| 297837707 | 649 | hypothetical protein ARALYDRAFT_315436 [ | 0.801 | 0.930 | 0.747 | 0.0 | |
| 449445270 | 667 | PREDICTED: E3 ubiquitin-protein ligase O | 0.781 | 0.883 | 0.753 | 0.0 | |
| 449487895 | 688 | PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu | 0.781 | 0.856 | 0.753 | 0.0 | |
| 449515239 | 745 | PREDICTED: LOW QUALITY PROTEIN: E3 ubiqu | 0.901 | 0.912 | 0.650 | 0.0 | |
| 313760929 | 713 | VARIANT IN METHYLATION-like protein [Lir | 0.927 | 0.980 | 0.644 | 0.0 | |
| 313760924 | 713 | VARIANT IN METHYLATION-like protein [Lir | 0.931 | 0.984 | 0.643 | 0.0 | |
| 449457333 | 608 | PREDICTED: E3 ubiquitin-protein ligase O | 0.758 | 0.940 | 0.736 | 0.0 | |
| 22330295 | 645 | E3 ubiquitin-protein ligase ORTHRUS 2 [A | 0.806 | 0.942 | 0.727 | 0.0 | |
| 225425270 | 815 | PREDICTED: E3 ubiquitin-protein ligase O | 0.973 | 0.900 | 0.586 | 0.0 |
| >gi|255577358|ref|XP_002529559.1| zinc finger protein, putative [Ricinus communis] gi|223530971|gb|EEF32828.1| zinc finger protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 996 bits (2574), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 511/793 (64%), Positives = 589/793 (74%), Gaps = 80/793 (10%)
Query: 1 MAHDIQ--LPCNLDEQCMRCKVKPRPEETITCSTCVTPWHVACLTKPPETLASSLSWLCP 58
MAHDIQ LPC+ D CM+CK+KP EET+TCSTCVTPWH+ CL+ ETLAS+L W CP
Sbjct: 1 MAHDIQIQLPCDGDGVCMKCKLKPIDEETLTCSTCVTPWHLTCLSSKTETLASTLQWECP 60
Query: 59 DCSGVDGPALPSGGTAGDGGD------------------LVAAIRAIEADEKLTDKEKAR 100
DCSG AG GGD LV I+ IEAD L +KEKA+
Sbjct: 61 DCSG-----------AGGGGDDVTAAAPADVAAGGGGSELVTKIKEIEADVTLNEKEKAK 109
Query: 101 KRQELLSGKVEEEMKENENEKKSKGKERERESDSDVLDLLDGSLNCSFCMQLPERPVTTP 160
KRQ LLSG +++ ++ +E SK +DV D+LD + C+FCMQLPERPVTTP
Sbjct: 110 KRQALLSGTIDDNDDDDGSEDNSK---------NDVFDVLDEAFKCAFCMQLPERPVTTP 160
Query: 161 CGHNFCLKCFQKWIGQGKRTCAKCRHIIPPKMASQPRINSALVTAIRMAKLSKSNLAAVP 220
CGHNFCLKCFQ+WIGQ K TCAKCR IPPKMASQPRINS+LV AIRMAKLSKS ++
Sbjct: 161 CGHNFCLKCFQRWIGQRKLTCAKCRSAIPPKMASQPRINSSLVAAIRMAKLSKSIVSGGL 220
Query: 221 TKVYHFMRNQDRPDKAFTTERAQKTGKANAASGKIFVTIPPDHFGPIPAENDPERNQGVL 280
KVYHF+ NQ+RPDKA+TTERAQ++GKANA SGKIFVT+PPDHFGPIPAENDPERNQGVL
Sbjct: 221 PKVYHFVHNQNRPDKAYTTERAQRSGKANACSGKIFVTVPPDHFGPIPAENDPERNQGVL 280
Query: 281 VGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRD 340
VGECWEDRLECRQWGAH PHVAGIAGQSNYG+QSVALSGGY DDEDHGEWFLYTGSGGRD
Sbjct: 281 VGECWEDRLECRQWGAHLPHVAGIAGQSNYGAQSVALSGGYIDDEDHGEWFLYTGSGGRD 340
Query: 341 LSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRSHKEKRSSYAPEKGVRYDGVYR 400
LSGNKRTNKEQSFDQKFEKMNEALR+SC+KGYPVRVVRSHKEKRSSYAPE GVRYDGVYR
Sbjct: 341 LSGNKRTNKEQSFDQKFEKMNEALRLSCRKGYPVRVVRSHKEKRSSYAPESGVRYDGVYR 400
Query: 401 IEKCWRKIGIQGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSLPGIPELKMATDVTERKES 460
IEKCWRK+GIQG KVCRYLFVRCDNEPAPWTSDE GDRPR LP I EL ATD+TERKES
Sbjct: 401 IEKCWRKVGIQGHKVCRYLFVRCDNEPAPWTSDEHGDRPRPLPVIKELAKATDITERKES 460
Query: 461 PAWDFDEEDSRWKWKKPPPLSKKPIGTGKPEDGKKVRRAIRQAQNTSVREKLLKEFSCLI 520
P+WDFDE D RWKWK PPP S+KP+ ED K R+ IR+AQNTSVR++LLKEFSCLI
Sbjct: 461 PSWDFDESDGRWKWKIPPPQSRKPVNARNSEDLKMSRKVIRKAQNTSVRDRLLKEFSCLI 520
Query: 521 CRQVMNLPITTPCAHNFCKSCLEGAFAGKTFVRERSRGGRTLRSQKNVMQCPSCPTDISE 580
CRQVMN PITTPCAHNFCKSCLEGAF GKT +RERS+GGRTLR+QKN+M CP CPTDIS+
Sbjct: 521 CRQVMNQPITTPCAHNFCKSCLEGAFTGKTLMRERSKGGRTLRAQKNIMHCPRCPTDISD 580
Query: 581 FLQNPQVNRELMDVIESLKHKTEENEDPPEELSDEEINGM-ENPNPTSGITGTAATENSE 639
FLQ+P+VNRE+M VIESL+ +TEE D ++ +EE +G ENP T A ++SE
Sbjct: 581 FLQDPKVNREVMAVIESLQRQTEETVDSVDDSGEEEADGSEENPCVTE-----AGEDDSE 635
Query: 640 NADVKEDLQNSPAKPKPKRASKRMKLDSGGSSSFDGGNEEENRISVEKPGCSNGDS-KVK 698
L+N P+K +P+ A ++ K EN IS K GC N S +
Sbjct: 636 KTAAHNGLEN-PSKCEPEVAIEQKK---------------ENEISAGKTGCGNEHSEEAS 679
Query: 699 KVESGVP-----------------KGLTNDGDGSVKQNVGLQSRSRKFPAATADEGDSPA 741
K+ES V + + + G S + VG + R+R+ ATAD +SP+
Sbjct: 680 KLESEVAEDGGLNVQVPAARLSCKRKIPDSGAESREPTVGAKKRNRRGQEATADGNNSPS 739
Query: 742 STLQLQSSDEDFE 754
S L ++SSD+DFE
Sbjct: 740 SPLNVRSSDDDFE 752
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297837707|ref|XP_002886735.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] gi|297332576|gb|EFH62994.1| hypothetical protein ARALYDRAFT_315436 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|449445270|ref|XP_004140396.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449487895|ref|XP_004157854.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449515239|ref|XP_004164657.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|313760929|gb|ADR79442.1| VARIANT IN METHYLATION-like protein [Liriodendron tulipifera] | Back alignment and taxonomy information |
|---|
| >gi|313760924|gb|ADR79438.1| VARIANT IN METHYLATION-like protein [Liriodendron tulipifera] | Back alignment and taxonomy information |
|---|
| >gi|449457333|ref|XP_004146403.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|22330295|ref|NP_176092.2| E3 ubiquitin-protein ligase ORTHRUS 2 [Arabidopsis thaliana] gi|75331157|sp|Q8VYZ0.1|ORTH2_ARATH RecName: Full=E3 ubiquitin-protein ligase ORTHRUS 2; AltName: Full=Protein VARIANT IN METHYLATION 1 gi|17529304|gb|AAL38879.1| putative transcription factor [Arabidopsis thaliana] gi|21436127|gb|AAM51310.1| putative transcription factor [Arabidopsis thaliana] gi|332195348|gb|AEE33469.1| E3 ubiquitin-protein ligase ORTHRUS 2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|225425270|ref|XP_002267902.1| PREDICTED: E3 ubiquitin-protein ligase ORTHRUS 2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 754 | ||||||
| TAIR|locus:2009420 | 645 | VIM1 "AT1G57820" [Arabidopsis | 0.618 | 0.722 | 0.760 | 4.3e-239 | |
| TAIR|locus:2164835 | 617 | VIM3 "VARIANT IN METHYLATION 3 | 0.619 | 0.756 | 0.687 | 5e-214 | |
| TAIR|locus:2013800 | 622 | VIM4 "VARIANT IN METHYLATION 4 | 0.649 | 0.787 | 0.658 | 2.5e-210 | |
| TAIR|locus:2013840 | 623 | VIM2 "VARIANT IN METHYLATION 2 | 0.628 | 0.760 | 0.676 | 4.1e-210 | |
| TAIR|locus:2009425 | 660 | VIM5 "VARIANT IN METHYLATION 5 | 0.620 | 0.709 | 0.632 | 3.7e-206 | |
| TAIR|locus:2138591 | 465 | ORTHL "ORTHRUS-like" [Arabidop | 0.415 | 0.673 | 0.657 | 1.3e-122 | |
| UNIPROTKB|Q96T88 | 793 | UHRF1 "E3 ubiquitin-protein li | 0.271 | 0.258 | 0.461 | 1e-53 | |
| UNIPROTKB|F1PJN4 | 792 | UHRF1 "Uncharacterized protein | 0.259 | 0.247 | 0.469 | 7.8e-53 | |
| RGD|1595855 | 774 | Uhrf1 "ubiquitin-like with PHD | 0.257 | 0.250 | 0.472 | 1e-51 | |
| UNIPROTKB|F6UA42 | 775 | uhrf1 "E3 ubiquitin-protein li | 0.370 | 0.36 | 0.383 | 5e-48 |
| TAIR|locus:2009420 VIM1 "AT1G57820" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1956 (693.6 bits), Expect = 4.3e-239, Sum P(2) = 4.3e-239
Identities = 359/472 (76%), Positives = 403/472 (85%)
Query: 146 CSFCMQLPERPVTTPCGHNFCLKCFQKWIGQGKRTCAKCRHIIPPKMASQPRINSALVTA 205
CSFCMQLPERPVT PCGHN CLKCF+KW+GQGKRTC KCR IIP KMA PRINS+LV A
Sbjct: 146 CSFCMQLPERPVTKPCGHNACLKCFEKWMGQGKRTCGKCRSIIPEKMAKNPRINSSLVAA 205
Query: 206 IRMAKLSKSNLAAVPTKVYHFMRNQDRPDKAFTTERAQKTGKANAASGKIFVTIPPDHFG 265
IR+AK+SKS AA +KV+HF+ NQDRPDKAFTTERA+KTGKANAASGKI+VTIPPDHFG
Sbjct: 206 IRLAKVSKS-AAATTSKVFHFISNQDRPDKAFTTERAKKTGKANAASGKIYVTIPPDHFG 264
Query: 266 PIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDE 325
PIPAENDP RNQG+LVGE WEDRLECRQWGAHFPHVAGIAGQS YG+QSVALSGGY+DDE
Sbjct: 265 PIPAENDPVRNQGLLVGESWEDRLECRQWGAHFPHVAGIAGQSTYGAQSVALSGGYKDDE 324
Query: 326 DHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRSHKEKRS 385
DHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEK N AL++SCK GYPVRVVRSHKEKRS
