Citrus Sinensis ID: 004587

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740---

METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

cccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccccc

cccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccccccccccEEEEEcccEccHHHHHHHHHHHHHHcccccccccccccEEEcc

metgatesssadncpnqmeedretgiprtkNIVSNILAAVDNLWHLKGGLYAAVLKDlqdggskqkasSNLQSEVKNLRLALMDLHLKHKSLTRELqsrqdidaKDKAKLNRLKGELESAVKELEECNCKLAALRAerdvtkgaffpvlnlgnkhvagdrvrdeqrDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFrrssavtdskIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEdrsqnsanLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCsiclerpkevvitkcyhlfcnpcvqkvtesrhrkcpgcaasfspndvkpvyi

metgatesssadncpnqmeedretgiprtKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSltrelqsrqdidakdkaKLNRLKGELESAVKELEECNCKLAALRAERDVTKgaffpvlnlgnkhvagdrvrdeqRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETElnmkidlvdvfrrssavtdskiadlgieiqkqideknriemrleeasrepgrkeIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHslkssldeqsLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAedrsqnsanlentqkrlsdvrkssvqvrgsleesqskvyksrlTLMELQIELVKERFAKKRLEEDLEMGRRKVlrlqaqtegssiIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRkcpgcaasfspndvkpvyi

METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMqtqnqqllqqITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSiieelqqelreyreilKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

*****************************KNIVSNILAAVDNLWHLKGGLYAAVLKDL*********************LALMDL***********************************VKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVA***************************QLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQL***KSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQ************************IIAEFRALV***************KYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLK***********V**************************************************AYLSEIETI*************LLQQITERDDYNIKLVLEGVRARQLQDALLMDKHM****IQQANASLNFFDMKAARIENQLRFCLD***********************************************RLTLMELQIELVKERFA**************************IIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRH*KC*****************

***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************ILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

************************GIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDL************LQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLEN************************KVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQK********CPGCAASFSPNDVKPVYI

************************GIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDV*************************RDLRDMESVHKELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxRDVTKGAFFPVLNLGNKHVAGDRxxxxxxxxxxxxxxxxxxxxxASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIExxxxxxxxxxxxxxxxxxxxxPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAARDLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFFDMKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSDVRKSSVQVRGSLEESQSKVYKSRLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTEGSSIxxxxxxxxxxxxxxxxxxxxxERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKPVYI

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		743	2.2.26 [Sep-21-2011]
Q8RXD6		878	E3 ubiquitin-protein liga	yes	no	1.0	0.846	0.586	0.0
Q7XU27		884	E3 ubiquitin-protein liga	yes	no	0.997	0.838	0.480	0.0
A2XW69		884	E3 ubiquitin-protein liga	N/A	no	0.997	0.838	0.480	0.0
Q9C895		900	E3 ubiquitin-protein liga	no	no	0.900	0.743	0.348	1e-105
Q336R3		844	E3 ubiquitin-protein liga	yes	no	0.904	0.796	0.353	1e-105
A2ZAC2		844	E3 ubiquitin-protein liga	N/A	no	0.904	0.796	0.353	1e-105
Q4R7K7		1001	E3 ubiquitin-protein liga	N/A	no	0.464	0.344	0.313	2e-35
Q8CJB9		1002	E3 ubiquitin-protein liga	yes	no	0.468	0.347	0.310	3e-35
Q3U319		1001	E3 ubiquitin-protein liga	yes	no	0.464	0.344	0.315	4e-35
O75150		1001	E3 ubiquitin-protein liga	no	no	0.464	0.344	0.313	7e-35

>sp\|Q8RXD6\|BRE1A_ARATH E3 ubiquitin-protein ligase BRE1-like 1 OS=Arabidopsis thaliana GN=HUB1 PE=1 SV=1	Back alignment and function desciption

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/744 (58%), Positives = 564/744 (75%), Gaps = 1/744 (0%)

Query: 1   METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLK-DLQ 59
           +ETGATESSS++ C NQMEE+      +    + N++AA ++L  LK  LY  VL+ +L 
Sbjct: 135 LETGATESSSSNICSNQMEENGVNTSSQMTQTLYNLVAATEDLRCLKDELYPTVLRTNLG 194

Query: 60  DGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELES 119
                Q A S L+SE+K+ R  L D+ +K KSL+RELQS +D DAK +  L R++GELE 
Sbjct: 195 KDLCGQLALSELESEIKSFRGDLDDVLVKFKSLSRELQSHRDADAKVRVDLKRIRGELED 254

Query: 120 AVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELM 179
            V EL++CN  L+ALRAERD T GAFFPVL+LGNK    DR RD+QRDL+DME+V KEL 
Sbjct: 255 EVVELQQCNGDLSALRAERDATAGAFFPVLSLGNKLATSDRERDKQRDLQDMETVLKELT 314

Query: 180 DQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKY 239
             AS +L +LK LH+ R K+L ++ NLQN  KSV+C+SSS+A LS+K+QLEKSK  VF+Y
Sbjct: 315 VLASGRLQQLKNLHEERTKMLGKMSNLQNKSKSVRCISSSQACLSLKDQLEKSKEAVFQY 374

Query: 240 QALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIE 299
            AL EKLQVEKD++ W+E E+N+K +L DV R++SAVTDS++A L  EIQKQ+DEK RI+
Sbjct: 375 MALLEKLQVEKDSIVWKEREINIKNELGDVSRKTSAVTDSRMASLDSEIQKQLDEKMRIK 434

Query: 300 MRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNV 359
            RL   SRE GRKEI A+ +AL+SSFPE+MS+M+ QL+ YKE A  IH LRADV SL+ V
Sbjct: 435 TRLGNISRERGRKEIFADMKALISSFPEEMSSMRSQLNNYKETAGGIHSLRADVQSLSGV 494

Query: 360 LERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAAR 419
           L RK KE E L   SAD  +++  L A V DL +S+ ELKL LDMY+RESTD+RD+  A+
Sbjct: 495 LCRKTKEYEALQLRSADYASQLGDLNATVCDLKNSHEELKLFLDMYKRESTDARDIAEAK 554

Query: 420 DLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRD 479
           + EY+AWAHV SLKSSLDEQ+LELRVK A EAEA+SQQ LAAAEAEIAD+RQK++  KRD
Sbjct: 555 EQEYRAWAHVQSLKSSLDEQNLELRVKAANEAEAVSQQMLAAAEAEIADLRQKMDDCKRD 614

Query: 480 MVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRA 539
           +   SD LKSK+EE   YLSEI+TIG +Y+D+  QNQQLL Q+TERDDYNIKL LEG+ +
Sbjct: 615 VAKHSDILKSKHEEHGTYLSEIQTIGSAYEDIVPQNQQLLLQVTERDDYNIKLFLEGITS 674

Query: 540 RQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANL 599
           RQ+QD LL+DK++M+ +IQQ +A  +F   K++RIE+QLRFC DQ Q+LAED+ Q S +L
Sbjct: 675 RQMQDTLLIDKYIMDKDIQQGSAYASFLSKKSSRIEDQLRFCTDQFQKLAEDKYQKSVSL 734

Query: 600 ENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGR 659
           EN QK+ +D+     Q R  LEES SKV +SRL    L++EL  ERF ++R+EE++E+ +
Sbjct: 735 ENLQKKRADIGNGLEQARSRLEESHSKVEQSRLDYGALELELEIERFNRRRIEEEMEIAK 794

Query: 660 RKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVT 719
           +KV RL++  EGSS I++L+QEL E++EILKC  C +RPKEVVITKCYHLFCNPCVQK+T
Sbjct: 795 KKVSRLRSLIEGSSAIQKLRQELSEFKEILKCKACNDRPKEVVITKCYHLFCNPCVQKLT 854

Query: 720 ESRHRKCPGCAASFSPNDVKPVYI 743
            +R +KCP C+ASF PND+KP+YI
Sbjct: 855 GTRQKKCPTCSASFGPNDIKPIYI 878

E3 ubiquitin-protein ligase that monoubiquitinates H2B to form H2BK143ub1. H2BK143ub1 gives a specific tag for epigenetic transcriptional activation and is also prerequisite for H3K4me and maybe H3K79me. It thereby plays a central role in histone code and gene regulation. Forms a ubiquitin ligase complex in cooperation with the E2 enzyme UBC2/RAD6. Required for the regulation of flowering time and defense against necrotrophic fungal pathogens.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q7XU27\|BRE1A_ORYSJ E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. japonica GN=BRE1A PE=2 SV=3	Back alignment and function description

>sp\|A2XW69\|BRE1A_ORYSI E3 ubiquitin-protein ligase BRE1-like 1 OS=Oryza sativa subsp. indica GN=BRE1A PE=3 SV=2	Back alignment and function description

>sp\|Q9C895\|BRE1B_ARATH E3 ubiquitin-protein ligase BRE1-like 2 OS=Arabidopsis thaliana GN=HUB2 PE=1 SV=2	Back alignment and function description

>sp\|Q336R3\|BRE1B_ORYSJ E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. japonica GN=BRE1B PE=2 SV=1	Back alignment and function description

>sp\|A2ZAC2\|BRE1B_ORYSI E3 ubiquitin-protein ligase BRE1-like 2 OS=Oryza sativa subsp. indica GN=BRE1B PE=3 SV=2	Back alignment and function description

>sp\|Q4R7K7\|BRE1B_MACFA E3 ubiquitin-protein ligase BRE1B OS=Macaca fascicularis GN=RNF40 PE=2 SV=1	Back alignment and function description

>sp\|Q8CJB9\|BRE1B_RAT E3 ubiquitin-protein ligase BRE1B OS=Rattus norvegicus GN=Rnf40 PE=1 SV=1	Back alignment and function description

