Citrus Sinensis ID: 004674


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------74
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRRKKHSNQGNEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
cccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccccccccccccccEEEccccEEEEEEcccccccccEEEEEEcccccccEEEEcccccccccccccEEEEEccccEEEEEcccccEEEEEcccccccccEEEEEccccEEEEcccccccccEEEEcccccccccccccEEEEEEcccccEEEEEcccccccccccEEEEEEcccccEEEEEEccEEEEEEccccccEEEEccccccccEEEEEEEEcccEEEEEEEEcccccEEEEEEcccccEEEEEEEcccccEEEEEEccccccccccccccccccccccccccccccccccccccccHHHHccccccccEEEccccccccccEEEEEccccccccccEEEEccccHHHHHHHHHccccEEEEEccccccccccEEEEcccccccEEcccccEEEEEEEEcccccHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEHHHHHHHHcccccccccccccccccEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccEEEccEEEEEEEEEEEEEcccccccccccccccccccccc
ccEEEEHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEccccEEEEEEEcccccccEEEEEEEEcccccEEEEEEccccccccccEEEEEEcccccEEEEEEccccEEEEEcccccccccEEEEcccccEEEEEccccccccEEEEEccccccccccccEccccccccccEEEEEcccccccccccEEEEEccccccEEEEEcccEEEEEccccccEEEccccccccccEEEEEEEEcccEEEEEEEEEcccEEEEEEEccccEEEEEEEEcccccEEEEEEEccccccccccHcccccccEEcccccccccccccccccccHHHHHccccccccEEcccccccccccEEEEccccccccccEEEcccccHHHHHHHHHHcccEEEEEEEcccccccEEEEEEcccHHHHHcccccccEEEEEcHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEcHHHHHHHHcccccccccccccccccEccEcccccEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccHHHEcccccccccHHHHHHHHHHHHHHHHHHHHccHccEEcccccHHHEEEcccccEEEccccccEEcccccccccccEEEEEccHccHHHHHHccccHHHHHHHHHHHHHHHEcccccccccccccccccEEEEcc
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTldtislgqsikdgETLVSAKEsfelgffspgnsksryLGIWYKKIAEGTVTwvanrdaplsdrsgvlringeRNGILVLLNStndtvwssnssisaQKPVAALMEsgnlvvkdgkdnnpdnilwqsfdypcdtllpgmklginlgTGLNRFLsswkstddpargdftygldprgipqlvlrKNSIITfragswnglhwtgvpqlqlnpvytfeyvsnekeAFYTynlsnssvpsrmvinpagtvqRYTWMERTKTwtlfsrfsgvtldqcdsyalcgayascninsnspececlqgfvpnsqrewdmqyksggcvrrtpldckhgdgflehkavklpdtrfswvDKNITLWECKelcskncsctayanadvrgrgsgcllwfhdlidikelpesgQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRrkkhsnqgnekeemelpiFDLKIIANAtdnfseknklgeggfgpvykgmLIEGQEIAVKRLskgsgqgmeEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYeylpnksldyfifdttrsklldwskrSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVlldntmnpkisdfglarsfgldqteantkrvvgtygymspeyaidGLFSVKSDVFSFGVLVLEIICgkknrgfnhadhdhnllghvsl
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESfelgffspgnsksrYLGIWYKKIAEGTVTwvanrdaplsdrsgvlringERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFtygldprgipqLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNlsnssvpsrmvinPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLehkavklpdtrfswVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAaseldnverrrqsknkkqvMIIITSISLATAVIFIGGLMYRRKKHsnqgnekeemeLPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARsfgldqteantKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNrgfnhadhdhnllghvsl
MPFILTLATNFIKQAISISMSKMEGFNlliiysflfyiisAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRRKKHSNQGNEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
**FILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWS*******************LVV******NPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMA*****************QVMIIITSISLATAVIFIGGLMYR***************LPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRL********EEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHA************
*PFILT*ATN*********MSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSS*****PVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELD*****RQSKNKKQVMIIITSISLATAVIFIGGLMYR****************PIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRR**********EEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRRKKHSNQGNEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPFILTLATNFIKQAISISMSKMEGFNLLIIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQKPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFxxxxxxxxxxxxxxxxxxxxxQVMIIITSISLATAVIFIGGLMYRRKKHSNQGNEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGHVSL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query738 2.2.26 [Sep-21-2011]
O81832783 G-type lectin S-receptor- yes no 0.914 0.862 0.554 0.0
O81905 850 Receptor-like serine/thre no no 0.932 0.809 0.488 0.0
O81833815 G-type lectin S-receptor- no no 0.924 0.836 0.530 0.0
Q09092 857 Putative serine/threonine N/A no 0.940 0.809 0.468 0.0
Q9ZT07 833 G-type lectin S-receptor- no no 0.928 0.822 0.481 0.0
Q9S972 847 Receptor-like serine/thre no no 0.910 0.793 0.481 0.0
Q39086 843 Receptor-like serine/thre no no 0.906 0.793 0.482 0.0
Q9LPZ3 845 G-type lectin S-receptor- no no 0.921 0.804 0.470 0.0
P0DH86 853 G-type lectin S-receptor- no no 0.921 0.797 0.467 1e-177
O81906 849 G-type lectin S-receptor- no no 0.917 0.797 0.451 1e-176
>sp|O81832|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 OS=Arabidopsis thaliana GN=At4g27290 PE=3 SV=4 Back     alignment and function desciption
 Score =  807 bits (2084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/721 (55%), Positives = 510/721 (70%), Gaps = 46/721 (6%)

Query: 23  MEGFNLL-IIYSFLFYIISAARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRY 81
           ME  N+L ++   LF  I  A+  D +   Q++KDG+T+VS   SFE+GFFSPG S++RY
Sbjct: 1   MEATNVLHLLIISLFSTILLAQATDILIANQTLKDGDTIVSQGGSFEVGFFSPGGSRNRY 60