Sbjct: 325 DHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKSNAALKLSCKLGYPVRVVRSHKEKRS 384
Query: 386 SYAPEKGVRYDGVYRIEKCWRKIGIQG-FKVCRYLFVRCDNEPAPWTSDEFGDRPRSLPG 444
+YAPE+GVRYDGVYRIEKCWRK+G+QG FKVCRYLFVRCDNEPAPWTSDE GDRPR +P
Sbjct: 385 AYAPEEGVRYDGVYRIEKCWRKVGVQGSFKVCRYLFVRCDNEPAPWTSDENGDRPRPIPN 444
Query: 445 IPELKMATDVTERKESPAWDFDEEDSRXXXXXXXXXXXXXIGTGKPEDGKKVRRAIRQAQ 504
IPEL MATD+ ERKE+P+WDFDE + + PE+ K +R+AI+ A
Sbjct: 445 IPELNMATDLFERKETPSWDFDEGEGCWKWMKPPPASKKSVNVLAPEERKNLRKAIKAAH 504
Query: 505 NTSVREKLLKEFSCLICRQVMNLPITTPCAHNFCKSCLEGAFAGKTFVRERSRGGRTLRS 564
+ ++R +LLKEF C IC+QV+ LP+TTPCAHNFCK+CLE FAGKT VRERS GGRTLRS
Sbjct: 505 SNTMRARLLKEFKCQICQQVLTLPVTTPCAHNFCKACLEAKFAGKTLVRERSTGGRTLRS 564
Query: 565 QKNVMQCPSCPTDISEFLQNPQVNRELMDVIESLKHKTEENEDPPEELSDEE 616
+KNV+ CP CPTDIS+FLQNPQVNRE+ +VIE LK T+E ED E L DE+
Sbjct: 565 RKNVLNCPCCPTDISDFLQNPQVNREVAEVIEKLK--TQE-EDTAE-LEDED 612
|
|
| TAIR|locus:2164835 VIM3 "VARIANT IN METHYLATION 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013800 VIM4 "VARIANT IN METHYLATION 4" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2013840 VIM2 "VARIANT IN METHYLATION 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009425 VIM5 "VARIANT IN METHYLATION 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138591 ORTHL "ORTHRUS-like" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q96T88 UHRF1 "E3 ubiquitin-protein ligase UHRF1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJN4 UHRF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1595855 Uhrf1 "ubiquitin-like with PHD and ring finger domains 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6UA42 uhrf1 "E3 ubiquitin-protein ligase UHRF1" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q8VYZ0 | ORTH2_ARATH | 6, ., 3, ., 2, ., - | 0.7274 | 0.8063 | 0.9426 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 6.3.2 | 0.691 |
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 754 | |||
| pfam02182 | 154 | pfam02182, YDG_SRA, YDG/SRA domain | 4e-73 | |
| smart00466 | 155 | smart00466, SRA, SET and RING finger associated do | 2e-63 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 4e-11 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 5e-09 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 2e-07 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 2e-07 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 1e-06 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 3e-06 | |
| COG5574 | 271 | COG5574, PEX10, RING-finger-containing E3 ubiquiti | 4e-05 | |
| PLN03208 | 193 | PLN03208, PLN03208, E3 ubiquitin-protein ligase RM | 2e-04 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 2e-04 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 8e-04 | |
| pfam13445 | 55 | pfam13445, zf-RING_LisH, RING-type zinc-finger, Li | 8e-04 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 0.001 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 0.002 | |
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 0.004 |
| >gnl|CDD|216920 pfam02182, YDG_SRA, YDG/SRA domain | Back alignment and domain information |
|---|
Score = 234 bits (598), Expect = 4e-73
Identities = 76/167 (45%), Positives = 94/167 (56%), Gaps = 17/167 (10%)
Query: 263 HFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGS---QSVALSG 319
G +P GV VG+ + R+E G H PH AGI G + G S+ SG
Sbjct: 2 RIGHVP---------GVEVGDIFFYRVELCVVGLHRPHQAGIDGMKSEGGTIATSIVSSG 52
Query: 320 GYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRS 379
GYEDDED+G+ +YTG GG DLSGNK QS DQK E+ N AL SC+KG PVRV+R
Sbjct: 53 GYEDDEDNGDVLVYTGQGGNDLSGNK-----QSEDQKLERGNLALANSCRKGNPVRVIRG 107
Query: 380 HKEKRSSYAPEKGVRYDGVYRIEKCWRKIGIQGFKVCRYLFVRCDNE 426
K S RYDG+YR+EK WR+ G GFKV ++ VR +
Sbjct: 108 EKGPSSHAPKGGIYRYDGLYRVEKYWREKGKSGFKVFKFKLVRIPGQ 154
|
The function of this domain is unknown, it contains a conserved motif YDG after which it has been named. Length = 154 |
| >gnl|CDD|197742 smart00466, SRA, SET and RING finger associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif | Back alignment and domain information |
|---|
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 754 | |||
| smart00466 | 155 | SRA SET and RING finger associated domain. Domain | 100.0 | |
| PF02182 | 155 | SAD_SRA: SAD/SRA domain; InterPro: IPR003105 This | 100.0 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.15 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 99.05 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 99.03 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.99 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.96 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.92 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 98.9 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.9 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.9 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.86 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.85 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.85 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 98.85 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.82 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.78 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.77 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.68 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.65 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.64 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.63 | |
| KOG2177 | 386 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.61 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.6 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.6 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.59 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.55 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 98.55 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.54 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.52 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.52 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.49 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.42 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.41 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 98.4 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.37 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 98.36 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.36 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.28 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.28 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.25 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.24 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.24 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.2 | |
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 98.19 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.16 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.12 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.12 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.11 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.1 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.04 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.02 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 98.01 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.01 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.99 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.96 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.95 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 97.94 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 97.92 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 97.89 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.83 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.78 | |