>sp\|Q3U319\|BRE1B_MOUSE E3 ubiquitin-protein ligase BRE1B OS=Mus musculus GN=Rnf40 PE=2 SV=2	Back alignment and function description

>sp\|O75150\|BRE1B_HUMAN E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens GN=RNF40 PE=1 SV=4	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		743
297734578		878	unnamed protein product [Vitis vinifera]	1.0	0.846	0.708	0.0
225453456		901	PREDICTED: E3 ubiquitin-protein ligase B	1.0	0.824	0.687	0.0
224067588		877	histone ubiquitination proteins group [P	1.0	0.847	0.685	0.0
224136330		884	histone ubiquitination proteins group [P	0.950	0.798	0.639	0.0
356539611		873	PREDICTED: E3 ubiquitin-protein ligase B	0.998	0.849	0.638	0.0
356498180		874	PREDICTED: E3 ubiquitin-protein ligase B	1.0	0.850	0.635	0.0
449431978		878	PREDICTED: E3 ubiquitin-protein ligase B	0.998	0.845	0.616	0.0
357504631		947	E3 ubiquitin-protein ligase BRE1-like pr	1.0	0.784	0.562	0.0
297828217		878	histone mono-ubiquitination 1 [Arabidops	1.0	0.846	0.587	0.0
30689877		878	E3 ubiquitin-protein ligase BRE1-like 1	1.0	0.846	0.586	0.0

>gi\|297734578\|emb\|CBI16629.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/744 (70%), Positives = 627/744 (84%), Gaps = 1/744 (0%)

Query: 1   METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDL-Q 59
           +ETGATES SA++  ++MEEDR T   +TKN +SNI++ +++LW LK GLYAAVL+ L +
Sbjct: 135 IETGATESCSANDFSDRMEEDRPTSCGKTKNSLSNIVSTINDLWCLKDGLYAAVLEALPE 194

Query: 60  DGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELES 119
           DG   +K SS+L +EV N+RLA  DLHLKHKS+TR++QS +DIDAK+KA+L RL+GELES
Sbjct: 195 DGLCNKKISSDLHAEVNNMRLAFGDLHLKHKSVTRDMQSHRDIDAKNKAELKRLRGELES 254

Query: 120 AVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELM 179
            V ELEE NCKL  L+AERD  KGAFFP+L+LG+K+VAGD+ RD+Q+DL DME+  KEL+
Sbjct: 255 TVAELEESNCKLVTLKAERDAAKGAFFPILSLGSKNVAGDKARDKQKDLHDMEATLKELL 314

Query: 180 DQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKY 239
           DQ+S +LLELK L++ RI +L+QL NLQNTLK+VKC+SSS A++ V +QLEKSK+EV  Y
Sbjct: 315 DQSSSRLLELKALYEERIGILKQLSNLQNTLKNVKCISSSSAYVLVTDQLEKSKAEVVHY 374

Query: 240 QALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIE 299
           QALFEKLQVEKDNL WRE E+NMK D VDVFRRSS VTDS++++L IEIQ QI+E+N IE
Sbjct: 375 QALFEKLQVEKDNLVWREKEVNMKNDFVDVFRRSSVVTDSRLSELRIEIQNQINERNLIE 434

Query: 300 MRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNV 359
           ++LEEASREPGRKEIIAEF+AL+SSFP++M  MQ QL KYKEAA D+H LRADV SL++V
Sbjct: 435 IKLEEASREPGRKEIIAEFKALLSSFPDNMGTMQNQLRKYKEAASDVHSLRADVQSLSSV 494

Query: 360 LERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAAR 419
           LERK KE ETL   SADQVA+I KLQA++QDL +S+++LKLIL+MYR ES DSRDVL AR
Sbjct: 495 LERKEKELETLSTRSADQVADIRKLQALIQDLEESDIQLKLILEMYRCESVDSRDVLEAR 554

Query: 420 DLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRD 479
           D EYKAWAHV SLKSSL+E SLELRVKTAIEAEA+SQQRLAAAEA I D+RQKLEA KRD
Sbjct: 555 DKEYKAWAHVQSLKSSLNEHSLELRVKTAIEAEALSQQRLAAAEAVIVDLRQKLEASKRD 614

Query: 480 MVSLSDALKSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRA 539
           M  LSD LKSK+EE EAYLSEIETIGQ+YDDMQTQNQ LLQQITERDDYNIKLVLEGVR+
Sbjct: 615 MFRLSDVLKSKHEENEAYLSEIETIGQAYDDMQTQNQHLLQQITERDDYNIKLVLEGVRS 674

Query: 540 RQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANL 599
           RQLQD+LLM+K  ME   Q+A  SL FFDMKA RIE+QL+ C DQ Q+LAEDR Q+   L
Sbjct: 675 RQLQDSLLMEKQTMERGFQRATTSLGFFDMKAGRIEDQLKMCSDQVQKLAEDRLQSLGTL 734

Query: 600 ENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGR 659
            N QKRL DV + S Q R SLEESQSKV KSR++L ELQIEL KERF KKR EE+LE+ R
Sbjct: 735 ANFQKRLLDVTRLSQQARESLEESQSKVDKSRVSLGELQIELEKERFEKKRTEEELEVVR 794

Query: 660 RKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVT 719
           RK  RL+AQTEGSSI+++L+QELREYR+ILKC IC ERPKEVVITKCYHLFCNPCVQ++ 
Sbjct: 795 RKASRLRAQTEGSSIVDKLRQELREYRDILKCGICHERPKEVVITKCYHLFCNPCVQRII 854

Query: 720 ESRHRKCPGCAASFSPNDVKPVYI 743
           E+R+RKCP C+ASF PNDVKPVYI
Sbjct: 855 EARNRKCPVCSASFGPNDVKPVYI 878

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|225453456\|ref\|XP_002274055.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224067588\|ref\|XP_002302510.1\| histone ubiquitination proteins group [Populus trichocarpa] gi\|222844236\|gb\|EEE81783.1\| histone ubiquitination proteins group [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|224136330\|ref\|XP_002326834.1\| histone ubiquitination proteins group [Populus trichocarpa] gi\|222835149\|gb\|EEE73584.1\| histone ubiquitination proteins group [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356539611\|ref\|XP_003538290.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|356498180\|ref\|XP_003517931.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Glycine max]	Back alignment and taxonomy information

>gi\|449431978\|ref\|XP_004133777.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Cucumis sativus] gi\|449478010\|ref\|XP_004155194.1\| PREDICTED: E3 ubiquitin-protein ligase BRE1-like 1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|357504631\|ref\|XP_003622604.1\| E3 ubiquitin-protein ligase BRE1-like protein [Medicago truncatula] gi\|355497619\|gb\|AES78822.1\| E3 ubiquitin-protein ligase BRE1-like protein [Medicago truncatula]	Back alignment and taxonomy information

>gi\|297828217\|ref\|XP_002881991.1\| histone mono-ubiquitination 1 [Arabidopsis lyrata subsp. lyrata] gi\|297327830\|gb\|EFH58250.1\| histone mono-ubiquitination 1 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi|30689877|ref|NP_182022.2| E3 ubiquitin-protein ligase BRE1-like 1 [Arabidopsis thaliana] gi|75303266|sp|Q8RXD6.1|BRE1A_ARATH RecName: Full=E3 ubiquitin-protein ligase BRE1-like 1; Short=AtBRE1; AltName: Full=Protein HISTONE MONOUBIQUITINATION 1; Short=AtHUB1 gi|19698951|gb|AAL91211.1| unknown protein [Arabidopsis thaliana] gi|34098841|gb|AAQ56803.1| At2g44950 [Arabidopsis thaliana] gi|330255395|gb|AEC10489.1| E3 ubiquitin-protein ligase BRE1-like 1 [Arabidopsis thaliana]

Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		743
TAIR\|locus:2054997		878	HUB1 "histone mono-ubiquitinat	1.0	0.846	0.564	1e-210
TAIR\|locus:2035726		900	HUB2 "histone mono-ubiquitinat	0.987	0.815	0.319	4.9e-101
UNIPROTKB\|Q4R7K7		1001	RNF40 "E3 ubiquitin-protein li	0.500	0.371	0.269	1.8e-31
UNIPROTKB\|H3BP71		961	RNF40 "E3 ubiquitin-protein li	0.500	0.387	0.269	1.9e-31
UNIPROTKB\|O75150		1001	RNF40 "E3 ubiquitin-protein li	0.500	0.371	0.269	2.3e-31
MGI\|MGI:2142048		1001	Rnf40 "ring finger protein 40"	0.471	0.349	0.280	3e-31
UNIPROTKB\|Q5RAU7		1001	RNF40 "E3 ubiquitin-protein li	0.500	0.371	0.269	3.8e-31
UNIPROTKB\|F1RG77		1000	RNF40 "Uncharacterized protein	0.497	0.37	0.284	5e-31
UNIPROTKB\|F8W8Z4		693	RNF40 "E3 ubiquitin-protein li	0.500	0.536	0.269	6.9e-31
UNIPROTKB\|F1N9A6		984	RNF20 "E3 ubiquitin-protein li	0.820	0.619	0.243	2.3e-29

TAIR\|locus:2054997 HUB1 "histone mono-ubiquitination 1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 2037 (722.1 bits), Expect = 1.0e-210, P = 1.0e-210
 Identities = 420/744 (56%), Positives = 543/744 (72%)

Query:     1 METGATESSSADNCPNQMEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLK-DLQ 59
             +ETGATESSS++ C NQMEE+      +    + N++AA ++L  LK  LY  VL+ +L 
Sbjct:   135 LETGATESSSSNICSNQMEENGVNTSSQMTQTLYNLVAATEDLRCLKDELYPTVLRTNLG 194