Query: 82  LGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQ 141
           LGIWYKKI+  TV WVANRD+PL D SG L+++   NG L L N  N  +WSS+SS S+Q
Sbjct: 61  LGIWYKKISLQTVVWVANRDSPLYDLSGTLKVS--ENGSLCLFNDRNHIIWSSSSSPSSQ 118

Query: 142 K-----PVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFL 196
           K     P+  ++++GNLVV++  D+   + +WQS DYP D  LPGMK G+N  TGLNRFL
Sbjct: 119 KASLRNPIVQILDTGNLVVRNSGDDQ--DYIWQSLDYPGDMFLPGMKYGLNFVTGLNRFL 176

Query: 197 SSWKSTDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTF 256
           +SW++ DDP+ G++T  +DP G+PQ  L+KNS++ FR G WNGL +TG+P L+ NP+Y +
Sbjct: 177 TSWRAIDDPSTGNYTNKMDPNGVPQFFLKKNSVVVFRTGPWNGLRFTGMPNLKPNPIYRY 236

Query: 257 EYVSNEKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDS 316
           EYV  E+E +YTY L N SV +RM +NP G +QRYTW++  ++W  +       +D CD 
Sbjct: 237 EYVFTEEEVYYTYKLENPSVLTRMQLNPNGALQRYTWVDNLQSWNFYL---SAMMDSCDQ 293

Query: 317 YALCGAYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHG-DGFLEH 375
           Y LCG+Y SCNIN  SP C CL+GFV  + + W     S GCVRR  LDC  G DGFL+ 
Sbjct: 294 YTLCGSYGSCNINE-SPACRCLKGFVAKTPQAWVAGDWSEGCVRRVKLDCGKGEDGFLKI 352

Query: 376 KAVKLPDTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKEL 435
             +KLPDTR SW DKN+ L ECK++C +NC+C+AY+  D+R  G GC+LWF DLIDI+E 
Sbjct: 353 SKLKLPDTRTSWYDKNMDLNECKKVCLRNCTCSAYSPFDIRDGGKGCILWFGDLIDIREY 412

Query: 436 PESGQDLFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMYRRKKHSNQ 495
            E+GQDL++R+A+SE++ ++R                                  + S++
Sbjct: 413 NENGQDLYVRLASSEIETLQRESS-------------------------------RVSSR 441

Query: 496 GNEKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQ 555
             E+E++ELP  DL  ++ AT  FS  NKLG+GGFGPVYKG L  GQE+AVKRLS+ S Q
Sbjct: 442 KQEEEDLELPFLDLDTVSEATSGFSAGNKLGQGGFGPVYKGTLACGQEVAVKRLSRTSRQ 501

Query: 556 GMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDW 615
           G+EEFKNE+ LIAKLQHRNLVK+LG C   +ERMLIYEY PNKSLD FIFD  R + LDW
Sbjct: 502 GVEEFKNEIKLIAKLQHRNLVKILGYCVDEEERMLIYEYQPNKSLDSFIFDKERRRELDW 561

Query: 616 SKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTE 675
            KR  II GIARG+LYLH+DSRLRIIHRDLKASNVLLD+ MN KISDFGLAR+ G D+TE
Sbjct: 562 PKRVEIIKGIARGMLYLHEDSRLRIIHRDLKASNVLLDSDMNAKISDFGLARTLGGDETE 621

Query: 676 ANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGH 735
           ANT RVVGTYGYMSPEY IDG FS+KSDVFSFGVLVLEI+ G++NRGF + +H  NLLGH
Sbjct: 622 ANTTRVVGTYGYMSPEYQIDGYFSLKSDVFSFGVLVLEIVSGRRNRGFRNEEHKLNLLGH 681

Query: 736 V 736
            
Sbjct: 682 A 682





Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|O81905|SD18_ARATH Receptor-like serine/threonine-protein kinase SD1-8 OS=Arabidopsis thaliana GN=SD18 PE=1 SV=1 Back     alignment and function description
>sp|O81833|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 OS=Arabidopsis thaliana GN=SD11 PE=1 SV=1 Back     alignment and function description
>sp|Q09092|SRK6_BRAOE Putative serine/threonine-protein kinase receptor OS=Brassica oleracea var. acephala GN=SRK6 PE=2 SV=2 Back     alignment and function description
>sp|Q9ZT07|RKS1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RKS1 OS=Arabidopsis thaliana GN=RKS1 PE=2 SV=3 Back     alignment and function description
>sp|Q9S972|SD16_ARATH Receptor-like serine/threonine-protein kinase SD1-6 OS=Arabidopsis thaliana GN=SD16 PE=1 SV=2 Back     alignment and function description
>sp|Q39086|SD17_ARATH Receptor-like serine/threonine-protein kinase SD1-7 OS=Arabidopsis thaliana GN=SD17 PE=1 SV=1 Back     alignment and function description
>sp|Q9LPZ3|Y1141_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g11410 OS=Arabidopsis thaliana GN=At1g11410 PE=3 SV=3 Back     alignment and function description
>sp|P0DH86|SRK_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SRK OS=Arabidopsis thaliana GN=SRK PE=2 SV=1 Back     alignment and function description
>sp|O81906|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120 OS=Arabidopsis thaliana GN=B120 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query738
224122978831 predicted protein [Populus trichocarpa] 0.953 0.847 0.638 0.0
224122958812 predicted protein [Populus trichocarpa] 0.951 0.864 0.622 0.0
147799241818 hypothetical protein VITISV_027305 [Viti 0.945 0.853 0.607 0.0
359493740 2422 PREDICTED: uncharacterized protein LOC10 0.955 0.291 0.583 0.0
224122858831 predicted protein [Populus trichocarpa] 0.955 0.848 0.585 0.0
359493715 1603 PREDICTED: uncharacterized protein LOC10 0.944 0.434 0.615 0.0
255569631 868 S-locus-specific glycoprotein S13 precur 0.949 0.807 0.593 0.0
359493725 1593 PREDICTED: uncharacterized protein LOC10 0.949 0.440 0.599 0.0
359493721804 PREDICTED: G-type lectin S-receptor-like 0.905 0.830 0.605 0.0
359493727 1767 PREDICTED: uncharacterized protein LOC10 0.945 0.395 0.589 0.0
>gi|224122978|ref|XP_002330411.1| predicted protein [Populus trichocarpa] gi|222871796|gb|EEF08927.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  937 bits (2423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/730 (63%), Positives = 562/730 (76%), Gaps = 26/730 (3%)