| KOG1244 | 336 | consensus Predicted transcription factor Requiem/N | 97.78 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.74 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.71 | |
| TIGR00570 | 309 | cdk7 CDK-activating kinase assembly factor MAT1. A | 97.7 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.58 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 97.57 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.56 | |
| KOG4367 | 699 | consensus Predicted Zn-finger protein [Function un | 97.56 | |
| KOG0824 | 324 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.49 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.47 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 97.41 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 97.4 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 97.36 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.31 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.31 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.3 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 97.27 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.27 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 97.24 | |
| KOG0957 | 707 | consensus PHD finger protein [General function pre | 97.22 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.19 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.16 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 97.01 | |
| KOG4299 | 613 | consensus PHD Zn-finger protein [General function | 96.98 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.98 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.81 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.8 | |
| KOG1245 | 1404 | consensus Chromatin remodeling complex WSTF-ISWI, | 96.78 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.77 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.65 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 96.57 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 96.48 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 96.44 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 96.38 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 96.37 | |
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.32 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 96.31 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.3 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.27 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.16 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.05 | |
| COG3440 | 301 | Predicted restriction endonuclease [Defense mechan | 95.58 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.52 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.37 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 95.34 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.31 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.2 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 95.19 | |
| KOG4185 | 296 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.09 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 95.09 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 94.72 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 94.7 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.69 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.61 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.6 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.6 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.56 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 94.27 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 94.19 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.12 | |
| KOG0955 | 1051 | consensus PHD finger protein BR140/LIN-49 [General | 93.97 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.92 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 93.8 | |
| KOG4443 | 694 | consensus Putative transcription factor HALR/MLL3, | 93.77 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 93.69 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.53 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 93.47 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 93.46 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 93.28 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 93.2 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.95 | |
| KOG1512 | 381 | consensus PHD Zn-finger protein [General function | 92.92 | |
| KOG0383 | 696 | consensus Predicted helicase [General function pre | 92.83 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.75 | |
| KOG1645 | 463 | consensus RING-finger-containing E3 ubiquitin liga | 92.55 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 92.22 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 91.95 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 91.94 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 91.93 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.9 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 91.79 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 91.59 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 91.55 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 91.44 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 91.4 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 91.31 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 91.16 | |
| KOG3800 | 300 | consensus Predicted E3 ubiquitin ligase containing | 90.92 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 90.88 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 90.15 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 90.02 | |
| KOG4362 | 684 | consensus Transcriptional regulator BRCA1 [Replica | 90.01 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.92 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.85 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 89.71 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 89.53 | |
| PHA03096 | 284 | p28-like protein; Provisional | 89.38 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 89.31 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 89.17 | |
| KOG3161 | 861 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.13 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 89.0 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 88.86 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 88.4 | |
| KOG0954 | 893 | consensus PHD finger protein [General function pre | 88.11 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 87.96 | |
| PF05290 | 140 | Baculo_IE-1: Baculovirus immediate-early protein ( | 87.53 | |
| PF07800 | 162 | DUF1644: Protein of unknown function (DUF1644); In | 85.93 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 85.81 | |