Query:    60 DGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQSRQDIDAKDKAKLNRLKGELES 119
                  Q A S L+SE+K+ R  L D+ +K KSL+RELQS +D DAK +  L R++GELE 
Sbjct:   195 KDLCGQLALSELESEIKSFRGDLDDVLVKFKSLSRELQSHRDADAKVRVDLKRIRGELED 254

Query:   120 AVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHVAGDRVRDEQRDLRDMESVHKELM 179
              V EL++CN  L+ALRAERD T GAFFPVL+LGNK    DR RD+QRDL+DME+V KEL 
Sbjct:   255 EVVELQQCNGDLSALRAERDATAGAFFPVLSLGNKLATSDRERDKQRDLQDMETVLKELT 314

Query:   180 DQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSVKCLSSSKAFLSVKNQLEKSKSEVFKY 239
               AS +L +LK LH+ R K+L ++ NLQN  KSV+C+SSS+A LS+K+QLEKSK  VF+Y
Sbjct:   315 VLASGRLQQLKNLHEERTKMLGKMSNLQNKSKSVRCISSSQACLSLKDQLEKSKEAVFQY 374

Query:   240 QALFEKLQVEKDNLAWRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIE 299
              AL EKLQVEKD++ W+E E+N+K +L DV R++SAVTDS++A L  EIQKQ+DEK RI+
Sbjct:   375 MALLEKLQVEKDSIVWKEREINIKNELGDVSRKTSAVTDSRMASLDSEIQKQLDEKMRIK 434

Query:   300 MRLEEASREPGRKEIIAEFRALVSSFPEDMSAMQRQLSKYKEAALDIHILRADVLSLTNV 359
              RL   SRE GRKEI A+ +AL+SSFPE+MS+M+ QL+ YKE A  IH LRADV SL+ V
Sbjct:   435 TRLGNISRERGRKEIFADMKALISSFPEEMSSMRSQLNNYKETAGGIHSLRADVQSLSGV 494

Query:   360 LERKVKECETLLASSADQVAEIHKLQAMVQDLTDSNLELKLILDMYRRESTDSRDVLAAR 419
             L RK KE E L   SAD  +++  L A V DL +S+ ELKL LDMY+RESTD+RD+  A+
Sbjct:   495 LCRKTKEYEALQLRSADYASQLGDLNATVCDLKNSHEELKLFLDMYKRESTDARDIAEAK 554

Query:   420 DLEYKAWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMRQKLEAFKRD 479
             + EY+AWAHV SLKSSLDEQ+LELRVK A EAEA+SQQ LAAAEAEIAD+RQK++  KRD
Sbjct:   555 EQEYRAWAHVQSLKSSLDEQNLELRVKAANEAEAVSQQMLAAAEAEIADLRQKMDDCKRD 614

Query:   480 MVSLSDALKSKNEEIEAYLSEIETIGQSYDDMXXXXXXXXXXITERDDYNIKLVLEGVRA 539
             +   SD LKSK+EE   YLSEI+TIG +Y+D+          +TERDDYNIKL LEG+ +
Sbjct:   615 VAKHSDILKSKHEEHGTYLSEIQTIGSAYEDIVPQNQQLLLQVTERDDYNIKLFLEGITS 674

Query:   540 RQLQDALLMDKHMMESEIQQANASLNFFDMKAARIENQLRFCLDQAQRLAEDRSQNSANL 599
             RQ+QD LL+DK++M+ +IQQ +A  +F   K++RIE+QLRFC DQ Q+LAED+ Q S +L
Sbjct:   675 RQMQDTLLIDKYIMDKDIQQGSAYASFLSKKSSRIEDQLRFCTDQFQKLAEDKYQKSVSL 734

Query:   600 ENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFAKKRLEEDLEMGR 659
             EN QK+ +D+     Q R  LEES SKV +SRL    L++EL  ERF ++R+EE++E+ +
Sbjct:   735 ENLQKKRADIGNGLEQARSRLEESHSKVEQSRLDYGALELELEIERFNRRRIEEEMEIAK 794

Query:   660 RKVLRLQAQTEGSSXXXXXXXXXXXXXXXXKCSICLERPKEVVITKCYHLFCNPCVQKVT 719
             +KV RL++  EGSS                KC  C +RPKEVVITKCYHLFCNPCVQK+T
Sbjct:   795 KKVSRLRSLIEGSSAIQKLRQELSEFKEILKCKACNDRPKEVVITKCYHLFCNPCVQKLT 854

Query:   720 ESRHRKCPGCAASFSPNDVKPVYI 743
              +R +KCP C+ASF PND+KP+YI
Sbjct:   855 GTRQKKCPTCSASFGPNDIKPIYI 878

GO:0005634 "nucleus" evidence=ISM;IDA

GO:0008270 "zinc ion binding" evidence=IEA;ISS

GO:0010162 "seed dormancy process" evidence=RCA;IMP

GO:0005739 "mitochondrion" evidence=IDA

GO:0010390 "histone monoubiquitination" evidence=IMP

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0006513 "protein monoubiquitination" evidence=IDA

GO:0009965 "leaf morphogenesis" evidence=IMP

GO:0010389 "regulation of G2/M transition of mitotic cell cycle" evidence=IMP

GO:0016049 "cell growth" evidence=RCA;IMP

GO:0048505 "regulation of timing of cell differentiation" evidence=IMP

GO:0051301 "cell division" evidence=RCA;IMP

GO:0010228 "vegetative to reproductive phase transition of meristem" evidence=RCA;IMP

GO:0033523 "histone H2B ubiquitination" evidence=IMP

GO:0042803 "protein homodimerization activity" evidence=IPI

GO:0005515 "protein binding" evidence=IPI

GO:0009817 "defense response to fungus, incompatible interaction" evidence=IMP

GO:0000278 "mitotic cell cycle" evidence=RCA

GO:0000956 "nuclear-transcribed mRNA catabolic process" evidence=RCA

GO:0003002 "regionalization" evidence=RCA

GO:0006396 "RNA processing" evidence=RCA

GO:0006406 "mRNA export from nucleus" evidence=RCA

GO:0007062 "sister chromatid cohesion" evidence=RCA

GO:0007155 "cell adhesion" evidence=RCA

GO:0007346 "regulation of mitotic cell cycle" evidence=RCA

GO:0009640 "photomorphogenesis" evidence=RCA

GO:0009793 "embryo development ending in seed dormancy" evidence=RCA

GO:0009845 "seed germination" evidence=RCA

GO:0009880 "embryonic pattern specification" evidence=RCA

GO:0009909 "regulation of flower development" evidence=RCA

GO:0009933 "meristem structural organization" evidence=RCA

GO:0010014 "meristem initiation" evidence=RCA

GO:0010072 "primary shoot apical meristem specification" evidence=RCA

GO:0010074 "maintenance of meristem identity" evidence=RCA

GO:0010090 "trichome morphogenesis" evidence=RCA

GO:0010182 "sugar mediated signaling pathway" evidence=RCA

GO:0010388 "cullin deneddylation" evidence=RCA

GO:0010413 "glucuronoxylan metabolic process" evidence=RCA

GO:0010431 "seed maturation" evidence=RCA

GO:0010564 "regulation of cell cycle process" evidence=RCA

GO:0016567 "protein ubiquitination" evidence=RCA

GO:0016571 "histone methylation" evidence=RCA

GO:0016579 "protein deubiquitination" evidence=RCA

GO:0016926 "protein desumoylation" evidence=RCA

GO:0019915 "lipid storage" evidence=RCA

GO:0033043 "regulation of organelle organization" evidence=RCA

GO:0045010 "actin nucleation" evidence=RCA

GO:0045492 "xylan biosynthetic process" evidence=RCA

GO:0045595 "regulation of cell differentiation" evidence=RCA

GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=RCA

GO:0048366 "leaf development" evidence=RCA

GO:0048449 "floral organ formation" evidence=RCA

GO:0048589 "developmental growth" evidence=RCA

GO:0048825 "cotyledon development" evidence=RCA

GO:0050665 "hydrogen peroxide biosynthetic process" evidence=RCA

GO:0050826 "response to freezing" evidence=RCA

TAIR\|locus:2035726 HUB2 "histone mono-ubiquitination 2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|Q4R7K7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Macaca fascicularis (taxid:9541)]	Back alignment and assigned GO terms

UNIPROTKB\|H3BP71 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|O75150 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:2142048 Rnf40 "ring finger protein 40" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5RAU7 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Pongo abelii (taxid:9601)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RG77 RNF40 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F8W8Z4 RNF40 "E3 ubiquitin-protein ligase BRE1B" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9A6 RNF20 "E3 ubiquitin-protein ligase BRE1A" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q8RXD6	BRE1A_ARATH	6, ., 3, ., 2, ., -	0.5860	1.0	0.8462	yes	no
Q7XU27	BRE1A_ORYSJ	6, ., 3, ., 2, ., -	0.4805	0.9973	0.8382	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		743
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	9e-13
smart00184		40	smart00184, RING, Ring finger	2e-12
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	2e-11
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	6e-11
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	5e-10
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	6e-08
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-07
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	2e-07
PLN03208		193	PLN03208, PLN03208, E3 ubiquitin-protein ligase RM	8e-07
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	1e-06
COG5574		271	COG5574, PEX10, RING-finger-containing E3 ubiquiti	2e-06
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	4e-06
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	1e-05
COG1196		1163	COG1196, Smc, Chromosome segregation ATPases [Cell	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	2e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	4e-05
TIGR02168		1179	TIGR02168, SMC_prok_B, chromosome segregation prot	7e-05
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	3e-04
COG0419		908	COG0419, SbcC, ATPase involved in DNA repair [DNA	0.002
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.003
TIGR00599		397	TIGR00599, rad18, DNA repair protein rad18	0.003
TIGR02169		1164	TIGR02169, SMC_prok_A, chromosome segregation prot	0.004
TIGR04211		198	TIGR04211, SH3_and_anchor, SH3 domain protein	0.004

