Citrus Sinensis ID: 004590

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740---

MSLHSKDIDSAFEGAGKKLGLEIWCIENLQLVSVPKSSHGKFYTGSAYVILNTALLKSGPPQHDIHYWLGNDVNEEDSTLVSDKALELDAALGSCTVQYREVQGQETEKFLSYFRPCIIPLDGKYSLRSGKSNGETYKISMLTCKGDHVVRVKEVPFSRSSLNHNDVFIVDTASKIFLFSGCNSSIQERAKALEVVQYIKEDKHGGKCGVATVEDGKFVGDSDVGEFWSLFGGYAPIPRDSPSAFQQQPDTPSTTFFWINLQGKLCQIAANSLNKDMLEKDKCYMLDCVNEVFVWTGRNTSITERRISISASEDFLRNQGRTTGTHLTFLTEGLETTVFRSYFDSWPQIAEPKLYDEGREKVAAIFKQQGHDVKELPEEDFEPYVNCRGILKVWRVNGDELSLLPAAEQMKLFSGDCYIVKYTYPGNGRDENVIYAWFGHESMTEDRAAAISHMSAIVDSTRGEAVMAQVHQDMEPVQFFLIFQSLIVFKGGLSTQYKKFIVEEGIVDETYDEKKMALFCIQGTSPCNMQAFQVDRVSTCLNSSYCYILQNGASVFTWIGNLSSSRDHDLLDRMVELINPTWQPISVREGSEPEVFWNALGGKSEYPREKEIKGFIEDPHLFTCTLTEGDLKVKEIYNFTQDDLTTEDILVLDCCREIYVWIGCHSDLNSKQQALNIGQKFLETDILVEGLSLETPIYVVTEGHEPPFFTCFFAWDPLKAKMHGNSFERKLAILKGRPSIETV

cccccccccHHHHcccccccEEEEEEEccCEEEcccccccccccccEEEEEEEEEccccccEEEEEEEEccccccccccHHHHHHHHHHHHHcccccHHHHHHccccHHHHHcccccCEEccccccccccccccccccEEEEEEcccCEEEEEEEcccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHcccccCEEEEEEEcccccccccHHHHHHHccccccccccccccccccccccccEEEEEcccccEEEEEcccccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHcccccccEEEEEccccccHHHHHcccccccccccccccccccHHHHHHHcccccccccccccccccCCcccEEEEEEEccccccccccccccCECcccEEEEEEEccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccEEEEEcccccHHHHHHcccEEEEEccccccccccEEcccccccccccccEEEEEEEcccccccEEEEEcccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHccccccCCcccccccHHHHHcccccccccccccccccccccCEEEEECccccEEEEEEccccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccEEEEcccccccccCECccccccccccccccHHHHHHHcccccccccc

************EGAGKKLGLEIWCIENLQLVSVPKSSHGKFYTGSAYVILNTALLKSGPPQHDIHYWLGNDVNEEDSTLVSDKALELDAALGSCTVQYREVQGQETEKFLSYFRPCIIPLDGKYSLRSGKSNGETYKISMLTCKGDHVVRVKEVPFSRSSLNHNDVFIVDTASKIFLFSGCNSSIQERAKALEVVQYIKEDKHGGKCGVATVEDGKFVGDSDVGEFWSLFGGYAPI******AFQQQPDTPSTTFFWINLQGKLCQIAANSLNKDMLEKDKCYMLDCVNEVFVWTGRNTSITERRISISASEDFLRNQGRTTGTHLTFLTEGLETTVFRSYFDSWPQIAEPKLYD*GREKVAAIFKQQGHDVKELPEEDFEPYVNCRGILKVWRVNGDELSLLPAAEQMKLFSGDCYIVKYTYPGNGRDENVIYAWFGHESMTEDRAAAISHMSAIVDSTRGEAVMAQVHQDMEPVQFFLIFQSLIVFKGGLSTQYKKFIVEEGIVDETYDEKKMALFCIQGTSPCNMQAFQVDRVSTCLNSSYCYILQNGASVFTWIGNLSSSRDHDLLDRMVELINPTWQPISVREGSEPEVFWNALGGKSEYPREKEIKGFIEDPHLFTCTLTEGDLKVKEIYNFTQDDLTTEDILVLDCCREIYVWIGCHSDLNSKQQALNIGQKFLETDILVEGLSLETPIYVVTEGHEPPFFTCFFAWDPLKAKMHGNSFERKLAI**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Villin-1	Ca(2+)-regulated actin-binding protein.	probable	O81643
Advillin	Ca(2+)-regulated actin-binding protein. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. Involved in the formation of long fine actin-containing filopodia-like structures in fibroblast. Plays a role in ciliogenesis.	probable	O75366

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J72, chain A
Confidence level:very confident
Coverage over the Query: 11-346
View the alignment between query and template
View the model in PyMOL

Template: 1D0N, chain A
Confidence level:very confident
Coverage over the Query: 9-499,511-734
View the alignment between query and template
View the model in PyMOL