| KOG4739 | 233 | consensus Uncharacterized protein involved in syna | 85.74 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 85.53 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 85.49 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.83 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 84.79 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 84.5 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 84.45 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 84.26 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 84.05 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 84.03 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 83.44 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 82.2 | |
| KOG1812 | 384 | consensus Predicted E3 ubiquitin ligase [Posttrans | 81.94 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 81.06 | |
| COG5220 | 314 | TFB3 Cdk activating kinase (CAK)/RNA polymerase II | 80.04 |
| >smart00466 SRA SET and RING finger associated domain | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-54 Score=414.27 Aligned_cols=150 Identities=50% Similarity=0.841 Sum_probs=143.1
Q ss_pred CCCCCCCCCCCCCCCCCcccccCccchhhhhhhccCcCCCCCCcccCC----CCcceEEeccCCCccCCCCCcEEEEEec
Q 004418 261 PDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQS----NYGSQSVALSGGYEDDEDHGEWFLYTGS 336 (754)
Q Consensus 261 ~~~~Gpip~~~~p~~~~Gv~vG~~~~~r~~~~~~G~H~~~~~GI~~~~----~~Ga~Siv~sggy~dd~d~gd~~~YtG~ 336 (754)
..+||+|| ||+|||||++|+||+++|||+++|+||++++ ..||+|||+||||+||+|+||+|+|||+
T Consensus 2 ~~~~G~vp---------Gv~vGd~f~~R~el~~~GlH~~~~~GI~~~~~~~~~~~A~SIV~SggYedd~D~gd~liYtG~ 72 (155)
T smart00466 2 KHIFGPVP---------GVEVGDIFFFRVELCLVGLHRPTQAGIDGLTADEGEPGATSVVSSGGYEDDTDDGDVLIYTGQ 72 (155)
T ss_pred CceEeCCC---------CccCCCEEcchhHhhhhcccCcccCCcccccccCCCccEEEEEECCCccCcccCCCEEEEEcc
Confidence 46799999 9999999999999999999999999999998 6889999999999999999999999999
Q ss_pred CCCCCCCCccCCccccccchhhhhHHHHHHHhhcCCcEEEEecccCCCCCCCCCCceEEceeeEEEEEEEeeCCcCceEE
Q 004418 337 GGRDLSGNKRTNKEQSFDQKFEKMNEALRVSCKKGYPVRVVRSHKEKRSSYAPEKGVRYDGVYRIEKCWRKIGIQGFKVC 416 (754)
Q Consensus 337 gg~~~~~~~~~~~~~~~dQ~~~~~n~AL~~s~~~g~pVRViR~~~~~~s~~ap~~gyrYDGLY~V~~~w~~~g~~g~~v~ 416 (754)
||++.. + .|..||+|++||+||++||++++|||||||++. ++.|+|.++|||||||+|++||.++|++||.||
T Consensus 73 gg~~~~--~----~~~~dQkl~~gNlAL~~S~~~~~PVRViRg~~~-~~~~~p~~gyrYDGLY~V~~~w~e~g~~G~~v~ 145 (155)
T smart00466 73 GGRDMT--H----GQPEDQKLERGNLALEASCRKGIPVRVVRGMKG-YSKYAPGKGYIYDGLYRIVDYWREVGKSGFLVF 145 (155)
T ss_pred CCccCC--C----CCccccEecchhHHHHHHHhcCCceEEEccccc-cCCCCCCCeEEECcEEEEEEEEEecCCCCcEEE
Confidence 999852 2 388999999999999999999999999999997 789999999999999999999999999999999
Q ss_pred EEEEEEeCCC
Q 004418 417 RYLFVRCDNE 426 (754)
Q Consensus 417 ~f~l~R~~~q 426 (754)
||+|+|+|||
T Consensus 146 kfkL~R~~gQ 155 (155)
T smart00466 146 KFKLVRIPGQ 155 (155)
T ss_pred EEEEEeCCCC
Confidence 9999999998
|
Domain of unknown function in SET domain containing proteins and in Deinococcus radiodurans DRA1533. Domain in SET domain containing proteins and in Deinococcus radiodurans DRA1533. |
| >PF02182 SAD_SRA: SAD/SRA domain; InterPro: IPR003105 This domain has been termed SRA-YDG, for SET and Ring finger Associated, and because of the conserved YDG motif within the domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4367 consensus Predicted Zn-finger protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0957 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4299 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG3440 Predicted restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1512 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0383 consensus Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG0954 consensus PHD finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 | Back alignment and domain information |
|---|
| >PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 754 | ||||
| 2pb7_A | 239 | Crystal Structure Of The Sra Domain Of The Human Uh | 6e-44 | ||
| 3f8j_B | 212 | Mouse Uhrf1 Sra Domain Bound With Hemi-methylated C | 7e-44 | ||
| 2zo0_B | 212 | Mouse Np95 Sra Domain Dna Specific Complex 1 Length | 1e-43 | ||
| 2zkd_A | 210 | Crystal Structure Of The Sra Domain Of Mouse Np95 I | 1e-43 | ||
| 3clz_A | 212 | The Set And Ring Associated (Sra) Domain Of Uhrf1 B | 1e-43 | ||
| 3dwh_A | 208 | Structural And Functional Analysis Of Sra Domain Le | 1e-43 | ||
| 3bi7_A | 212 | Crystal Structure Of The Sra Domain Of E3 Ubiquitin | 2e-43 | ||
| 3oln_A | 231 | Crystal Structure Of The Sra Domain Of E3 Ubiquitin | 2e-38 | ||
| 3q0c_X | 167 | Crystal Structure Of Suvh5 Sra-Fully Methylated Cg | 5e-15 | ||
| 3q0b_X | 167 | Crystal Structure Of Suvh5 Sra- Fully Methylated Cg | 2e-14 | ||
| 3fl2_A | 124 | Crystal Structure Of The Ring Domain Of The E3 Ubiq | 6e-05 | ||
| 1z6u_A | 150 | Np95-Like Ring Finger Protein Isoform B [homo Sapie | 1e-04 | ||
| 1jm7_A | 112 | Solution Structure Of The Brca1/bard1 Ring-domain H | 8e-04 |
| >pdb|2PB7|A Chain A, Crystal Structure Of The Sra Domain Of The Human Uhrf1 Protein Length = 239 | Back alignment and structure |
|
| >pdb|3F8J|B Chain B, Mouse Uhrf1 Sra Domain Bound With Hemi-methylated Cpg, Crystal Structure In Space Group C222(1) Length = 212 | Back alignment and structure |
| >pdb|2ZO0|B Chain B, Mouse Np95 Sra Domain Dna Specific Complex 1 Length = 212 | Back alignment and structure |
| >pdb|2ZKD|A Chain A, Crystal Structure Of The Sra Domain Of Mouse Np95 In Complex With Hemi-Methylated Cpg Dna Length = 210 | Back alignment and structure |
| >pdb|3CLZ|A Chain A, The Set And Ring Associated (Sra) Domain Of Uhrf1 Bound To Methylated Dna Length = 212 | Back alignment and structure |
| >pdb|3DWH|A Chain A, Structural And Functional Analysis Of Sra Domain Length = 208 | Back alignment and structure |
| >pdb|3BI7|A Chain A, Crystal Structure Of The Sra Domain Of E3 Ubiquitin-Protein Ligase Uhrf1 Length = 212 | Back alignment and structure |
| >pdb|3OLN|A Chain A, Crystal Structure Of The Sra Domain Of E3 Ubiquitin-Protein Ligase Uhrf2 Length = 231 | Back alignment and structure |
| >pdb|3Q0C|X Chain X, Crystal Structure Of Suvh5 Sra-Fully Methylated Cg Dna Complex In Space Group P6122 Length = 167 | Back alignment and structure |
| >pdb|3Q0B|X Chain X, Crystal Structure Of Suvh5 Sra- Fully Methylated Cg Dna Complex In Space Group P42212 Length = 167 | Back alignment and structure |
| >pdb|3FL2|A Chain A, Crystal Structure Of The Ring Domain Of The E3 Ubiquitin- Protein Ligase Uhrf1 Length = 124 | Back alignment and structure |
| >pdb|1Z6U|A Chain A, Np95-Like Ring Finger Protein Isoform B [homo Sapiens] Length = 150 | Back alignment and structure |
| >pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3oln_A E3 ubiquitin-protein ligase UHRF2; DNA-binding, metal-binding, nucleus, phosphorylation transcription, transcription regulation; 2.30A {Homo sapiens} Length = 231 | Back alignment and structure |
|---|
Score = 226 bits (577), Expect = 2e-69
Identities = 95/224 (42%), Positives = 127/224 (56%), Gaps = 30/224 (13%)
Query: 238 TTERAQKTGKANAASG--KIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWG 295
+TE + G+ A G + +P +H+GPIP G+ VG W R++ + G
Sbjct: 2 STESRRDWGRGMACVGRTRECTIVPSNHYGPIP---------GIPVGSTWRFRVQVSEAG 52
Query: 296 AHFPHVAGIAGQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQ 355
H PHV GI G+SN G+ S+ L+GG+ D+ D G+ F YTGSGG++L+GNKR S DQ
Sbjct: 53 VHRPHVGGIHGRSNDGAYSLVLAGGFADEVDRGDEFTYTGSGGKNLAGNKRIG-APSADQ 111
Query: 356 KFEKMNEALRVSC---------------KKGYPVRVVRSHK-EKRSSYAPEKGVRYDGVY 399
MN AL ++C + G PVRV+RS K K S YAPE+G RYDG+Y