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

 Score = 62.5 bits (152), Expect = 9e-13
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 691 CSICLERPKE-VVITKCYHLFCNPCVQKVTESRHRKCPGC 729
           C ICLE PK+ V I  C HLFC+ C+    ES +  CP C
Sbjct: 1   CPICLEEPKDPVTILPCGHLFCSKCILSWLESGNVTCPLC 40

The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid. Many proteins containing a RING finger play a key role in the ubiquitination pathway. Length = 40

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

>gnl\|CDD\|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|233043 TIGR00599, rad18, DNA repair protein rad18	Back alignment and domain information

>gnl\|CDD\|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>gnl\|CDD\|234501 TIGR04211, SH3_and_anchor, SH3 domain protein	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		743
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	100.0
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.88
KOG0161		1930	consensus Myosin class II heavy chain [Cytoskeleto	99.81
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.76
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.71
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	99.69
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.68
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.68
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	99.66
COG1196		1163	Smc Chromosome segregation ATPases [Cell division	99.65
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.64
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	99.64
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	99.63
PRK02224		880	chromosome segregation protein; Provisional	99.62
PF10174		775	Cast: RIM-binding protein of the cytomatrix active	99.58
KOG4674		1822	consensus Uncharacterized conserved coiled-coil pr	99.58
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.57
PRK03918		880	chromosome segregation protein; Provisional	99.55
PRK03918		880	chromosome segregation protein; Provisional	99.5
PF01576		859	Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu	99.49
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.43
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	99.43
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	99.38
KOG0933		1174	consensus Structural maintenance of chromosome pro	99.37
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	99.36
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	99.3
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	99.27
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	99.25
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	99.23
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	99.22
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	99.21
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	99.19
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	99.18
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	99.16
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	99.15
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	99.15
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	99.11
PRK01156		895	chromosome segregation protein; Provisional	99.09
PRK01156		895	chromosome segregation protein; Provisional	99.09
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	99.07
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	99.07
PF14634		44	zf-RING_5: zinc-RING finger domain	99.05
KOG0964		1200	consensus Structural maintenance of chromosome pro	99.03
KOG0996		1293	consensus Structural maintenance of chromosome pro	99.03
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	99.01
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	99.0
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.96
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.95
PHA02929		238	N1R/p28-like protein; Provisional	98.95
PHA02926		242	zinc finger-like protein; Provisional	98.94
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	98.91
PRK04863		1486	mukB cell division protein MukB; Provisional	98.86
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	98.86
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	98.85
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.83
KOG0964		1200	consensus Structural maintenance of chromosome pro	98.82
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	98.79
KOG0018		1141	consensus Structural maintenance of chromosome pro	98.78
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.75
PF00261		237	Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop	98.75
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.74
KOG0971		1243	consensus Microtubule-associated protein dynactin	98.71
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	98.69
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.66
KOG4643		1195	consensus Uncharacterized coiled-coil protein [Fun	98.64
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	98.6
PRK04863		1486	mukB cell division protein MukB; Provisional	98.59
KOG0976		1265	consensus Rho/Rac1-interacting serine/threonine ki	98.55
PF05701		522	WEMBL: Weak chloroplast movement under blue light;	98.53
PF12128		1201	DUF3584: Protein of unknown function (DUF3584); In	98.53
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	98.51
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	98.5
KOG0824		324	consensus Predicted E3 ubiquitin ligase [Posttrans	98.49
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.49
TIGR00570		309	cdk7 CDK-activating kinase assembly factor MAT1. A	98.48
PF07888		546	CALCOCO1: Calcium binding and coiled-coil domain (	98.42
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.42
KOG0977		546	consensus Nuclear envelope protein lamin, intermed	98.42
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.4
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	98.39
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.38
COG5152		259	Uncharacterized conserved protein, contains RING a	98.38
PF00038		312	Filament: Intermediate filament protein; InterPro:	98.37
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	98.35
KOG0962		1294	consensus DNA repair protein RAD50, ABC-type ATPas	98.35
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	98.34
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	98.31
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	98.3
PRK04778		569	septation ring formation regulator EzrA; Provision	98.29
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	98.28
KOG0994		1758	consensus Extracellular matrix glycoprotein Lamini	98.27
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	98.22
PRK04778		569	septation ring formation regulator EzrA; Provision	98.21
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	98.21
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	98.2
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	98.19
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.18
PF14662		193	CCDC155: Coiled-coil region of CCDC155	98.18
PF04641		260	Rtf2: Rtf2 RING-finger	98.17
COG1579		239	Zn-ribbon protein, possibly nucleic acid-binding [	98.16
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	98.14
PF06160		560	EzrA: Septation ring formation regulator, EzrA ; I	98.11
PF05557		722	MAD: Mitotic checkpoint protein; InterPro: IPR0086	98.1
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	98.1
KOG2660		331	consensus Locus-specific chromosome binding protei	98.06
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	98.06
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	98.05
KOG0250		1074	consensus DNA repair protein RAD18 (SMC family pro	98.04
PHA02562		562	46 endonuclease subunit; Provisional	98.03
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	98.02
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.99
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	97.99
COG5222		427	Uncharacterized conserved protein, contains RING Z	97.99
PRK11637		428	AmiB activator; Provisional	97.94
KOG3039		303	consensus Uncharacterized conserved protein [Funct	97.91
PHA02562		562	46 endonuclease subunit; Provisional	97.87
PF09730		717	BicD: Microtubule-associated protein Bicaudal-D; I	97.84
KOG0825		1134	consensus PHD Zn-finger protein [General function	97.79
COG5220		314	TFB3 Cdk activating kinase (CAK)/RNA polymerase II	97.78
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	97.77
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	97.76
KOG1002		791	consensus Nucleotide excision repair protein RAD16	97.73
COG4372		499	Uncharacterized protein conserved in bacteria with	97.72
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	97.71
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	97.68
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	97.67
PF05622		713	HOOK: HOOK protein; InterPro: IPR008636 This famil	97.65
KOG0297		391	consensus TNF receptor-associated factor [Signal t	97.62
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.59
PF09726		697	Macoilin: Transmembrane protein; InterPro: IPR0191	97.59
PF14662		193	CCDC155: Coiled-coil region of CCDC155	97.56
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.55
KOG2817		394	consensus Predicted E3 ubiquitin ligase [Posttrans	97.55
PF05483		786	SCP-1: Synaptonemal complex protein 1 (SCP-1); Int	97.54
KOG1003		205	consensus Actin filament-coating protein tropomyos	97.52
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	97.45
COG1340		294	Uncharacterized archaeal coiled-coil protein [Func	97.44
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	97.43
PF05667		594	DUF812: Protein of unknown function (DUF812); Inte	97.36
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	97.34
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	97.34
PF15070		617	GOLGA2L5: Putative golgin subfamily A member 2-lik	97.33
PF05290		140	Baculo_IE-1: Baculovirus immediate-early protein (	97.2
KOG4673		961	consensus Transcription factor TMF, TATA element m	97.19
KOG1001		674	consensus Helicase-like transcription factor HLTF/	97.06
PRK09039		343	hypothetical protein; Validated	97.05
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	97.04
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	97.02
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	97.0
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	97.0
KOG4673		961	consensus Transcription factor TMF, TATA element m	96.98
PRK09039		343	hypothetical protein; Validated	96.96
KOG0946		970	consensus ER-Golgi vesicle-tethering protein p115	96.95
KOG3800		300	consensus Predicted E3 ubiquitin ligase containing	96.94
COG5175		480	MOT2 Transcriptional repressor [Transcription]	96.91
KOG1003		205	consensus Actin filament-coating protein tropomyos	96.88
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	96.86
COG4942		420	Membrane-bound metallopeptidase [Cell division and	96.86
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	96.84
PF08647		96	BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395	96.81
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	96.81
COG4372		499	Uncharacterized protein conserved in bacteria with	96.76
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	96.76
PF15619		194	Lebercilin: Ciliary protein causing Leber congenit	96.57
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.56
KOG2034		911	consensus Vacuolar sorting protein PEP3/VPS18 [Int	96.55
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	96.54
KOG3161		861	consensus Predicted E3 ubiquitin ligase [Posttrans	96.48
PF10473		140	CENP-F_leu_zip: Leucine-rich repeats of kinetochor	96.46
KOG3002		299	consensus Zn finger protein [General function pred	96.44
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	96.44
