Citrus Sinensis ID: 004568


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740----
MGDFAGSSFDSELLTEKGSGIYGIVGAAIVALLIPVLLSMMVARKKKVKQRGVPVEVGGEPGYAIRNAQIPELVEVPWKGASTMAALFEQSCKSHPQDRFLGKRKLLGKDFVTASDGRKFEKLHLGDYEWQTYGEVFDRACSFASGLVNFGHNVDTRAAILAETCVEWFIAFQGCFRQSITVVTIYSSLGEDALIHSLNETQVTTLICDSKQLKKLSAVSSSLKTIKNVIYFENDGSEKDSGVSGGISNWTVSSFSEVEKLGKRSPVDPSLPSQNGVAVIMYTSGSTGLPKGVMITHGNIVATAAAIKTLIPNPGRSDVYLAYLPLAHVLELAAESIMLCAGCAIGYGSTLTMTDTSSKIKKGTKGDVSVLKPTLMAAVPAIFDRVREGVVKKVEEKGGLTKNLFNIGYKRRLAAVEGSWFGAWGLERMLWDAIVFKSVRAVLGGRIRFMICGGAPLSADSQRFINICMGAPIGQAYGLTETCAGSTFSEWDDPSVGRVGPPVPCCYIKLVSWDEGGYKTSDKPMPRGEIVVGGFNVTAGYFNNPGKTSEVYKVDERGMCWFYTGDIGQVYPDGCLEIIDRKKDIVKLQHGEYISLGKVEAALISSDYVDNIMIHADPFHNYCVALVVPSHKALEKWAHEASIKYEDLSELCNKAEAVNEVQQALSKASTLVSRTEFFLSRRYKTTLCLQVAKAAKLDKFEIPAKIKLMPEPWTPEAGLVTAALKIKREQLKAKFKDDLQMLYQ
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccccccccccccccccccccccHHHHHHHHHHHccccccCEEECcccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHcccccEEEEccccHHHHHHHccccccccEEEEEccccccccccccccccccEEEEHHHHHHHcccccccccccccccEEEEEEccccccccccEEEccHHHHHHHHHHHHHccccccccEEEEEccHHHHHHHHHHHHHHHHccEEECcccccccccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHcccccEECcccHcccccccccccccccccccccccccCEEEEEEccccccccccccccccEEEEccccccccccccccccHHHHcccccccccEEcccCEEEcccccEEEEEccccHHHcccccccccHHHHHHHHccccccEEEEECcccccEEEEEEEccHHHHHHHHHHcccccccHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHccccccccCEEEEECccccccccccccccccccHHHHHHHHHHHHHHHcc
***********ELLTEKGSGIYGIVGAAIVALLIPVLLSMMVARK********PVEVGGEPGYAIRNAQIPELVEVPWKGASTMAALFEQSCKSHPQDRFLGKRKLLGKDFVTASDGRKFEKLHLGDYEWQTYGEVFDRACSFASGLVNFGHNVDTRAAILAETCVEWFIAFQGCFRQSITVVTIYSSLGEDALIHSLNETQVTTLICDSKQLKKLSAVSSSLKTIKNVIYFENDGSEKDSGVSGGISNWTVSSFSEVEKLG*********PSQNGVAVIMYTSGSTGLPKGVMITHGNIVATAAAIKTLIPNPGRSDVYLAYLPLAHVLELAAESIMLCAGCAIGYGSTLTMTDTSSKIKKGTKGDVSVLKPTLMAAVPAIFDRVREGVVKKVEEKGGLTKNLFNIGYKRRLAAVEGSWFGAWGLERMLWDAIVFKSVRAVLGGRIRFMICGGAPLSADSQRFINICMGAPIGQAYGLTETCAGSTFSEWDDPSVGRVGPPVPCCYIKLVSWDEGGYKTSDKPMPRGEIVVGGFNVTAGYFNNPGKTSEVYKVDERGMCWFYTGDIGQVYPDGCLEIIDRKKDIVKLQHGEYISLGKVEAALISSDYVDNIMIHADPFHNYCVALVVPSHKALEKWAHEASIKYEDLSELCNKAEAVNEVQQALSKASTLVSRTEFFLSRRYKTTLCLQVAKAAKLDKFEIPAKIKLMPEPWTPEAGLVTAALKIKREQLKAKFKDDLQMLYQ