Sbjct: 112 TLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKGRKISKYAPEEGNRYDGIY 171
Query: 400 RIEKCWRKIGIQ-GFKVCRYLFVRCDNEPAPWTSDEFGDRPRSL 442
++ K W +I GF V RYL R D EPAPWTS+ +R R L
Sbjct: 172 KVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEG-IERSRRL 214
|
| >2pb7_A E3 ubiquitin-protein ligase UHRF1; beta barrel, NEW fold; 1.90A {Homo sapiens} SCOP: b.122.1.12 Length = 239 | Back alignment and structure |
|---|
| >3fde_A E3 ubiquitin-protein ligase UHRF1; SRA domain, base flipping, DNA CPG methylation, cell cycle, developmental protein, DNA damage; HET: 5CM; 1.41A {Mus musculus} PDB: 2zo0_B* 2zo2_B* 3f8i_A* 2zo1_B* 3f8j_B* 2zkd_A* 2zke_A* 2zkf_A* 2zkg_A 3dwh_A 3bi7_A 3clz_A* Length = 212 | Back alignment and structure |
|---|
| >3q0b_X Histone-lysine N-methyltransferase, H3 lysine-9 S SUVH5; SRA, fully methylated CG, SUVH5, 5MC binding protein, fully methylated CG duplex DNA; HET: DNA 5CM; 2.20A {Arabidopsis thaliana} PDB: 3q0c_X* 3q0d_X* 3q0f_X* Length = 167 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 | Back alignment and structure |
|---|
| >3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 754 | |||
| 3oln_A | 231 | E3 ubiquitin-protein ligase UHRF2; DNA-binding, me | 100.0 | |
| 3fde_A | 212 | E3 ubiquitin-protein ligase UHRF1; SRA domain, bas | 100.0 | |
| 2pb7_A | 239 | E3 ubiquitin-protein ligase UHRF1; beta barrel, NE | 100.0 | |
| 3q0b_X | 167 | Histone-lysine N-methyltransferase, H3 lysine-9 S | 100.0 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.41 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.4 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.4 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.39 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.39 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.38 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.37 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.35 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.34 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.34 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.33 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 99.33 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.33 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.33 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.33 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 99.31 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 99.3 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.3 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.28 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 99.28 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 99.27 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 99.26 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.25 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.24 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.22 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.21 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.19 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.18 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.18 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.18 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.16 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.16 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.16 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.15 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 99.15 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 99.14 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.13 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.13 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.12 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.12 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.1 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.1 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.09 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 99.09 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.09 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 99.09 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.09 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.08 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.07 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.07 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 99.07 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.06 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.05 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 99.04 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.02 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.01 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.0 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 99.0 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.0 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.0 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 98.99 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.98 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.97 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.96 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.95 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.95 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.95 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 98.95 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.93 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.93 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.92 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.92 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.91 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.91 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 98.9 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.89 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.88 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 98.88 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.88 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.87 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.86 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.86 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.86 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.86 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.85 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 98.84 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.84 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.83 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.83 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.82 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 98.82 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 98.81 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.81 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 98.8 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.79 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 98.79 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.79 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.79 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 98.79 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.78 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 98.78 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.77 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.76 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.76 