Query: 23  MEGFNLLIIYSFLFYIISAAR-TLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRY 81
           + GF +L +++FL  +ISA R + DT++ GQSI+DG+ LVSA  SFELGFFSPG SK RY
Sbjct: 5   ISGFIILFVHTFL--LISAIRASTDTLTPGQSIRDGDLLVSADGSFELGFFSPGISKGRY 62

Query: 82  LGIWYKKIAEGTVTWVANRDAPLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQ 141
           LGIWY+KI+ GTV WVANR+ PL+D SG L +  +  GIL+LLNS+ D +WSSN+S +AQ
Sbjct: 63  LGIWYQKISAGTVVWVANRETPLNDSSGALIVTDQ--GILILLNSSKDAIWSSNASRTAQ 120

Query: 142 KPVAALMESGNLVVKDGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKS 201
            PV  L++SGNLVVKD  DN+ +N LWQSFDYP DTLLPGMK G N+ TGL+R+LSSWKS
Sbjct: 121 NPVMKLLDSGNLVVKDINDNS-ENFLWQSFDYPGDTLLPGMKWGRNMVTGLDRYLSSWKS 179

Query: 202 TDDPARGDFTYGLDPRGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSN 261
           ++DPA+G+FT+ +DPRG  Q++L +   I +R G+WNG  WTG PQL+ N +YT+ ++S 
Sbjct: 180 SNDPAQGEFTFRIDPRGNTQMLLMRGPKILYRTGTWNGYRWTGTPQLEPNMLYTYGFIST 239

Query: 262 EKEAFYTYNLSNSSVPSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCG 321
             E +Y ++L NSSV SR+V+N +G  QR+TW+ RT +W   +RFS V LDQCD YALCG
Sbjct: 240 ATEMYYKFDLINSSVASRIVMNSSGAAQRFTWITRTNSW---ARFSAVLLDQCDDYALCG 296

Query: 322 AYASCNINSNSPECECLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHGDGFLEHKAVKLP 381
           AY SCN+N   P C CL+GF+P S ++W +Q  S GCVRRT LDC  GD FL+H  VKLP
Sbjct: 297 AYGSCNVNKQ-PVCACLEGFIPKSPKDWSIQEWSDGCVRRTKLDCDKGDRFLQHGGVKLP 355

Query: 382 DTRFSWVDKNITLWECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQD 441
           D   SWVD +  L ECK+LC KNCSC AYAN+D+RG GSGCLLWF +LID +EL   GQD
Sbjct: 356 DMIKSWVDTSKGLKECKDLCLKNCSCVAYANSDIRGGGSGCLLWFDELIDTRELTTGGQD 415

Query: 442 LFIRMAASELDNVERRRQSKNKKQVMIIITSISLATAVIFIGGLMY-RRKKHSNQGN--- 497
           L+IR+AASEL N+E+ R S +KKQ+ II+ +I     V+ +  ++Y RRKK   Q N   
Sbjct: 416 LYIRIAASELYNIEKNRSS-DKKQLGIIVGTIITIVGVLVLAFILYARRKKLKKQANMKT 474

Query: 498 -----------EKEEMELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAV 546
                       KE+MELP FDL  IANATDNFS +NKLGEGGFG VYKG LIEGQE+AV
Sbjct: 475 SHLQNYEDEDQRKEDMELPTFDLSTIANATDNFSSRNKLGEGGFGSVYKGTLIEGQEVAV 534

Query: 547 KRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFD 606
           KRLSK SGQG+ EFKNEV+LIAKLQHRNLVKLLGCC + DER+LIYEY+PNKSLDYFIFD
Sbjct: 535 KRLSKNSGQGLTEFKNEVILIAKLQHRNLVKLLGCCIEGDERILIYEYMPNKSLDYFIFD 594

Query: 607 TTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLA 666
                  DW    +I+ GIARGLLYLHQDSRLRIIHRDLKA+NVLLDN MNPKISDFGLA
Sbjct: 595 KKTRNSSDWRIWINIVGGIARGLLYLHQDSRLRIIHRDLKAANVLLDNGMNPKISDFGLA 654

Query: 667 RSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHA 726
           R+FG DQTEANT ++VGTYGYMSPEYA+DG FSVKSDVFSFGVLVLEI+ GKKNRGFNH 
Sbjct: 655 RTFGGDQTEANTNKIVGTYGYMSPEYAVDGFFSVKSDVFSFGVLVLEIVSGKKNRGFNHP 714