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	96.42
COG5236		493	Uncharacterized conserved protein, contains RING Z	96.42
KOG3113		293	consensus Uncharacterized conserved protein [Funct	96.38
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	96.37
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	96.35
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	96.33
PF13514		1111	AAA_27: AAA domain	96.33
PF10146		230	zf-C4H2: Zinc finger-containing protein ; InterPro	96.32
KOG1029		1118	consensus Endocytic adaptor protein intersectin [S	96.29
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	96.29
KOG4593		716	consensus Mitotic checkpoint protein MAD1 [Cell cy	96.28
KOG0963		629	consensus Transcription factor/CCAAT displacement	96.17
KOG3970		299	consensus Predicted E3 ubiquitin ligase [Posttrans	96.1
PF04849		306	HAP1_N: HAP1 N-terminal conserved region; InterPro	96.08
COG4477		570	EzrA Negative regulator of septation ring formatio	96.05
COG5109		396	Uncharacterized conserved protein, contains RING Z	96.04
KOG4362		684	consensus Transcriptional regulator BRCA1 [Replica	96.02
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	96.01
PF02891		50	zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041	95.94
KOG0963		629	consensus Transcription factor/CCAAT displacement	95.94
smart00744		49	RINGv The RING-variant domain is a C4HC3 zinc-fing	95.89
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	95.88
KOG0993		542	consensus Rab5 GTPase effector Rabaptin-5 [Intrace	95.79
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	95.7
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	95.68
PF03854		50	zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc	95.64
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	95.63
KOG1941		518	consensus Acetylcholine receptor-associated protei	95.46
KOG0980		980	consensus Actin-binding protein SLA2/Huntingtin-in	95.45
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	95.42
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	95.41
PF10272		358	Tmpp129: Putative transmembrane protein precursor;	95.39
KOG4445		368	consensus Uncharacterized conserved protein, conta	95.39
KOG0995		581	consensus Centromere-associated protein HEC1 [Cell	95.35
KOG3039		303	consensus Uncharacterized conserved protein [Funct	95.17
KOG2930		114	consensus SCF ubiquitin ligase, Rbx1 component [Po	95.14
COG5219		1525	Uncharacterized conserved protein, contains RING Z	95.07
PRK11281		1113	hypothetical protein; Provisional	95.02
PF13514		1111	AAA_27: AAA domain	94.96
KOG4185		296	consensus Predicted E3 ubiquitin ligase [Posttrans	94.9
PF06906		57	DUF1272: Protein of unknown function (DUF1272); In	94.85
PF09789		319	DUF2353: Uncharacterized coiled-coil protein (DUF2	94.83
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	94.77
PF07191		70	zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807	94.71
KOG0999		772	consensus Microtubule-associated protein Bicaudal-	94.7
KOG0298		1394	consensus DEAD box-containing helicase-like transc	94.59
PF12325		120	TMF_TATA_bd: TATA element modulatory factor 1 TATA	94.59
PHA03096		284	p28-like protein; Provisional	94.4
KOG3579		352	consensus Predicted E3 ubiquitin ligase [Posttrans	94.39
PF13851		201	GAS: Growth-arrest specific micro-tubule binding	94.23
KOG1645		463	consensus RING-finger-containing E3 ubiquitin liga	94.17
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	94.16
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	94.15
PF05911		769	DUF869: Plant protein of unknown function (DUF869)	94.13
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	94.05
COG3813		84	Uncharacterized protein conserved in bacteria [Fun	94.02
KOG0018		1141	consensus Structural maintenance of chromosome pro	94.01
PF14915		305	CCDC144C: CCDC144C protein coiled-coil region	93.95
PF09728		309	Taxilin: Myosin-like coiled-coil protein; InterPro	93.71
PF10481		307	CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0	93.66
PF07111		739	HCR: Alpha helical coiled-coil rod protein (HCR);	93.65
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	93.6
TIGR01562		305	FdhE formate dehydrogenase accessory protein FdhE.	93.45
PF04216		290	FdhE: Protein involved in formate dehydrogenase fo	93.41
PF05883		134	Baculo_RING: Baculovirus U-box/Ring-like domain; I	93.32
PF02318		118	FYVE_2: FYVE-type zinc finger; InterPro: IPR003315	93.28
COG5185		622	HEC1 Protein involved in chromosome segregation, i	93.27
KOG1812		384	consensus Predicted E3 ubiquitin ligase [Posttrans	93.15
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	93.12
PF04710		416	Pellino: Pellino; InterPro: IPR006800 Pellino is i	93.1
PF08614		194	ATG16: Autophagy protein 16 (ATG16); InterPro: IPR	93.03
PF01363		69	FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc f	92.65
KOG1815		444	consensus Predicted E3 ubiquitin ligase [Posttrans	92.65
COG3883		265	Uncharacterized protein conserved in bacteria [Fun	92.64
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	92.64
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	92.63
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	92.51
cd00065		57	FYVE FYVE domain; Zinc-binding domain; targets pro	92.43
PRK03564		309	formate dehydrogenase accessory protein FdhE; Prov	92.25
PF07975		51	C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al	92.24
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	92.23
COG4647		165	AcxC Acetone carboxylase, gamma subunit [Secondary	92.12
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	92.08
KOG0825		1134	consensus PHD Zn-finger protein [General function	92.05
PRK10929		1109	putative mechanosensitive channel protein; Provisi	91.99
PRK10929		1109	putative mechanosensitive channel protein; Provisi	91.98
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	91.88
KOG3899		381	consensus Uncharacterized conserved protein [Funct	91.74
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	91.74
PF13240		23	zinc_ribbon_2: zinc-ribbon domain	91.74
PF13248		26	zf-ribbon_3: zinc-ribbon domain	91.73
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	91.71
PF14569		80	zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A.	91.6
PRK11281		1113	hypothetical protein; Provisional	91.54
TIGR01843		423	type_I_hlyD type I secretion membrane fusion prote	91.54
PF04111		314	APG6: Autophagy protein Apg6; InterPro: IPR007243	91.5
PF08317		325	Spc7: Spc7 kinetochore protein; InterPro: IPR01325	91.45
KOG4360		596	consensus Uncharacterized coiled coil protein [Fun	91.35
PF15066		527	CAGE1: Cancer-associated gene protein 1 family	91.35
KOG1428		3738	consensus Inhibitor of type V adenylyl cyclases/Ne	91.28
KOG0827		465	consensus Predicted E3 ubiquitin ligase [Posttrans	91.23
PF06005		72	DUF904: Protein of unknown function (DUF904); Inte	91.18
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	90.83
PF05010		207	TACC: Transforming acidic coiled-coil-containing p	90.61
PF06008		264	Laminin_I: Laminin Domain I; InterPro: IPR009254 L	90.4
PF10571		26	UPF0547: Uncharacterised protein family UPF0547; I	90.39
PF07800		162	DUF1644: Protein of unknown function (DUF1644); In	90.36
PF10235		90	Cript: Microtubule-associated protein CRIPT; Inter	90.21
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	90.16
KOG3842		429	consensus Adaptor protein Pellino [Signal transduc	90.13
PF05384		159	DegS: Sensor protein DegS; InterPro: IPR008595 Thi	89.82
TIGR01005		754	eps_transp_fam exopolysaccharide transport protein	89.81
KOG3799		169	consensus Rab3 effector RIM1 and related proteins,	89.73
PF10498		359	IFT57: Intra-flagellar transport protein 57 ; Inte	89.26
KOG1940		276	consensus Zn-finger protein [General function pred	89.2
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	89.08
smart00064		68	FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	88.83
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	88.82
TIGR03007		498	pepcterm_ChnLen polysaccharide chain length determ	88.74
PF00769		246	ERM: Ezrin/radixin/moesin family; InterPro: IPR011	88.55
PF08746		43	zf-RING-like: RING-like domain; InterPro: IPR01485	88.49
KOG2068		327	consensus MOT2 transcription factor [Transcription	88.48
PF09755		310	DUF2046: Uncharacterized conserved protein H4 (DUF	88.23
PF05605		54	zf-Di19: Drought induced 19 protein (Di19), zinc-b	88.13
KOG1729		288	consensus FYVE finger containing protein [General	88.11
PF12660		99	zf-TFIIIC: Putative zinc-finger of transcription f	88.04
COG4026		290	Uncharacterized protein containing TOPRIM domain,	88.0
PF08882		112	Acetone_carb_G: Acetone carboxylase gamma subunit;	87.86
PF04582		326	Reo_sigmaC: Reovirus sigma C capsid protein; Inter	87.17
COG4026		290	Uncharacterized protein containing TOPRIM domain,	87.13
PRK04023		1121	DNA polymerase II large subunit; Validated	86.94
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	86.92
PRK10884		206	SH3 domain-containing protein; Provisional	86.63
cd00350		33	rubredoxin_like Rubredoxin_like; nonheme iron bind	86.58
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	86.55
PF14353		128	CpXC: CpXC protein	86.44
COG2433		652	Uncharacterized conserved protein [Function unknow	86.35
PF15616		131	TerY-C: TerY-C metal binding domain	86.32
KOG0309		1081	consensus Conserved WD40 repeat-containing protein	86.18
smart00787		312	Spc7 Spc7 kinetochore protein. This domain is foun	86.11
PRK14714		1337	DNA polymerase II large subunit; Provisional	85.74
KOG2462		279	consensus C2H2-type Zn-finger protein [Transcripti	85.67
PF15397		258	DUF4618: Domain of unknown function (DUF4618)	85.66
COG1655		267	Uncharacterized protein conserved in bacteria [Fun	85.46
KOG1937		521	consensus Uncharacterized conserved protein [Funct	85.27
KOG2113		394	consensus Predicted RNA binding protein, contains	85.22
PHA02862		156	5L protein; Provisional	85.09
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	85.09
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	85.05
KOG4718		235	consensus Non-SMC (structural maintenance of chrom	84.92
PF15254		861	CCDC14: Coiled-coil domain-containing protein 14	84.8
PF12773		50	DZR: Double zinc ribbon	84.59
PF06818		202	Fez1: Fez1; InterPro: IPR009638 This family repres	84.39
PF10083		158	DUF2321: Uncharacterized protein conserved in bact	84.18
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	83.93
PF13870		177	DUF4201: Domain of unknown function (DUF4201)	83.64
KOG2979		262	consensus Protein involved in DNA repair [General	83.31
PF09304		107	Cortex-I_coil: Cortexillin I, coiled coil; InterPr	83.12
KOG1952		950	consensus Transcription factor NF-X1, contains NFX	82.77
COG5185		622	HEC1 Protein involved in chromosome segregation, i	82.74
COG2433		652	Uncharacterized conserved protein [Function unknow	82.69
PF15290		305	Syntaphilin: Golgi-localised syntaxin-1-binding cl	82.63
KOG3268		234	consensus Predicted E3 ubiquitin ligase [Posttrans	82.6
PF12906		47	RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A.	82.43
PF09738		302	DUF2051: Double stranded RNA binding protein (DUF2	82.38
KOG0396		389	consensus Uncharacterized conserved protein [Funct	82.08
PF09538		108	FYDLN_acid: Protein of unknown function (FYDLN_aci	81.55
PLN02189		1040	cellulose synthase	81.43
KOG2041		1189	consensus WD40 repeat protein [General function pr	81.36
PRK00420		112	hypothetical protein; Validated	81.11
KOG2789		482	consensus Putative Zn-finger protein [General func	81.08
KOG1356		889	consensus Putative transcription factor 5qNCA, con	80.96
KOG4218		475	consensus Nuclear hormone receptor betaFTZ-F1 [Tra	80.32
PF07889		126	DUF1664: Protein of unknown function (DUF1664); In	80.27
PRK05978		148	hypothetical protein; Provisional	80.22
KOG1853		333	consensus LIS1-interacting protein NUDE [Cytoskele	80.01