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 98.74 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.74 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.72 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 98.72 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 98.72 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.71 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.7 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.7 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.69 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 98.69 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 98.68 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.67 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.67 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 98.65 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.64 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 98.64 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.63 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.58 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.57 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.56 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 98.55 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.53 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.51 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.49 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.48 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.45 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.45 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.44 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.44 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.43 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.41 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.4 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.39 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.38 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.37 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 98.37 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.35 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 98.34 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.33 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 98.3 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 98.29 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.29 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.29 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.28 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.25 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.17 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 98.15 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 98.15 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.99 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.93 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 97.83 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.82 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 97.71 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 97.69 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 97.66 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.62 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.59 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 97.49 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.47 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.34 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 97.28 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.23 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.15 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 96.91 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 96.88 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 96.84 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 96.8 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 96.78 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 96.76 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 96.75 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 96.68 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 96.59 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 96.55 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 96.11 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 95.96 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 95.75 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 95.67 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 95.45 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 95.45 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 95.23 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 95.19 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 95.01 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 94.9 | |
| 3m62_A | 968 | Ubiquitin conjugation factor E4; armadillo-like re | 94.69 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 94.56 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 94.08 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 93.96 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 93.58 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 93.06 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 92.3 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 92.18 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 91.47 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 91.39 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 91.15 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 89.76 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 89.2 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 88.66 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 86.91 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 81.46 |
| >3oln_A E3 ubiquitin-protein ligase UHRF2; DNA-binding, metal-binding, nucleus, phosphorylation transcription, transcription regulation; 2.30A {Homo sapiens} SCOP: b.122.1.12 | Back alignment and structure |
|---|
Probab=100.00 E-value=3.2e-65 Score=511.40 Aligned_cols=185 Identities=49% Similarity=0.904 Sum_probs=151.0
Q ss_pred hhhhhcCCcccccCceee--cCCCCCCCCCCCCCCCCCCCcccccCccchhhhhhhccCcCCCCCCcccCCCCcceEEec
Q 004418 240 ERAQKTGKANAASGKIFV--TIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVAL 317 (754)
Q Consensus 240 eRA~k~gkana~sgri~~--~~~~~~~Gpip~~~~p~~~~Gv~vG~~~~~r~~~~~~G~H~~~~~GI~~~~~~Ga~Siv~ 317 (754)
+..++||++|||+|++|+ ++|.++||||| ||+|||||+||+||+++|+|+++|+||+|++..||||||+
T Consensus 4 ~~~~~~g~~~a~~g~~~~~~~~p~~~~G~IP---------GV~VGd~f~~R~el~~~GlH~p~~aGI~g~~~~GA~SIVl 74 (231)
T 3oln_A 4 ESRRDWGRGMACVGRTRECTIVPSNHYGPIP---------GIPVGSTWRFRVQVSEAGVHRPHVGGIHGRSNDGAYSLVL 74 (231)
T ss_dssp --------------------CCCTTCCSCCT---------TCCTTCEESSHHHHHHTTSSCCSSCSEEEETTTEEEEEEE
T ss_pred cccccccccccccceeEEEeecCCccCcCCC---------CCcCcCEEccHHHHhhhCCCCcccCCcccCCCCCeEEEEe
Confidence 456689999999999997 56999999999 9999999999999999999999999999999999999999
Q ss_pred cCCCccCCCCCcEEEEEecCCCCCCCCccCCccccccchhhhhHHHHHHHh---------------hcCCcEEEEecccC
Q 004418 318 SGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVSC---------------KKGYPVRVVRSHKE 382 (754)
Q Consensus 318 sggy~dd~d~gd~~~YtG~gg~~~~~~~~~~~~~~~dQ~~~~~n~AL~~s~---------------~~g~pVRViR~~~~ 382 (754)
||||+||+|+||+|+|||+||+|++||+|++. |++||+|++||+||++|| +.|+|||||||++.