Query: 727 DHDHNLLGHV 736
           DH HNLLGH 
Sbjct: 715 DHHHNLLGHA 724




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224122958|ref|XP_002330406.1| predicted protein [Populus trichocarpa] gi|222871791|gb|EEF08922.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147799241|emb|CAN77004.1| hypothetical protein VITISV_027305 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493740|ref|XP_002280379.2| PREDICTED: uncharacterized protein LOC100262430 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224122858|ref|XP_002330381.1| predicted protein [Populus trichocarpa] gi|222871766|gb|EEF08897.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359493715|ref|XP_002280938.2| PREDICTED: uncharacterized protein LOC100246941 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255569631|ref|XP_002525781.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] gi|223534931|gb|EEF36617.1| S-locus-specific glycoprotein S13 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359493725|ref|XP_002280679.2| PREDICTED: uncharacterized protein LOC100260657 [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493721|ref|XP_002280717.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359493727|ref|XP_002280656.2| PREDICTED: uncharacterized protein LOC100243545 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query738
TAIR|locus:2131684783 AT4G27290 [Arabidopsis thalian 0.563 0.531 0.516 9.9e-218
TAIR|locus:2131694815 AT4G27300 [Arabidopsis thalian 0.917 0.830 0.539 2.9e-190
TAIR|locus:2141181 850 RK3 "receptor kinase 3" [Arabi 0.585 0.508 0.426 6.4e-190
TAIR|locus:2018546 843 RK1 "receptor kinase 1" [Arabi 0.581 0.508 0.401 7.8e-183
TAIR|locus:2018506 847 RK2 "receptor kinase 2" [Arabi 0.373 0.325 0.631 5e-179
TAIR|locus:2141176 849 B120 [Arabidopsis thaliana (ta 0.325 0.282 0.676 2.8e-165
TAIR|locus:2200908842 AT1G61610 [Arabidopsis thalian 0.323 0.283 0.658 2.6e-160
TAIR|locus:2200151830 SD1-13 "S-domain-1 13" [Arabid 0.319 0.284 0.618 2.5e-149
UNIPROTKB|O49974848 KIK1 "Serine/threonine-protein 0.315 0.274 0.665 3e-144
TAIR|locus:2197729805 SD1-29 "S-domain-1 29" [Arabid 0.880 0.807 0.442 8.6e-143
TAIR|locus:2131684 AT4G27290 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1220 (434.5 bits), Expect = 9.9e-218, Sum P(2) = 9.9e-218
 Identities = 223/432 (51%), Positives = 306/432 (70%)

Query:    42 ARTLDTISLGQSIKDGETLVSAKESFELGFFSPGNSKSRYLGIWYKKIAEGTVTWVANRD 101
             A+  D +   Q++KDG+T+VS   SFE+GFFSPG S++RYLGIWYKKI+  TV WVANRD
Sbjct:    21 AQATDILIANQTLKDGDTIVSQGGSFEVGFFSPGGSRNRYLGIWYKKISLQTVVWVANRD 80

Query:   102 APLSDRSGVLRINGERNGILVLLNSTNDTVWSSNSSISAQK-----PVAALMESGNLVVK 156
             +PL D SG L+++   NG L L N  N  +WSS+SS S+QK     P+  ++++GNLVV+
Sbjct:    81 SPLYDLSGTLKVS--ENGSLCLFNDRNHIIWSSSSSPSSQKASLRNPIVQILDTGNLVVR 138

Query:   157 DGKDNNPDNILWQSFDYPCDTLLPGMKLGINLGTGLNRFLSSWKSTDDPARGDFTYGLDP 216
             +  D+   + +WQS DYP D  LPGMK G+N  TGLNRFL+SW++ DDP+ G++T  +DP
Sbjct:   139 NSGDDQ--DYIWQSLDYPGDMFLPGMKYGLNFVTGLNRFLTSWRAIDDPSTGNYTNKMDP 196

Query:   217 RGIPQLVLRKNSIITFRAGSWNGLHWTGVPQLQLNPVYTFEYVSNEKEAFYTYNLSNSSV 276
              G+PQ  L+KNS++ FR G WNGL +TG+P L+ NP+Y +EYV  E+E +YTY L N SV
Sbjct:   197 NGVPQFFLKKNSVVVFRTGPWNGLRFTGMPNLKPNPIYRYEYVFTEEEVYYTYKLENPSV 256

Query:   277 PSRMVINPAGTVQRYTWMERTKTWTLFSRFSGVTLDQCDSYALCGAYASCNINSNSPECE 336
              +RM +NP G +QRYTW++  ++W  +   S + +D CD Y LCG+Y SCNIN  SP C 
Sbjct:   257 LTRMQLNPNGALQRYTWVDNLQSWNFY--LSAM-MDSCDQYTLCGSYGSCNINE-SPACR 312

Query:   337 CLQGFVPNSQREWDMQYKSGGCVRRTPLDCKHG-DGFLEHKAVKLPDTRFSWVDKNITLW 395
             CL+GFV  + + W     S GCVRR  LDC  G DGFL+   +KLPDTR SW DKN+ L 
Sbjct:   313 CLKGFVAKTPQAWVAGDWSEGCVRRVKLDCGKGEDGFLKISKLKLPDTRTSWYDKNMDLN 372

Query:   396 ECKELCSKNCSCTAYANADVRGRGSGCLLWFHDLIDIKELPESGQDLFIRMAASELDNVE 455
             ECK++C +NC+C+AY+  D+R  G GC+LWF DLIDI+E  E+GQDL++R+A+SE++ ++
Sbjct:   373 ECKKVCLRNCTCSAYSPFDIRDGGKGCILWFGDLIDIREYNENGQDLYVRLASSEIETLQ 432

Query:   456 RR--RQSKNKKQ 465
             R   R S  K++
Sbjct:   433 RESSRVSSRKQE 444