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGDFAGSSFDSELLTEKGSGIYGIVGAAIVALLIPVLLSMMVARKKKVKQRGVPVEVGGEPGYAIRNAQIPELVEVPWKGASTMAALFEQSCKSHPQDRFLGKRKLLGKDFVTASDGRKFEKLHLGDYEWQTYGEVFDRACSFASGLVNFGHNVDTRAAILAETCVEWFIAFQGCFRQSITVVTIYSSLGEDALIHSLNETQVTTLICDSKQLKKLSAVSSSLKTIKNVIYFENDGSEKDSGVSGGISNWTVSSFSEVEKLGKRSPVDPSLPSQNGVAVIMYTSGSTGLPKGVMITHGNIVATAAAIKTLIPNPGRSDVYLAYLPLAHVLELAAESIMLCAGCAIGYGSTLTMTDTSSKIKKGTKGDVSVLKPTLMAAVPAIFDRVREGVVKKVEEKGGLTKNLFNIGYKRRLAAVEGSWFGAWGLERMLWDAIVFKSVRAVLGGRIRFMICGGAPLSADSQRFINICMGAPIGQAYGLTETCAGSTFSEWDDPSVGRVGPPVPCCYIKLVSWDEGGYKTSDKPMPRGEIVVGGFNVTAGYFNNPGKTSEVYKVDERGMCWFYTGDIGQVYPDGCLEIIDRKKDIVKLQHGEYISLGKVEAALISSDYVDNIMIHADPFHNYCVALVVPSHKALEKWAHEASIKYEDLSELCNKAEAVNEVQQALSKASTLVSRTEFFLSRRYKTTLCLQVAKAAKLDKFEIPAKIKLMPEPWTPEAGLVTAALKIKREQLKAKFKDDLQMLYQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Long chain acyl-CoA synthetase 8 Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitate, palmitoleate, oleate and linoleate.confidentQ9SJD4
Long-chain-fatty-acid--CoA ligase 3 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 has mainly an anabolic role in energy metabolism (By similarity). Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins) (By similarity). Mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates.probableQ5R668
Long-chain-fatty-acid--CoA ligase 3 Acyl-CoA synthetases (ACSL) activates long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. ACSL3 has mainly an anabolic role in energy metabolism (By similarity). Required for the incorporation of fatty acids into phosphatidylcholine, the major phospholipid located on the surface of VLDL (very low density lipoproteins) (By similarity). Mediates hepatic lipogenesis (By similarity). Preferentially uses myristate, laurate, arachidonate and eicosapentaenoate as substrates.probableQ9CZW4

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.2.-.-Forming carbon-sulfur bonds.probable
6.2.1.-Acid--thiol ligases.probable
6.2.1.3Long-chain-fatty-acid--CoA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D1S, chain A
Confidence level:very confident
Coverage over the Query: 111-120,132-393,431-587
View the alignment between query and template
View the model in PyMOL
Template: 3NYQ, chain A
Confidence level:very confident
Coverage over the Query: 123-209,236-386,413-429,448-603
View the alignment between query and template
View the model in PyMOL
Template: 3G7S, chain A
Confidence level:confident
Coverage over the Query: 83-119,132-235,252-384,399-416,448-582
View the alignment between query and template
View the model in PyMOL
Template: 3E7W, chain A
Confidence level:confident
Coverage over the Query: 265-383,403-405,426-553,564-642
View the alignment between query and template
View the model in PyMOL
Template: 3T5A, chain A
Confidence level:probable
Coverage over the Query: 82-242,268-329
View the alignment between query and template
View the model in PyMOL