T Consensus 75 SGgYeDD~D~Gd~liYTGsGG~d~~gnkrt~~-q~~DQkl~~gNlAL~~Sc~~~~~~k~~~~~~~~~~g~PVRVIRg~k~ 153 (231)
T 3oln_A 75 AGGFADEVDRGDEFTYTGSGGKNLAGNKRIGA-PSADQTLTNMNRALALNCDAPLDDKIGAESRNWRAGKPVRVIRSFKG 153 (231)
T ss_dssp SSCSSTTCBCSSEEEEECCCC------------CCSCCCSCHHHHHHHHHSSSCCCTTTCEECSSGGGSCCEEEEEEGGG
T ss_pred cCCccccCCCCCEEEEEcCCCccCcCcccccc-cccccccccchHHHHhhhhccccccccchhhhhccCCceEEEecccc
Confidence 99999999999999999999999999999874 999999999999999996 46899999999996
Q ss_pred -CCCCCCCCCceEEceeeEEEEEEEeeCCc-CceEEEEEEEEeCCCCCCCCccc
Q 004418 383 -KRSSYAPEKGVRYDGVYRIEKCWRKIGIQ-GFKVCRYLFVRCDNEPAPWTSDE 434 (754)
Q Consensus 383 -~~s~~ap~~gyrYDGLY~V~~~w~~~g~~-g~~v~~f~l~R~~~qp~~~~~~~ 434 (754)
++|.|||.+||||||||+|++||.++|++ ||.||||+|+|+++||+||++++
T Consensus 154 ~k~s~yaP~~gyrYDGLY~V~~~W~e~g~s~G~~V~Kf~L~R~~gQP~~w~~~~ 207 (231)
T 3oln_A 154 RKISKYAPEEGNRYDGIYKVVKYWPEISSSHGFLVWRYLLRRDDVEPAPWTSEG 207 (231)
T ss_dssp TTTCTTSCSSSEEEEEEEEEEEEEEEECTTTCCEEEEEEEEECCSSCCTTSHHH
T ss_pred CcCCCccCCCCeEeCeEEEEEEEEeccCCcCCeEEEEEEEEECCCCCCCcchhh
Confidence 47999999999999999999999999999 99999999999999999999876
|
| >3fde_A E3 ubiquitin-protein ligase UHRF1; SRA domain, base flipping, DNA CPG methylation, cell cycle, developmental protein, DNA damage; HET: 5CM; 1.41A {Mus musculus} SCOP: b.122.1.12 PDB: 2zo0_B* 2zo2_B* 3f8i_A* 2zo1_B* 3f8j_B* 2zkd_A* 2zke_A* 2zkf_A* 2zkg_A 3dwh_A 3bi7_A 3clz_A* | Back alignment and structure |
|---|
| >2pb7_A E3 ubiquitin-protein ligase UHRF1; beta barrel, NEW fold; 1.90A {Homo sapiens} SCOP: b.122.1.12 | Back alignment and structure |
|---|
| >3q0b_X Histone-lysine N-methyltransferase, H3 lysine-9 S SUVH5; SRA, fully methylated CG, SUVH5, 5MC binding protein, fully methylated CG duplex DNA; HET: DNA 5CM; 2.20A {Arabidopsis thaliana} PDB: 3q0c_X* 3q0d_X* 3q0f_X* | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 754 | ||||
| d2zkda1 | 209 | b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase | 2e-81 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 9e-14 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 2e-06 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 5e-12 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 4e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 2e-11 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 7e-05 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 3e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 5e-06 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 5e-08 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 2e-04 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 9e-08 | |
| d1t1ha_ | 78 | g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre | 0.003 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 1e-07 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 5e-05 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 2e-07 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 1e-06 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 3e-06 | |
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 3e-06 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 4e-06 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 3e-05 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 4e-05 | |
| d2c2la2 | 80 | g.44.1.2 (A:225-304) STIP1 homology and U box-cont | 2e-04 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 4e-04 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 5e-04 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 0.002 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 0.003 |
| >d2zkda1 b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PUA domain-like superfamily: PUA domain-like family: SRA domain-like domain: E3 ubiquitin-protein ligase UHRF1 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 256 bits (655), Expect = 2e-81
Identities = 103/220 (46%), Positives = 125/220 (56%), Gaps = 29/220 (13%)
Query: 246 GKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIA 305
G A +P +HFGPIP GV VG W R++ + G H PHVAGI
Sbjct: 1 GMACVGRTTECTIVPANHFGPIP---------GVPVGTMWRFRVQVSESGVHRPHVAGIH 51
Query: 306 GQSNYGSQSVALSGGYEDDEDHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALR 365
G+SN G+ S+ L+GGYEDD D+G +F YTGSGGRDLSGNKRT QS DQK N AL
Sbjct: 52 GRSNDGAYSLVLAGGYEDDVDNGNYFTYTGSGGRDLSGNKRTA-GQSSDQKLTNNNRALA 110
Query: 366 VSC--------------KKGYPVRVVRSHK-EKRSSYAPEKGVRYDGVYRIEKCWRKIGI 410
++C ++G PVRVVR+ K K S YAP +G RYDG+Y++ K W + G
Sbjct: 111 LNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPAEGNRYDGIYKVVKYWPERGK 170
Query: 411 QGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSL---PGIPE 447
GF V RYL R D EP PWT + DR R L PE
Sbjct: 171 SGFLVWRYLLRRDDTEPEPWTREG-KDRTRQLGLTMQYPE 209
|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 754 | |||