GO:0004672 "protein kinase activity" evidence=IEA;ISS
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0004713 "protein tyrosine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=IEA
GO:0048544 "recognition of pollen" evidence=IEA
GO:0048765 "root hair cell differentiation" evidence=RCA
TAIR|locus:2131694 AT4G27300 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141181 RK3 "receptor kinase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018546 RK1 "receptor kinase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018506 RK2 "receptor kinase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141176 B120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200908 AT1G61610 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2200151 SD1-13 "S-domain-1 13" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|O49974 KIK1 "Serine/threonine-protein kinase" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
TAIR|locus:2197729 SD1-29 "S-domain-1 29" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81832Y4729_ARATH2, ., 7, ., 1, 1, ., 10.55470.91460.8620yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.10.914
3rd Layer2.7.110.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.01340036
hypothetical protein (831 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query738
smart00221258 smart00221, STYKc, Protein kinase; unclassified sp 2e-52
smart00219257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 2e-51
cd00192262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-49
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-48
pfam07714258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 2e-47
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-46
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 9e-46
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-39
pfam00954110 pfam00954, S_locus_glycop, S-locus glycoprotein fa 2e-37
pfam01453109 pfam01453, B_lectin, D-mannose binding lectin 3e-37
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-34
cd00028116 cd00028, B_lectin, Bulb-type mannose-specific lect 4e-34
cd05048283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 1e-33
cd05034261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 2e-33
cd05038284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 3e-32
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 9e-32
smart00108114 smart00108, B_lectin, Bulb-type mannose-specific l 4e-31
cd05057279 cd05057, PTKc_EGFR_like, Catalytic domain of Epide 1e-30
cd05148261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 2e-30
cd05049280 cd05049, PTKc_Trk, Catalytic domain of the Protein 2e-30
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 3e-30
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 5e-30
cd05068261 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re 3e-29
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 7e-29
pfam0827666 pfam08276, PAN_2, PAN-like domain 7e-29
cd05044269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 8e-29
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 9e-29
cd05060257 cd05060, PTKc_Syk_like, Catalytic domain of Spleen 6e-28
cd05039256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 9e-28
cd05067260 cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro 1e-27
cd05091283 cd05091, PTKc_Ror2, Catalytic domain of the Protei 3e-27
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 6e-27
cd05036277 cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro 8e-27
cd05033266 cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec 9e-27
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 1e-26
cd05081284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 2e-26
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 3e-26
cd05112256 cd05112, PTKc_Itk, Catalytic domain of the Protein 6e-26
cd05072261 cd05072, PTKc_Lyn, Catalytic domain of the Protein 7e-26
cd05046275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 2e-25
cd05059256 cd05059, PTKc_Tec_like, Catalytic domain of Tec-li 4e-25
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 5e-25
cd05052263 cd05052, PTKc_Abl, Catalytic domain of the Protein 7e-25
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 2e-24
cd05070260 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro 3e-24
cd05090283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 6e-24
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 9e-24
cd05040257 cd05040, PTKc_Ack_like, Catalytic domain of the Pr 1e-23
cd05045290 cd05045, PTKc_RET, Catalytic domain of the Protein 2e-23
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 2e-23
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 2e-23
cd0109884 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain 2e-23
cd05071262 cd05071, PTKc_Src, Catalytic domain of the Protein 3e-23
cd05092280 cd05092, PTKc_TrkA, Catalytic domain of the Protei 3e-23
cd07840287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 6e-23
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-23
cd05110303 cd05110, PTKc_HER4, Catalytic domain of the Protei 1e-22
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 1e-22
cd05080283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-22
cd05053293 cd05053, PTKc_FGFR, Catalytic domain of the Protei 2e-22
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 2e-22
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 2e-22
cd05063268 cd05063, PTKc_EphR_A2, Catalytic domain of the Pro 4e-22
cd08224267 cd08224, STKc_Nek6_Nek7, Catalytic domain of the P 5e-22
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 7e-22
cd05035273 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li 1e-21
cd05032277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 1e-21
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 2e-21
cd05099314 cd05099, PTKc_FGFR4, Catalytic domain of the Prote 2e-21
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 2e-21
cd05069260 cd05069, PTKc_Yes, Catalytic domain of the Protein 2e-21
cd05073260 cd05073, PTKc_Hck, Catalytic domain of the Protein 3e-21
cd05093288 cd05093, PTKc_TrkB, Catalytic domain of the Protei 4e-21
cd05097295 cd05097, PTKc_DDR_like, Catalytic domain of Discoi 4e-21
cd06655296 cd06655, STKc_PAK2, Catalytic domain of the Protei 4e-21
cd05050288 cd05050, PTKc_Musk, Catalytic domain of the Protei 4e-21
cd05094291 cd05094, PTKc_TrkC, Catalytic domain of the Protei 7e-21
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 7e-21
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 9e-21
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 1e-20
cd05113256 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro 1e-20
cd06629272 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o 1e-20
cd05085250 cd05085, PTKc_Fer, Catalytic domain of the Protein 1e-20
cd06647293 cd06647, STKc_PAK_I, Catalytic domain of the Prote 2e-20
cd05051296 cd05051, PTKc_DDR, Catalytic domain of the Protein 2e-20
cd05055302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 3e-20
cd05108316 cd05108, PTKc_EGFR, Catalytic domain of the Protei 3e-20
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 4e-20
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 5e-20
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 5e-20
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 6e-20
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 9e-20
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 9e-20
