Citrus Sinensis ID: 004587


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740---
METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
ccccccccccccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccc
*****************************KNIVSNILAAVDNLWHLKGGLYAAVLKDL*********************LALMDL***********************************VKELEECNCKLAALRAERDV********************************************QLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQL***KSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQ************************IIAEFRALV***************KYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLK***********V**************************************************AYLSEIETI*************LLQQITERDDYNIKLVLEGVRARQLQDALLMDKHM****IQQANASLNFFDMKAARIENQLRFCLD***********************************************RLTLMELQIELVKERFA**************************IIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDVTKGAFFPVLNLGNKHVAGDRxxxxxxxxxxxxxxxxxxxxxASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIExxxxxxxxxxxxxxxxxxxxxPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSDVRKSSVQVRGSLEESQSKVYKSRLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEGSSIxxxxxxxxxxxxxxxxxxxxxERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase BRE1-like 1 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6. Required for the regulation of flowering time and defense against necrotrophic fungal pathogens.probableQ8RXD6
E3 ubiquitin-protein ligase BRE1-like 1 E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6.probableQ7XU27

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 240-411
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 240-411
View the alignment between query and template
View the model in PyMOL
Template: 1Z6U, chain A
Confidence level:probable
Coverage over the Query: 630-738
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 51-569
View the alignment between query and template
View the model in PyMOL