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=2.9e-41  Score=354.09  Aligned_cols=686  Identities=30%  Similarity=0.413  Sum_probs=514.0

Q ss_pred             hhhhhhcccchHHHHHHHHHHHHHHHHHhhcchHHHHhccccCcchhhccccchHHHHHHHHHHHHHHHHhhHHHHHHHH
Q 004587           18 MEEDRETGIPRTKNIVSNILAAVDNLWHLKGGLYAAVLKDLQDGGSKQKASSNLQSEVKNLRLALMDLHLKHKSLTRELQ   97 (743)
Q Consensus        18 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~l~~l~~~~~~~~~el~   97 (743)
                      ++..++.++.++.+.++.+...++.+..+.+.+...+.+   .........+.|..+...++..+..+..++..+...+.
T Consensus         3 ~~~~~~~~i~~~~~~~~~~~~~~D~lq~~~e~~~~~~~~---~~e~l~~~~~~L~~e~e~Lq~~~~~~~~~~~~~~~~~~   79 (698)
T KOG0978|consen    3 VEEPLAGRIKSEKEAVSLVLIQIDDLQTQAEELARRLNR---VEEALTVLFDELAEENEKLQNLADHLQEKHATLSEQIS   79 (698)
T ss_pred             chhhhHHHHHhhhhhhcccchhhHHHHHHHHHHHhhhhH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            567889999999999999999999988877766554433   11223336778888888999999999999999999999


Q ss_pred             HHhhhhHHhHHHHHhhHHHHHHHHHHHHHhhHhHHHhhhhhhhhccccccccccCCccc-ccccchhhhhhHhhHHHHHH
Q 004587           98 SRQDIDAKDKAKLNRLKGELESAVKELEECNCKLAALRAERDVTKGAFFPVLNLGNKHV-AGDRVRDEQRDLRDMESVHK  176 (743)
Q Consensus        98 ~~~~~~~~~~~e~~~l~~el~~~~~~le~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~l~  176 (743)
                      .+.+.+.....+...+...++.+..+++...+....+.........+...   ..++++ ..+.+.-.......+...++
T Consensus        80 el~~k~s~~~~~~~e~~~~le~~~~d~eki~~~~~~l~~~la~~~~~~~t---~~~~~~~~~~~~t~~~t~~~~l~~~ie  156 (698)
T KOG0978|consen   80 ELLDKISTAETEVDELEQQLEDLQADLEKIRRRSNKLNKHLAEALEHLNT---YGNGNGSLSGTITVNSTELEELRDEIE  156 (698)
T ss_pred             HHHHHHHHHhccHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhccCCC---CCCcccccCcccccchhhhhhhccchh
Confidence            99999988889999999999999999988888877775544444333332   112221 11111122345667778888


Q ss_pred             HHHHHHHHHHHHHHhHhhhHHHHHHHHHHHHHhhhhh--hhhhchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004587          177 ELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTLKSV--KCLSSSKAFLSVKNQLEKSKSEVFKYQALFEKLQVEKDNLA  254 (743)
Q Consensus       177 ~l~~~~~~~~~e~~~l~~e~~~l~~el~~l~~~l~~~--~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~l~~e~~~l~  254 (743)
                      ++......+..+++.++.....+..++..+...+..-  ........+..++     ++..+.-..       .+.+   
T Consensus       157 e~~~~~~~~~~ele~lq~~~~~~~~~~~~~~~~l~~~~~~~~~~~~e~~~~~-----~NE~l~~~~-------~~~~---  221 (698)
T KOG0978|consen  157 ELRELASTRMEELEKLQLYSDEILRQLDRFRVELRSLKEKVRSETFELRCLQ-----YNEELQRKT-------MESD---  221 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHH-----hhhhccccc-------chhh---
Confidence            8888888888889988888888888888888777431  1100000000000     000000000       0000   


Q ss_pred             HHHHHhhhhhchHHHHhhhhhchhhhHHHHHHHHHHHHHHHHHHHHHHHHhhcCCC-chHHHHHHHHHhhccHHHHHHHH
Q 004587          255 WRETELNMKIDLVDVFRRSSAVTDSKIADLGIEIQKQIDEKNRIEMRLEEASREPG-RKEIIAEFRALVSSFPEDMSAMQ  333 (743)
Q Consensus       255 ~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~l~~~~~~~~~L~~~l~~~~~~~~-~~~~~~e~~~~~~~~~~e~~~l~  333 (743)
                                   +.    +  ....+..+...+..+..+.+.+.........+.+ ......+++.++.++......|.
T Consensus       222 -------------e~----~--~~~~~~~lee~~~~~~~e~~~l~~~~e~~~~~~~~~~~in~e~~~L~Ssl~e~~~~l~  282 (698)
T KOG0978|consen  222 -------------EA----I--NSKKVIKLEEKLAQCVKEYEMLRKEFENNKSQNDLFSSINREMRHLISSLQEHEKLLK  282 (698)
T ss_pred             -------------hh----h--ccchHHHHHHHHHHHHHHHHHHHHhHHHhHHhhhhhhhHHHHHHHHHHHHHHHHHHHH
Confidence                         00    0  1122455556666666677777666655533333 44455677777777777777777


Q ss_pred             HHHHHhHHHHHHHHHHHHhHHhHHHHHHHHHHHHHHHHhhhHHHHHHHHHHH-HHHHhhhhhHHHHHHHHHHHhhcccch
Q 004587          334 RQLSKYKEAALDIHILRADVLSLTNVLERKVKECETLLASSADQVAEIHKLQ-AMVQDLTDSNLELKLILDMYRRESTDS  412 (743)
Q Consensus       334 ~~l~~~~~~~~el~~l~~~~~~l~~~l~~~~~~~~~l~~~~~~~~~~~~~l~-~~i~~l~~~~~~~~~~~~~~~~~~~~~  412 (743)
                      .....++.....+..++.....+...+.........+...+.........+. .-+..+......+....+.......+.
T Consensus       283 ~~~~~~k~t~~~~~~lr~~~~s~~~~~~~~~~~~e~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~k~  362 (698)
T KOG0978|consen  283 EYERELKDTESDNLKLRKQHSSAADSLESKSRDLESLLDKIQDLISQEAELSKKLRSKLLESAKKLKILLREKDRESQKE  362 (698)
T ss_pred             HHHHHHhcccchHHHHHHHHHHHHhhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHhhhh
Confidence            7777888888888888877777777776655555566666666666665555 333344444444555555444555555


Q ss_pred             hhHHHHHHHHHH-HHHHHHHHHhhhhHhhHHHHHhhHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHH---HHHHHHHHH
Q 004587          413 RDVLAARDLEYK-AWAHVHSLKSSLDEQSLELRVKTAIEAEAISQQRLAAAEAEIADMR-QKLEAFKR---DMVSLSDAL  487 (743)
Q Consensus       413 ~~~~~l~~~~~~-~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~e~~i~~l~-~~l~~~~~---~~~~l~~~l  487 (743)
                      +++.....+... ++..++.+.........+++++...+...-.+.-+.....+...++ ..++....   ++..+...|
T Consensus       363 ~di~~~k~el~~~~~~~le~~k~~~ke~~~~~~~ka~~E~e~l~q~l~~~~k~e~~e~~k~~~d~~~r~~~~~~~~~e~L  442 (698)
T KOG0978|consen  363 RDILVAKSELLKTNELRLEMLKSLLKEQRDKLQVKARAETESLLQRLKALDKEERSEIRKQALDDAERQIRQVEELSEEL  442 (698)
T ss_pred             HhHHHHHHHHHHHHHHHHHHHhCCCHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHhHHHHHHHHHHH
Confidence            666666666555 6777777777666665555544444444334444444445555555 34445555   344444455


