Citrus Sinensis ID: 004522

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------

MASKASPSASPNRSEPLKSSSLTKTENGTLTRKEILSVIDCLKNQVAADHFVSVQRRVEKNRQKLIGVTNHLYRLSLERRNNQTINTHGSVDLLTKRQREALGVQNGIDVSSGDRDSHISQEDGYASTAVYGSSNPTKNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKSERNATACSPLNGDIKEKFISSSDGAGAQTSSRKKFSGPARRVKSHQSESASSNAKNLSESSDSEVGQRQDTAFTHHSSPSKSKLVGKVGICKRKSKRVAERALVCKQKKQKKMAAFDLDSVASGGVLPSDMKLRSTSRKENEDANSSSHKHAKSSSSGKTRKKEMQIQDSRNLMHVRVPLGSSQEIVSNPPAISTNDSLRKDEFVAENMCKQELSDEKSWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCSENKLFCQAGDAATSLLEGYSKFDFNGTTGNNEVRRRSRYLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWIR

ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccCCcccccccccccEEEcccccccccccccccccccccccccccEEEccccccccccHHHHHccccccccHHHHHHcccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHcccccccccccHHccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

******************************TRKEILSVIDCLKNQVAADHFVSVQRRVEKNRQKLIGVTNHLYRLSLERRNNQ******SVDLL******************************************TKNIIRPIKLNDNKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVGLSDATLESLAQCFS********************************NNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQPLWYHLDEGNVPCGPHCYRSVLKS**************************************************************************************************************************************************************************************************************************SWKTIEKGLFDKGVEIFGRNSCLIARNLLNGLKTCWEVFQYMTCSEN***********************************************KYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWI*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone-lysine N-methyltransferase CLF	Polycomb group (PcG) protein. Catalytic subunit of some PcG multiprotein complex, which methylates 'Lys-27' of histone H3, leading to transcriptional repression of the affected target genes. Required to regulate floral development by repressing the AGAMOUS homeotic gene in leaves, influorescence stems and flowers. Regulates the antero-posterior organization of the endosperm, as well as the division and elongation rates of leaf cells. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development.	probable	P93831

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.1.-.-	Transferring one-carbon groups.	probable
2.1.1.-	15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).	probable
2.1.1.43	Histone-lysine N-methyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BO5, chain A
Confidence level:probable
Coverage over the Query: 705-744
View the alignment between query and template
View the model in PyMOL