Citrus Sinensis ID: 004502


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------75
MDISQQEFQERKREFYDFLELSIYQDEIKAMINHKRCRLIVNISDLYAFREDLPPRLLKNPVEYLQPFCDAATDWARNIDPKYLKEGEHILVGFEGPFVSRCVTPRDLLSQFIGSMVCVEGIVTKCSLVRPKVVKSVHYCPTTGSFLTREYRDITSNTGVPTGSVYPTRDEHGNLLVTEYGLCKYKDHQTLSVQEVPEKSAPGQLPRTVDVIVEDDLVDSCKPGDRVAIVGTYKALPGKSKGSVNGVFRTVLIANNVSLLNKEANAPIYTPEDLKSIKKIAERDDTFDLLGNSLAPSIYGHSWIKKAVILLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAIMNIAPLAISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEVMEQQTVTIAKAGIHASLNARCSVVAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIVLDQMDPDIDRRISDHVLRMHRYRSVMDGGEGGLDGSSRYGREDEVDTDASVFVKYNRMLHGKRTQRGQKRDTLTIQFLKKYIHYAKHRIQPELTDEASEQIATTYAELRNSSSNAKTGGTLPITARTLETIIRLSTAHAKMKLNRKISKSDVEAALKALNFAIYHKELTEMEEREQERQREQEKNPRAEHPGGNDRADHSTNDNERMEAFNSVFGQHMRANRLDLITITELEEIVNTGMDAHYSRAEITFLLEKLQDENRVMIADGIVHMIS
ccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEEcHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHHccccccccccEEEEEECccccccccccccccccccccEEEEEEEEEEcccccccEEEEEEEccccccEEEEEEEcccccccccccccccccccccccEEEEccccEEECcEEEEEEcccccccccccccCEEEEECcccccccccccEEEEEEEEEccccccccccccEEEEEEEEEEEEEcccccccccccHHHHHHHHHHHccccHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccccEEEEccccHHHHHHHHHHHHHcccEEECcccccccccccEEEECccccccEEEcccEEEEccccEEccccccccccccHHHHHHHHccccEEEEEccHHHcccHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHHcccEEEEccEEEEcc
****QQEFQERKREFYDFLELSIYQDEIKAMINHKRCRLIVNISDLYAFREDLPPRLLKNPVEYLQPFCDAATDWARNIDPKYLKEGEHILVGFEGPFVSRCVTPRDLLSQFIGSMVCVEGIVTKCSLVRPKVVKSVHYCPTTGSFLTREYRDITSNTGVPTGSVYPTRDEHGNLLVTEYGLCKYKDHQTLSVQEVPEKSAPGQLPRTVDVIVEDDLVDSCKPGDRVAIVGTYKALPGKSKGSVNGVFRTVLIANNVSLLNKEANAPIYTPEDLKSIKKIAERDDTFDLLGNSLAPSIYGHSWIKKAVILLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAIMNIAPLAISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEVMEQQTVTIAKAGIHASLNARCSVVAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIVLDQMDPDIDRRISDHVLRMHRYR**************************SVFVKY*************KRDTLTIQFLKKYIHYAKHRIQPELTDEASEQIATTYA*************TLPITARTLETIIRLSTAHAKMKLNRKISKSDVEAALKALNFAIYHK********************************************NSVFGQHMRANRLDLITITELEEIVNTGMDAHYSRAEITFLLEKLQDENRVMIADGIVHMIS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDISQQEFQERKREFYDFLELSIYQDEIKAMINHKRCRLIVNISDLYAFREDLPPRLLKNPVEYLQPFCDAATDWARNIDPKYLKEGEHILVGFEGPFVSRCVTPRDLLSQFIGSMVCVEGIVTKCSLVRPKVVKSVHYCPTTGSFLTREYRDITSNTGVPTGSVYPTRDEHGNLLVTEYGLCKYKDHQTLSVQEVPEKSAPGQLPRTVDVIVEDDLVDSCKPGDRVAIVGTYKALPGKSKGSVNGVFRTVLIANNVSLLNKEANAPIYTPEDLKSIKKIAERDDTFDLLGNSLAPSIYGHSWIKKAVILLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAIMNIAPLAISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEVMEQQTVTIAKAGIHASLNARCSVVAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIVLDQMDPDIDRRISDHVLRMHRYRSVMDGGEGGLDGSSRYGREDEVDTDASVFVKYNRMLHGKRTQRGQKRDTLTIQFLKKYIHYAKHRIQPELTDEASEQIATTYAELRNSSSNAKTGGTLPITARTLETIIRLSTAHAKMKLNRKISKSDVEAALKALNFAIxxxxxxxxxxxxxxxxxxxxxxPRAEHPGGNDRADHSTNDNERMEAFNSVFGQHMRANRLDLITITELEEIVNTGMDAHYSRAEITFLLEKLQDENRVMIADGIVHMIS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication licensing factor MCM3 homolog Acts as a factor that allows the DNA to undergo a single round of replication per cell cycle. Required for DNA replication and cell proliferation. May act as a component of the MCM complex which is the putative replicative helicase of the replication licensing system in eukaryotic cells.confidentQ9FL33
DNA replication licensing factor MCM3 homolog 3 Acts as a factor that allows the DNA to undergo a single round of replication per cell cycle. Required for DNA replication and cell proliferation (By similarity). May act as a component of the MCM complex which is the putative replicative helicase of the replication licensing system in eukaryotic cells.probableQ9SX03
DNA replication licensing factor MCM3 homolog 2 Acts as a factor that allows the DNA to undergo a single round of replication per cell cycle. Required for DNA replication and cell proliferation (By similarity). May act as a component of the MCM complex which is the putative replicative helicase of the replication licensing system in eukaryotic cells.probableQ9SX04

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:very confident
Coverage over the Query: 10-502,547-639
View the alignment between query and template
View the model in PyMOL