cd06656297 cd06656, STKc_PAK3, Catalytic domain of the Protei 9e-20
cd05083254 cd05083, PTKc_Chk, Catalytic domain of the Protein 1e-19
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 1e-19
cd05608280 cd05608, STKc_GRK1, Catalytic domain of the Protei 1e-19
cd05058262 cd05058, PTKc_Met_Ron, Catalytic domain of the Pro 2e-19
cd05109279 cd05109, PTKc_HER2, Catalytic domain of the Protei 2e-19
cd06654296 cd06654, STKc_PAK1, Catalytic domain of the Protei 2e-19
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 2e-19
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 2e-19
cd07835283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 3e-19
cd05088303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 3e-19
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 4e-19
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 5e-19
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 5e-19
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 5e-19
cd06641277 cd06641, STKc_MST3, Catalytic domain of the Protei 5e-19
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 5e-19
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 6e-19
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 1e-18
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 1e-18
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-18
cd05607277 cd05607, STKc_GRK7, Catalytic domain of the Protei 2e-18
cd05079284 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma 2e-18
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 2e-18
cd05065269 cd05065, PTKc_EphR_B, Catalytic domain of the Prot 2e-18
cd05096304 cd05096, PTKc_DDR1, Catalytic domain of the Protei 3e-18
cd05066267 cd05066, PTKc_EphR_A, Catalytic domain of the Prot 3e-18
cd07860284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 3e-18
cd06651266 cd06651, STKc_MEKK3, Catalytic domain of the Prote 4e-18
PLN00009294 PLN00009, PLN00009, cyclin-dependent kinase A; Pro 4e-18
cd05095296 cd05095, PTKc_DDR2, Catalytic domain of the Protei 4e-18
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 4e-18
cd05075272 cd05075, PTKc_Axl, Catalytic domain of the Protein 6e-18
cd05089297 cd05089, PTKc_Tie1, Catalytic domain of the Protei 7e-18
cd06635317 cd06635, STKc_TAO1, Catalytic domain of the Protei 7e-18
cd05111279 cd05111, PTK_HER3, Pseudokinase domain of the Prot 7e-18
cd06634308 cd06634, STKc_TAO2, Catalytic domain of the Protei 7e-18
cd05082256 cd05082, PTKc_Csk, Catalytic domain of the Protein 7e-18
cd08228267 cd08228, STKc_Nek6, Catalytic domain of the Protei 1e-17
cd06644292 cd06644, STKc_STK10_LOK, Catalytic domain of the P 1e-17
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 1e-17
cd05100334 cd05100, PTKc_FGFR3, Catalytic domain of the Prote 2e-17
cd08220256 cd08220, STKc_Nek8, Catalytic domain of the Protei 2e-17
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 2e-17
cd05047270 cd05047, PTKc_Tie, Catalytic domain of Tie Protein 2e-17
cd08222260 cd08222, STKc_Nek11, Catalytic domain of the Prote 2e-17
cd05101304 cd05101, PTKc_FGFR2, Catalytic domain of the Prote 3e-17
cd06607307 cd06607, STKc_TAO, Catalytic domain of the Protein 3e-17
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 3e-17
cd06652265 cd06652, STKc_MEKK2, Catalytic domain of the Prote 4e-17
cd08225257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-17
cd06636282 cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr 4e-17
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 5e-17
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 6e-17
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 6e-17
cd05043280 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece 6e-17
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 8e-17
cd05062277 cd05062, PTKc_IGF-1R, Catalytic domain of the Prot 8e-17
cd06645267 cd06645, STKc_MAP4K3, Catalytic domain of the Prot 9e-17
cd06616288 cd06616, PKc_MKK4, Catalytic domain of the dual-sp 9e-17
cd06633313 cd06633, STKc_TAO3, Catalytic domain of the Protei 1e-16
cd05098307 cd05098, PTKc_FGFR1, Catalytic domain of the Prote 1e-16
cd05115257 cd05115, PTKc_Zap-70, Catalytic domain of the Prot 1e-16
cd06653264 cd06653, STKc_MEKK3_like_1, Catalytic domain of MA 2e-16
cd07843293 cd07843, STKc_CDC2L1, Catalytic domain of the Seri 2e-16
cd07845309 cd07845, STKc_CDK10, Catalytic domain of the Serin 2e-16
cd05056270 cd05056, PTKc_FAK, Catalytic domain of the Protein 4e-16
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 5e-16
cd08229267 cd08229, STKc_Nek7, Catalytic domain of the Protei 5e-16
cd07839284 cd07839, STKc_CDK5, Catalytic domain of the Serine 6e-16
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 6e-16
cd06643282 cd06643, STKc_SLK, Catalytic domain of the Protein 6e-16
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 9e-16
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 9e-16
cd05084252 cd05084, PTKc_Fes, Catalytic domain of the Protein 1e-15
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 1e-15
cd05570 318 cd05570, STKc_PKC, Catalytic domain of the Protein 1e-15
cd05631285 cd05631, STKc_GRK4, Catalytic domain of the Protei 1e-15
cd06646267 cd06646, STKc_MAP4K5, Catalytic domain of the Prot 1e-15
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-15
cd05064266 cd05064, PTKc_EphR_A10, Catalytic domain of the Pr 4e-15
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-15
cd05061288 cd05061, PTKc_InsR, Catalytic domain of the Protei 5e-15
cd05116257 cd05116, PTKc_Syk, Catalytic domain of the Protein 5e-15
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 8e-15
cd08528269 cd08528, STKc_Nek10, Catalytic domain of the Prote 8e-15
cd07833288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 8e-15
cd07862290 cd07862, STKc_CDK6, Catalytic domain of the Serine 9e-15
cd07865310 cd07865, STKc_CDK9, Catalytic domain of the Serine 1e-14
cd05590 320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 1e-14
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 2e-14
cd07846286 cd07846, STKc_CDKL2_3, Catalytic domain of the Ser 2e-14
cd07873301 cd07873, STKc_PCTAIRE1, Catalytic domain of the Se 5e-14
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 5e-14
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 5e-14
cd05074273 cd05074, PTKc_Tyro3, Catalytic domain of the Prote 6e-14
cd07869303 cd07869, STKc_PFTAIRE1, Catalytic domain of the Se 7e-14
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 7e-14
cd05589 324 cd05589, STKc_PKN, Catalytic domain of the Protein 7e-14
cd05592 316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 9e-14
PHA03209357 PHA03209, PHA03209, serine/threonine kinase US3; P 1e-13
PTZ00024335 PTZ00024, PTZ00024, cyclin-dependent protein kinas 1e-13
cd07852 337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 1e-13
cd07870291 cd07870, STKc_PFTAIRE2, Catalytic domain of the Se 1e-13
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-13
cd07863288 cd07863, STKc_CDK4, Catalytic domain of the Serine 1e-13
cd05619 316 cd05619, STKc_nPKC_theta, Catalytic domain of the 3e-13
cd07872309 cd07872, STKc_PCTAIRE2, Catalytic domain of the Se 3e-13
cd07842316 cd07842, STKc_CDK8_like, Catalytic domain of Cycli 3e-13
cd06619279 cd06619, PKc_MKK5, Catalytic domain of the dual-sp 5e-13
cd05582 318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 6e-13
cd07856 328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 8e-13