Q ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHH
Q 004587          488 KSKNEEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQDALLMDKHMMESEIQQANASLNFF  567 (743)
Q Consensus       488 ~~~~~e~~~l~~e~~~l~~~~~el~~~~~~l~~~~~~~~~~~~~l~~e~~~~~~~~~~l~~e~~~l~~el~~l~~~l~~~  567 (743)
                      .........+..+++.++.++++++.++..|..++.+.++.+.+++.+...+.+.+..|..++..+...+.++....+.+
T Consensus       443 qk~~~~~k~ll~e~~t~gsA~ed~Qeqn~kL~~el~ekdd~nfklm~e~~~~~q~~k~L~~ek~~l~~~i~~l~~~~~~~  522 (698)
T KOG0978|consen  443 QKKEKNFKCLLSEMETIGSAFEDMQEQNQKLLQELREKDDKNFKLMSERIKANQKHKLLREEKSKLEEQILTLKASVDKL  522 (698)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            55555555778899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 004587          568 DMKAARIENQLRFCLDQAQRLAEDRSQNSANLENTQKRLSDVRKSSVQVRGSLEESQSKVYKSRLTLMELQIELVKERFA  647 (743)
Q Consensus       568 ~~~~~~le~~~~~l~~~l~~l~~el~~~~~~l~~~~~~~~e~~~~~~~l~~~l~~l~~~~~~~~~~l~~~~~~l~~~~~~  647 (743)
                      ...+..++++...+......+..++..+...++.+++...++...+..+...++.....+..++..+.+...+++.+...
T Consensus       523 ~~~i~~leeq~~~lt~~~~~l~~el~~~~~~le~~kk~~~e~~~~~~~Lq~~~ek~~~~le~i~~~~~e~~~ele~~~~k  602 (698)
T KOG0978|consen  523 ELKIGKLEEQERGLTSNESKLIKELTTLTQSLEMLKKKAQEAKQSLEDLQIELEKSEAKLEQIQEQYAELELELEIEKFK  602 (698)
T ss_pred             HHHHHHHHHHHHHhhHhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhhhhcCchhHHHHHHHHHHhhccccccccccccCCceeccCcccccHhhHHHHhccCCCCCc
Q 004587          648 KKRLEEDLEMGRRKVLRLQAQTEGSSIIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCP  727 (743)
Q Consensus       648 ~~~~~~~~~~l~~~~~~l~~~~~~~~~~~~l~~e~~~l~~~~~C~iC~~~~~~~~~~~Cgh~fC~~C~~~~~~~~~~~Cp  727 (743)
                      ...+++++..+.+++..+............|.+++..|+..+.||+|..+|++.|++.|||+||..|+.+++..|+|+||
T Consensus       603 ~~rleEE~e~L~~kle~~k~~~~~~s~d~~L~EElk~yK~~LkCs~Cn~R~Kd~vI~kC~H~FC~~Cvq~r~etRqRKCP  682 (698)
T KOG0978|consen  603 RKRLEEELERLKRKLERLKKEESGASADEVLAEELKEYKELLKCSVCNTRWKDAVITKCGHVFCEECVQTRYETRQRKCP  682 (698)
T ss_pred             HHHHHHHHHHHHHHHHHhccccccccccHHHHHHHHHHHhceeCCCccCchhhHHHHhcchHHHHHHHHHHHHHhcCCCC
Confidence            99999999999999999988777667789999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCcCcCC
Q 004587          728 GCAASFSPNDVKPVYI  743 (743)
Q Consensus       728 ~c~~~~~~~~~~~~~~  743 (743)
                      .|+.+|+++||++|||
T Consensus       683 ~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  683 KCNAAFGANDVHRIHL  698 (698)
T ss_pred             CCCCCCCcccccccCC
Confidence            9999999999999997

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>KOG0161 consensus Myosin class II heavy chain [Cytoskeleton]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning]	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion []	Back alignment and domain information

>KOG4674 consensus Uncharacterized conserved coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG0933 consensus Structural maintenance of chromosome protein 2 (chromosome condensation complex Condensin, subunit E) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0996 consensus Structural maintenance of chromosome protein 4 (chromosome condensation complex Condensin, subunit C) [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0964 consensus Structural maintenance of chromosome protein 3 (sister chromatid cohesion complex Cohesin, subunit SMC3) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG0971 consensus Microtubule-associated protein dynactin DCTN1/Glued [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG4643 consensus Uncharacterized coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PRK04863 mukB cell division protein MukB; Provisional	Back alignment and domain information

>KOG0976 consensus Rho/Rac1-interacting serine/threonine kinase Citron [Signal transduction mechanisms]	Back alignment and domain information

>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function	Back alignment and domain information

>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1	Back alignment and domain information

>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT)	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0962 consensus DNA repair protein RAD50, ABC-type ATPase/SMC superfamily [Replication, recombination and repair]	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>KOG0994 consensus Extracellular matrix glycoprotein Laminin subunit beta [Extracellular structures]	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK04778 septation ring formation regulator EzrA; Provisional	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site	Back alignment and domain information

>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PRK11637 AmiB activator; Provisional	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) []	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes	Back alignment and domain information

>PF14662 CCDC155: Coiled-coil region of CCDC155	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05483 SCP-1: Synaptonemal complex protein 1 (SCP-1); InterPro: IPR008827 Synaptonemal complex protein 1 (SCP-1) is the major component of the transverse filaments of the synaptonemal complex	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1340 Uncharacterized archaeal coiled-coil protein [Function unknown]	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5	Back alignment and domain information

>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG4673 consensus Transcription factor TMF, TATA element modulatory factor [Transcription]	Back alignment and domain information

>PRK09039 hypothetical protein; Validated	Back alignment and domain information

>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG1003 consensus Actin filament-coating protein tropomyosin [Cytoskeleton]	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions []	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ]	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG3113 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>KOG4593 consensus Mitotic checkpoint protein MAD1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues	Back alignment and domain information

>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning]	Back alignment and domain information

>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription]	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0963 consensus Transcription factor/CCAAT displacement protein CDP1 [Transcription]	Back alignment and domain information

>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>KOG0993 consensus Rab5 GTPase effector Rabaptin-5 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures]	Back alignment and domain information

>KOG0980 consensus Actin-binding protein SLA2/Huntingtin-interacting protein Hip1 [Cytoskeleton]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG0995 consensus Centromere-associated protein HEC1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>PF13514 AAA_27: AAA domain	Back alignment and domain information

>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length	Back alignment and domain information

>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length	Back alignment and domain information

>KOG0999 consensus Microtubule-associated protein Bicaudal-D [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair]	Back alignment and domain information

>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes []	Back alignment and domain information

>PHA03096 p28-like protein; Provisional	Back alignment and domain information

>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13851 GAS: Growth-arrest specific micro-tubule binding	Back alignment and domain information

>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05911 DUF869: Plant protein of unknown function (DUF869); InterPro: IPR008587 This family consists of a number of sequences found in plants	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3813 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG0018 consensus Structural maintenance of chromosome protein 1 (sister chromatid cohesion complex Cohesin, subunit SMC1) [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PF14915 CCDC144C: CCDC144C protein coiled-coil region	Back alignment and domain information

>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed	Back alignment and domain information

>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore []	Back alignment and domain information

>PF07111 HCR: Alpha helical coiled-coil rod protein (HCR); InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE	Back alignment and domain information

>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []	Back alignment and domain information

>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length	Back alignment and domain information

>PF02318 FYVE_2: FYVE-type zinc finger; InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ]	Back alignment and domain information

>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF01363 FYVE: FYVE zinc finger; InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3883 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;	Back alignment and domain information

>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional	Back alignment and domain information

>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PRK10929 putative mechanosensitive channel protein; Provisional	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>KOG3899 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF13240 zinc_ribbon_2: zinc-ribbon domain	Back alignment and domain information

>PF13248 zf-ribbon_3: zinc-ribbon domain	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A	Back alignment and domain information

>PRK11281 hypothetical protein; Provisional	Back alignment and domain information

>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family	Back alignment and domain information

>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells	Back alignment and domain information

>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association []	Back alignment and domain information

>KOG4360 consensus Uncharacterized coiled coil protein [Function unknown]	Back alignment and domain information

>PF15066 CAGE1: Cancer-associated gene protein 1 family	Back alignment and domain information

>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF05010 TACC: Transforming acidic coiled-coil-containing protein (TACC); InterPro: IPR007707 This family contains the proteins TACC 1, 2 and 3, found concentrated in the centrosomes of eukaryotes which may play a conserved role in organising centrosomal microtubules	Back alignment and domain information

>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells	Back alignment and domain information

>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines	Back alignment and domain information

>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function	Back alignment and domain information

>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>KOG3842 consensus Adaptor protein Pellino [Signal transduction mechanisms]	Back alignment and domain information

>PF05384 DegS: Sensor protein DegS; InterPro: IPR008595 This is a group of Bacillus DegS proteins	Back alignment and domain information

>TIGR01005 eps_transp_fam exopolysaccharide transport protein family	Back alignment and domain information

>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms	Back alignment and domain information

>KOG1940 consensus Zn-finger protein [General function prediction only]	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily	Back alignment and domain information

>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []	Back alignment and domain information

>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO)	Back alignment and domain information

>KOG2068 consensus MOT2 transcription factor [Transcription]	Back alignment and domain information

>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain	Back alignment and domain information

>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins	Back alignment and domain information

>KOG1729 consensus FYVE finger containing protein [General function prediction only]	Back alignment and domain information

>PF12660 zf-TFIIIC: Putative zinc-finger of transcription factor IIIC complex; InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PF08882 Acetone_carb_G: Acetone carboxylase gamma subunit; InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction: CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+ It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits)

Back alignment and domain information

>PF04582 Reo_sigmaC: Reovirus sigma C capsid protein; InterPro: IPR007662 Protein sigmaC in its native state was shown to be a homotrimer	Back alignment and domain information

>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only]	Back alignment and domain information

>PRK04023 DNA polymerase II large subunit; Validated	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>PRK10884 SH3 domain-containing protein; Provisional	Back alignment and domain information

>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>PF14353 CpXC: CpXC protein	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15616 TerY-C: TerY-C metal binding domain	Back alignment and domain information

>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown]	Back alignment and domain information

>smart00787 Spc7 Spc7 kinetochore protein	Back alignment and domain information

>PRK14714 DNA polymerase II large subunit; Provisional	Back alignment and domain information

>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]	Back alignment and domain information

>PF15397 DUF4618: Domain of unknown function (DUF4618)	Back alignment and domain information

>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>KOG1937 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG2113 consensus Predicted RNA binding protein, contains KH domain [General function prediction only]	Back alignment and domain information

>PHA02862 5L protein; Provisional	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>KOG4718 consensus Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1) [Chromatin structure and dynamics]	Back alignment and domain information

