Citrus Sinensis ID: 004489


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------75
MVGLIDLNTTEDDENPSSGSLSPSSSSASALSASGFALAPAPASASASASGVSLELWHACAGPLISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDLPPHPFCRVADVKLHAEAASDEVYAQVSLVPDELIEQKVREGKIEDGDEDSVEVVAKSSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELRLGIRRAPHVKSGATFPSFCSQQSSPNSVTEVVDAIARKRAFSISYNPRASASEFIIPVNKFLKSLDHSFAVGMRFKMRFETDDAAERRYTGVIMGVGDVDPVRWPGSKWRCLLVRWDDVESNRHTRVSPWEIEPSGSVCGSNNLITSGLKRTRIGLPSGKPEFPVPDGIGVTDFGESLRFQKVLQGQEILGFNTLYDGGDCQNLHPSEVRRGILGSNGSGIAAIGDGSRNLQVKSDISYKGIGIGFGESFRFHKVLQGQEIFPKSPYGRAPTNNEARGIGSLGISDGVLVSGSRNRWSAVVPGYNTHTSPSAPPVQVSSPSSVLMFQLASNPISNYNPPYSLNDQEKEQRVNCQSFFHNSEIYGGKHASSSFLDHSFRGGDQEVMDSIGQSNEHISPPLVGQPTVRGSQDLVSSCKGSCRLFGFSLTEERHVANIEDNAAPVASPLNPRSSFLSHVGQQFHPKPPVMSKATGSNCTNVSNHCAVRDMLFDIAL
cccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccEEEECcccccccccccccHcccccccccccccEEEEcccHHccccHHHHccccccccHHHHHHHHcccccccccccHHHHHcccccCEEEEEECccccccccccCEccccHHHccccccccccccccEEEEEcccccEEEEEEEECccccCEEEccccHHHHcccccccccEEEEEEcccccEEEEEEEccccccccccccccccccccccHHHHHHHHHHccccccccccccccccEEEHHHHHHHHHccccccccEEEEEEEccccccEEEEEEEEEECccccccccccccEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccc
**GL************************************************SLELWHACAGPLISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDLPPHPFCRVADVKLHAEAASDEVYAQVSLVPDEL***************************HMFCKTLTASDTSTHGGFSVPRRAAEDCF************ELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELRLGIRRAPHVKSGATFPS*CSQQSSPNSVTEVVDAIARKRAFSISYNPRASASEFIIPVNKFLKSLDHSFAVGMRFKMRFETDDAAERRYTGVIMGVGDVDPVRWPGSKWRCLLVRWDDVESNRHTRVSPWEIEPSGSVCGSNNLITSGLK******************************************************************************************************************************************************************************************************************************************************************************LFGFSL*************************************************TNVSNHCAVRDMLFDIAL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGLIDLNTTEDDENPSSGSLSPSSSSASALSASGFALAPAPASASASASGVSLELWHACAGPLISLPKRGSVVVYFPQGHLEHVSDFSAAASAAYDLPPHPFCRVADVKLHAEAASDEVYAQVSLVPDELIEQKVREGKIEDGDEDSVEVVAKSSTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQQRPSQELVAKDLHGLEWRFRHIYRGQPRRHLLTTGWSAFVNKKKLVSGDAVLFLRGEDGELRLGIRRAPHVKSGATFPSFCSQQSSPNSVTEVVDAIARKRAFSISYNPRASASEFIIPVNKFLKSLDHSFAVGMRFKMRFETDDAAERRYTGVIMGVGDVDPVRWPGSKWRCLLVRWDDVESNRHTRVSPWEIEPSGSVCGSNNLITSGLKRTRIGLPSGKPEFPVPDGIGVTDFGESLRFQKVLQGQEILGFNTLYDGGDCQNLHPSEVRRGILGSNGSGIAAIGDGSRNLQVKSDISYKGIGIGFGESFRFHKVLQGQEIFPKSPYGRAPTNNEARGIGSLGISDGVLVSGSRNRWSAVVPGYNTHTSPSAPPVQVSSPSSVLMFQLASNPISNYNPPYSLNDQEKEQRVNCQSFFHNSEIYGGKHASSSFLDHSFRGGDQEVMDSIGQSNEHISPPLVGQPTVRGSQDLVSSCKGSCRLFGFSLTEERHVANIEDNAAPVASPLNPRSSFLSHVGQQFHPKPPVMSKATGSNCTNVSNHCAVRDMLFDIAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Auxin response factor 3 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Involved in the establishment or elaboration of tissue patterning during gynoecial development.probableO23661
Auxin response factor 2 Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).probableQ0JKI9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:confident
Coverage over the Query: 158-269
View the alignment between query and template
View the model in PyMOL