cd07849 336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 9e-13
cd07875 364 cd07875, STKc_JNK1, Catalytic domain of the Serine 9e-13
cd06639291 cd06639, STKc_myosinIIIB, Catalytic domain of the 1e-12
cd05620 316 cd05620, STKc_nPKC_delta, Catalytic domain of the 1e-12
cd08223257 cd08223, STKc_Nek4, Catalytic domain of the Protei 1e-12
cd07850 353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 1e-12
cd05054337 cd05054, PTKc_VEGFR, Catalytic domain of the Prote 2e-12
cd05593 328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-12
cd07876 359 cd07876, STKc_JNK2, Catalytic domain of the Serine 3e-12
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 3e-12
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 4e-12
TIGR03903 1266 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas 4e-12
cd07848287 cd07848, STKc_CDKL5, Catalytic domain of the Serin 4e-12
cd05595 323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 6e-12
cd07880 343 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of 8e-12
cd07871288 cd07871, STKc_PCTAIRE3, Catalytic domain of the Se 8e-12
cd05587 324 cd05587, STKc_cPKC, Catalytic domain of the Protei 1e-11
cd07847286 cd07847, STKc_CDKL1_4, Catalytic domain of the Ser 1e-11
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 1e-11
cd05616 323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 1e-11
cd07877 345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 1e-11
cd05591 321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 1e-11
cd05042269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 1e-11
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 2e-11
cd07844291 cd07844, STKc_PCTAIRE_like, Catalytic domain of PC 2e-11
cd05594 325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 2e-11
cd05102338 cd05102, PTKc_VEGFR3, Catalytic domain of the Prot 3e-11
cd07853 372 cd07853, STKc_NLK, Catalytic domain of the Serine/ 4e-11
cd05615 323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 4e-11
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 4e-11
cd07874 355 cd07874, STKc_JNK3, Catalytic domain of the Serine 4e-11
cd05601 330 cd05601, STKc_CRIK, Catalytic domain of the Protei 5e-11
PTZ00036 440 PTZ00036, PTZ00036, glycogen synthase kinase; Prov 5e-11
cd05103343 cd05103, PTKc_VEGFR2, Catalytic domain of the Prot 7e-11
cd05037259 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) dom 8e-11
cd07878 343 cd07878, STKc_p38beta_MAPK11, Catalytic domain of 9e-11
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-11
cd05106374 cd05106, PTKc_CSF-1R, Catalytic domain of the Prot 9e-11
cd06649 331 cd06649, PKc_MEK2, Catalytic domain of the dual-sp 1e-10
cd07879 342 cd07879, STKc_p38delta_MAPK13, Catalytic domain of 1e-10
cd05087269 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t 1e-10
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 2e-10
cd05571 323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-10
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 2e-10
cd06650 333 cd06650, PKc_MEK1, Catalytic domain of the dual-sp 2e-10
cd05105400 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the 3e-10
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 3e-10
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 6e-10
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 6e-10
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 8e-10
cd05078258 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1e-09
smart0047378 smart00473, PAN_AP, divergent subfamily of APPLE d 2e-09
cd05586 330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-09
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 3e-09
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 3e-09
cd05618 329 cd05618, STKc_aPKC_iota, Catalytic domain of the P 4e-09
cd07867317 cd07867, STKc_CDC2L6, Catalytic domain of Serine/T 5e-09
cd06638286 cd06638, STKc_myosinIIIA, Catalytic domain of the 6e-09
cd05575 323 cd05575, STKc_SGK, Catalytic domain of the Protein 7e-09
cd05104375 cd05104, PTKc_Kit, Catalytic domain of the Protein 1e-08
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 1e-08
cd05614 332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 1e-08
cd05584 323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 2e-08
cd05107401 cd05107, PTKc_PDGFR_beta, Catalytic domain of the 2e-08
PTZ00283 496 PTZ00283, PTZ00283, serine/threonine protein kinas 2e-08
cd05604 325 cd05604, STKc_SGK3, Catalytic domain of the Protei 2e-08
cd05617 327 cd05617, STKc_aPKC_zeta, Catalytic domain of the P 2e-08
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 3e-08
PHA03210 501 PHA03210, PHA03210, serine/threonine kinase US3; P 4e-08
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 5e-08
cd07868317 cd07868, STKc_CDK8, Catalytic domain of the Serine 6e-08
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 8e-08
cd05585 312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-07
cd05588 329 cd05588, STKc_aPKC, Catalytic domain of the Protei 1e-07
cd07857 332 cd07857, STKc_MPK1, Catalytic domain of the Serine 2e-07
cd05621 370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 2e-07
cd05603 321 cd05603, STKc_SGK2, Catalytic domain of the Protei 2e-07
PTZ00426340 PTZ00426, PTZ00426, cAMP-dependent protein kinase 3e-07
cd05602 325 cd05602, STKc_SGK1, Catalytic domain of the Protei 3e-07
PHA03212391 PHA03212, PHA03212, serine/threonine kinase US3; P 4e-07
cd05596 370 cd05596, STKc_ROCK, Catalytic domain of the Protei 7e-07
PHA03207392 PHA03207, PHA03207, serine/threonine kinase US3; P 7e-07
cd05624 331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 1e-06
cd05086268 cd05086, PTKc_Aatyk2, Catalytic domain of the Prot 2e-06
cd07859 338 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of 2e-06
PTZ00267 478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 3e-06
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 4e-06
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 6e-06
cd05120155 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphot 7e-06
cd0012980 cd00129, PAN_APPLE, PAN/APPLE-like domain; present 1e-05
cd05610 669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-05
cd05622 371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 1e-05
cd05597 331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 2e-05
cd08216314 cd08216, PK_STRAD, Pseudokinase domain of STE20-re 2e-05
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 2e-05
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 3e-05
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 4e-05
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 4e-05
PTZ00284 467 PTZ00284, PTZ00284, protein kinase; Provisional 6e-05
cd05623 332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 2e-04
PHA02988283 PHA02988, PHA02988, hypothetical protein; Provisio 3e-04
cd08226 328 cd08226, PK_STRAD_beta, Pseudokinase domain of STE 4e-04
PLN03225 566 PLN03225, PLN03225, Serine/threonine-protein kinas 8e-04
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 0.001
PHA03211461 PHA03211, PHA03211, serine/threonine kinase US3; P 0.002
cd05076274 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) do 0.004
cd05626 381 cd05626, STKc_LATS2, Catalytic domain of the Prote 0.004
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
 Score =  181 bits (463), Expect = 2e-52
 Identities = 84/200 (42%), Positives = 111/200 (55%), Gaps = 17/200 (8%)