>PF15254 CCDC14: Coiled-coil domain-containing protein 14	Back alignment and domain information

>PF12773 DZR: Double zinc ribbon	Back alignment and domain information

>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein	Back alignment and domain information

>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PF13870 DUF4201: Domain of unknown function (DUF4201)	Back alignment and domain information

>KOG2979 consensus Protein involved in DNA repair [General function prediction only]	Back alignment and domain information

>PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold)	Back alignment and domain information

>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription]	Back alignment and domain information

>COG5185 HEC1 Protein involved in chromosome segregation, interacts with SMC proteins [Cell division and chromosome partitioning]	Back alignment and domain information

>COG2433 Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF15290 Syntaphilin: Golgi-localised syntaxin-1-binding clamp	Back alignment and domain information

>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A	Back alignment and domain information

>PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA	Back alignment and domain information

>KOG0396 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues	Back alignment and domain information

>PLN02189 cellulose synthase	Back alignment and domain information

>KOG2041 consensus WD40 repeat protein [General function prediction only]	Back alignment and domain information

>PRK00420 hypothetical protein; Validated	Back alignment and domain information

>KOG2789 consensus Putative Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG1356 consensus Putative transcription factor 5qNCA, contains JmjC domain [Transcription]	Back alignment and domain information

>KOG4218 consensus Nuclear hormone receptor betaFTZ-F1 [Transcription]	Back alignment and domain information

>PF07889 DUF1664: Protein of unknown function (DUF1664); InterPro: IPR012458 The members of this family are hypothetical plant proteins of unknown function	Back alignment and domain information

>PRK05978 hypothetical protein; Provisional	Back alignment and domain information

>KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		743
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-20
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-18
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	2e-15
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	2e-14
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	2e-14
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	2e-13
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	3e-13
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	3e-12
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	6e-12
1z6u_A		150	NP95-like ring finger protein isoform B; structura	2e-11
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	4e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	7e-11
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-10
1i84_S		1184	Smooth muscle myosin heavy chain; muscle protein,	2e-06
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	1e-10
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	1e-10
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	2e-10
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-10
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	2e-10
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	3e-10
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	6e-10
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	1e-09
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	1e-09
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	1e-09
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	2e-09
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	2e-09
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	2e-09
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	2e-09
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	7e-09
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	2e-08
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	2e-08
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	2e-08
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	2e-08
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	3e-08
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	3e-08
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	4e-08
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	4e-08
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	5e-08
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	6e-08
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	1e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	4e-07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	6e-07
2ea5_A		68	Cell growth regulator with ring finger domain prot	5e-07
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	6e-07
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	6e-07
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	1e-06
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	5e-06
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	6e-06
1sjj_A		863	Actinin; 3-helix bundle, calponin homology domain,	2e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	2e-05
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	2e-05
2cs3_A		93	Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s	4e-05
3nw0_A		238	Non-structural maintenance of chromosomes element	4e-05
3vkg_A		3245	Dynein heavy chain, cytoplasmic; AAA+ protein, mol	2e-04
2dfs_A		1080	Myosin-5A; myosin-V, inhibited state, cryoelectron	5e-04
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	6e-04
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	8e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 96.5 bits (239), Expect = 1e-20
 Identities = 97/592 (16%), Positives = 194/592 (32%), Gaps = 122/592 (20%)

Query: 29  TKNIVSNILAAVDNLWHLKGGLYAA-----VLKDLQDGGSKQKASSNLQSEVKNLRLALM 83
            K+I+S     +D++   K  +         L   Q+   ++     L+    N +  LM
Sbjct: 42  PKSILSK--EEIDHIIMSKDAVSGTLRLFWTLLSKQEEMVQKFVEEVLR---INYKF-LM 95

Query: 84  DLHLKHKSLTRELQSRQDIDAKDK--------AKLN--RLK--GELESAVKELEECN--- 128
              +K +     + +R  I+ +D+        AK N  RL+   +L  A+ EL       
Sbjct: 96  S-PIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVL 154

Query: 129 ------C-K--LAA--LRAERDVTKGAFFPV--LNLGNKHVAGDRVRDEQRDLRDMESVH 175
                   K  +A     + + V     F +  LNL N +     +   Q+ L  ++   
Sbjct: 155 IDGVLGSGKTWVALDVCLSYK-VQCKMDFKIFWLNLKNCNSPETVLEMLQKLLYQIDPNW 213

Query: 176 KELMDQASHQLLELKGLHDGRIKVLQQLYNLQNTL------KSVKCLSSSKAF------- 222
               D +S+  L +  +    ++ L +    +N L      ++ K      AF       
Sbjct: 214 TSRSDHSSNIKLRIHSIQA-ELRRLLKSKPYENCLLVLLNVQNAKAW---NAFNLSCKIL 269

Query: 223 -----LSVKNQLEKSKSEVFKYQALFEKLQVEKDNLAWRETE------LNMKI-DLVDVF 270
                  V + L  + +           L      L   E +      L+ +  DL    
Sbjct: 270 LTTRFKQVTDFLSAATTTHI-------SLDHHSMTLTPDEVKSLLLKYLDCRPQDL---- 318

Query: 271 RRSSAVTDS--KIADLGIEIQKQIDEKNRIEMRLEEASREPGRKEIIAEFRALVSSFPED 328
                +T +  +++ +   I+   D     +   +  + +     I +    L    P +
Sbjct: 319 -PREVLTTNPRRLSIIAESIR---DGLATWD-NWKHVNCDKLTTIIESSLNVLE---PAE 370

Query: 329 MSAMQRQLSKYKEAALDIHILRADVLSL------TNVLERKVKECE--TLLA-SSADQVA 379
              M  +LS +       HI    +LSL       + +   V +    +L+     +   
Sbjct: 371 YRKMFDRLSVFPP---SAHI-PTILLSLIWFDVIKSDVMVVVNKLHKYSLVEKQPKESTI 426

Query: 380 EIHKLQAMVQDLTDSNLEL-KLILDMYR-RESTDSRDVLAARDLEYKAWAHV--HSLKSS 435
            I  +   ++   ++   L + I+D Y   ++ DS D++     +Y    H+  H     
Sbjct: 427 SIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYS-HIGHHLKNIE 485

Query: 436 LDEQSLELRVKTA----IEAEAISQQRLAAAEAEIADMRQKLEAFKRDMVSLSDALKSKN 491
             E+    R+       +E +         A   I +  Q+L+ +K  +       +   
Sbjct: 486 HPERMTLFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLV 545

Query: 492 EEIEAYLSEIETIGQSYDDMQTQNQQLLQQITERDDYNIKLVLEGVRARQLQ 543
             I  +L +IE               LL+     +D  I    E    +Q+Q
Sbjct: 546 NAILDFLPKIEENLICSKYT-----DLLRIALMAEDEAI--FEEA--HKQVQ 588

PyMOL of 1vt4

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74	Back alignment and structure

>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93	Back alignment and structure

>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238	Back alignment and structure

>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245	Back alignment and structure

>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		743
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	4e-17
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	4e-14
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	1e-13
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	2e-12
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	5e-09
d1t1ha_		78	g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre	2e-08
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	3e-08
d2c2la2		80	g.44.1.2 (A:225-304) STIP1 homology and U box-cont	3e-08
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	3e-08
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	6e-07
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	2e-06
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	1e-05
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	9e-05
d1v87a_		114	g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou	0.002
d3dplr1		88	g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S	0.002
d1wima_		94	g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016	0.002

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 74.6 bits (183), Expect = 4e-17
 Identities = 16/57 (28%), Positives = 25/57 (43%)

Query: 684 EYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRHRKCPGCAASFSPNDVKP 740
            + + + C IC     + V T C HLFC  C+ +  +     CP C     P D++ 
Sbjct: 19  HFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCPSCRYPCFPTDLES 75

PyMOL of d1rmda2

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		743
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	99.1
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.99
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.85
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.81
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.81
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.76
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.55
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	98.52
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.51
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.36
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.35
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.28
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.24
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	98.0
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.0
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.4
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	97.28
d1zbdb_		124	Effector domain of rabphilin-3a {Rat (Rattus norve	88.32
d2cs3a1		80	Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [	87.79
d2fiya1		290	FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId	82.76

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.10  E-value=5.4e-11  Score=101.93  Aligned_cols=69  Identities=35%  Similarity=0.729  Sum_probs=58.2

Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCCEECCCCCCCCHHHHHHHHCCCC--CCCCCCCCCCCCCCCCCCC
Q ss_conf             48999999998422665612113467726626766223720888753698--8876788878889986767
Q 004587          674 IIEELQQELREYREILKCSICLERPKEVVITKCYHLFCNPCVQKVTESRH--RKCPGCAASFSPNDVKPVY  742 (743)
Q Consensus       674 ~~~~l~~e~~~~~~~~~C~iC~~~~~~~~~~~CgH~fC~~C~~~~~~~~~--~~CP~C~~~~~~~~~~~~~  742 (743)
                      .++.++.-+..+...+.||||++.|.+|++++|||+||..|+..|+....  ..||.||..+...++.+++
T Consensus         7 ~~~~~~~~~~~l~~~l~CpIC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~~l~~n~   77 (103)
T d1jm7a_           7 RVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQEST   77 (103)
T ss_dssp             SHHHHHHHHHHHHHHTSCSSSCCCCSSCCBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTTTCBCCC
T ss_pred             HHHHHHHHHHHCCCCCCCCCCCCHHCCEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHCCCCH
T ss_conf             19999999996635849972182318918837998641678999999779998096988838755287578

PyMOL of d1jm7a_

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fiya1 e.59.1.1 (A:19-308) FdhE homolog PA4809 {Pseudomonas aeruginosa [TaxId: 287]}	Back information, alignment and structure