| d2zkda1 | 209 | E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musc | 100.0 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.43 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.42 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 99.39 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.39 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 99.39 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.38 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.37 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.34 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.29 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 99.25 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.21 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 99.13 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.02 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.98 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.94 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 98.94 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.93 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.88 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.87 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 98.87 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.84 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.82 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 98.8 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 98.79 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 98.74 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 98.7 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 98.57 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.42 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 98.37 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 98.34 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.33 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 98.14 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.13 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.07 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.03 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.87 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.66 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.57 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 97.55 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.41 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.02 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 96.59 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 96.4 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 95.72 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 87.04 |
| >d2zkda1 b.122.1.12 (A:405-613) E3 ubiquitin-protein ligase UHRF1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PUA domain-like superfamily: PUA domain-like family: SRA domain-like domain: E3 ubiquitin-protein ligase UHRF1 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=6.7e-62 Score=482.22 Aligned_cols=186 Identities=54% Similarity=0.924 Sum_probs=174.6
Q ss_pred CCcccccCceeecCCCCCCCCCCCCCCCCCCCcccccCccchhhhhhhccCcCCCCCCcccCCCCcceEEeccCCCccCC
Q 004418 246 GKANAASGKIFVTIPPDHFGPIPAENDPERNQGVLVGECWEDRLECRQWGAHFPHVAGIAGQSNYGSQSVALSGGYEDDE 325 (754)
Q Consensus 246 gkana~sgri~~~~~~~~~Gpip~~~~p~~~~Gv~vG~~~~~r~~~~~~G~H~~~~~GI~~~~~~Ga~Siv~sggy~dd~ 325 (754)
|++++-.+++++++|.+|||+|| ||+|||||+||+||+++|||+++++||+|++..||+|||+||||+||.
T Consensus 1 g~~~~~~~~~~~~~p~~~~G~vp---------Gv~VGd~F~~R~el~~~GlH~~~~aGI~g~~~~GA~SIV~SGgYeDD~ 71 (209)
T d2zkda1 1 GMACVGRTTECTIVPANHFGPIP---------GVPVGTMWRFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDV 71 (209)
T ss_dssp TTTTCCCSCCCCSSCTTCCSCCT---------TCCTTCEESSHHHHHHTTSSCCSSCSEEEETTTEEEEEEECSCSTTCE
T ss_pred CcccccccceEEeCCCCcccCCC---------CCCCCCEECCHHHHHHcCCCCCccCcEeecCCCceEEEEECCCccccc
Confidence 56777788899999999999999 999999999999999999999999999999999999999999999999
Q ss_pred CCCcEEEEEecCCCCCCCCccCCccccccchhhhhHHHHHHH--------------hhcCCcEEEEecccC-CCCCCCCC
Q 004418 326 DHGEWFLYTGSGGRDLSGNKRTNKEQSFDQKFEKMNEALRVS--------------CKKGYPVRVVRSHKE-KRSSYAPE 390 (754)
Q Consensus 326 d~gd~~~YtG~gg~~~~~~~~~~~~~~~dQ~~~~~n~AL~~s--------------~~~g~pVRViR~~~~-~~s~~ap~ 390 (754)
|+||+|+|||+||++..++++++. |..||+|++||+||++| +++++|||||||++. +++.|+|.
T Consensus 72 D~gd~liYTG~GG~d~~~~k~~~~-q~~DQkl~~gNlAL~~Sc~~~~n~~~~~~~~~~~g~PVRVIRg~k~~~~~~~~p~ 150 (209)
T d2zkda1 72 DNGNYFTYTGSGGRDLSGNKRTAG-QSSDQKLTNNNRALALNCHSPINEKGAEAEDWRQGKPVRVVRNMKGGKHSKYAPA 150 (209)
T ss_dssp ECSSEEEEECSCCBCCTTTCSCCC-BCSCCCSSHHHHHHHHTSSSCCCTTCEECTTGGGSCCEEEEEEGGGGGTCTTSCS
T ss_pred cCCcEEEEECCCCccccCCccccc-cccceeeccchHHHhhccccccccccchhhhhhcCCceEEEEeeccccCCCcCCC
Confidence 999999999999999999999875 99999999999999999 578999999999986 57899999
Q ss_pred CceEEceeeEEEEEEEeeCCcCceEEEEEEEEeCCCCCCCCccccCCCCCCC
Q 004418 391 KGVRYDGVYRIEKCWRKIGIQGFKVCRYLFVRCDNEPAPWTSDEFGDRPRSL 442 (754)
Q Consensus 391 ~gyrYDGLY~V~~~w~~~g~~g~~v~~f~l~R~~~qp~~~~~~~~~~~~~~~ 442 (754)
+||||||||+|++||.++|++||.||||+|+|+++||+||+... ++|++++
T Consensus 151 ~gYrYDGLY~V~~~w~e~gk~G~~V~rF~L~R~~gQp~p~~~~~-~~r~~~~ 201 (209)
T d2zkda1 151 EGNRYDGIYKVVKYWPERGKSGFLVWRYLLRRDDTEPEPWTREG-KDRTRQL 201 (209)
T ss_dssp SSEEEEEEEEEEEEEEEECTTSSEEEEEEEEECCSSCCTTSHHH-HHHHHHH
T ss_pred ceEEeCcEEEEEEEEEccCCCCcEEEEEEEEECCCCCCCcccCC-cCCCCcc
Confidence 99999999999999999999999999999999999999999764 4555544
|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|