Query: 524 KLGEGGFGPVYKGMLI-----EGQEIAVKRLSKG-SGQGMEEFKNEVLLIAKLQHRNLVK 577
           KLGEG FG VYKG L      +  E+AVK L +  S Q +EEF  E  ++ KL H N+VK
Sbjct: 6   KLGEGAFGEVYKGTLKGKGDGKEVEVAVKTLKEDASEQQIEEFLREARIMRKLDHPNIVK 65

Query: 578 LLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSR 637
           LLG CT+ +  M++ EY+P   L  ++    R K L  S        IARG+ YL     
Sbjct: 66  LLGVCTEEEPLMIVMEYMPGGDLLDYLRK-NRPKELSLSDLLSFALQIARGMEYLE---S 121

Query: 638 LRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGT---YGYMSPEYAI 694
              IHRDL A N L+   +  KISDFGL+R    D  + +  +V G      +M+PE   
Sbjct: 122 KNFIHRDLAARNCLVGENLVVKISDFGLSR----DLYDDDYYKVKGGKLPIRWMAPESLK 177

Query: 695 DGLFSVKSDVFSFGVLVLEI 714
           +G F+ KSDV+SFGVL+ EI
Sbjct: 178 EGKFTSKSDVWSFGVLLWEI 197


Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase. Length = 258

>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|201524 pfam00954, S_locus_glycop, S-locus glycoprotein family Back     alignment and domain information
>gnl|CDD|216511 pfam01453, B_lectin, D-mannose binding lectin Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|237995 cd00028, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214519 smart00108, B_lectin, Bulb-type mannose-specific lectin Back     alignment and domain information
>gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219774 pfam08276, PAN_2, PAN-like domain Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|238531 cd01098, PAN_AP_plant, Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins Back     alignment and domain information
>gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>gnl|CDD|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional Back     alignment and domain information
>gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>gnl|CDD|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>gnl|CDD|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>gnl|CDD|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>gnl|CDD|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>gnl|CDD|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein Back     alignment and domain information
>gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional Back     alignment and domain information
>gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>gnl|CDD|173627 cd05037, PTK_Jak_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>gnl|CDD|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|214680 smart00473, PAN_AP, divergent subfamily of APPLE domains Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240159 cd05120, APH_ChoK_like, Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>gnl|CDD|238074 cd00129, PAN_APPLE, PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|140307 PTZ00284, PTZ00284, protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|165291 PHA02988, PHA02988, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional Back     alignment and domain information
>gnl|CDD|133207 cd05076, PTK_Tyk2_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 738
KOG1187361 consensus Serine/threonine protein kinase [Signal 100.0
KOG0595 429 consensus Serine/threonine-protein kinase involved 100.0
KOG0598 357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0575 592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0591 375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0197468 consensus Tyrosine kinases [Signal transduction me 100.0
KOG0593 396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0600 560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0592 604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0605 550 consensus NDR and related serine/threonine kinases 100.0
KOG1026774 consensus Nerve growth factor receptor TRKA and re 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0583 370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 100.0
KOG0694 694 consensus Serine/threonine protein kinase [Signal 100.0
KOG3653534 consensus Transforming growth factor beta/activin 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
KOG0663 419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0582 516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0661 538 consensus MAPK related serine/threonine protein ki 100.0
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
KOG0611 668 consensus Predicted serine/threonine protein kinas 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0585 576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 100.0
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 100.0
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
KOG0658 364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
PTZ00267 478 NIMA-related protein kinase; Provisional 100.0
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.98
KOG0201 467 consensus Serine/threonine protein kinase [Signal 99.98
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.98
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.98
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.98
KOG0660 359 consensus Mitogen-activated protein kinase [Signal 99.98
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.98
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.98
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.98
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.98
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.98
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.98
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.98
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.98
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.98
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.98
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.98
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.98
PHA02988283 hypothetical protein; Provisional 99.98
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.98
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.98
KOG1095 1025 consensus Protein tyrosine kinase [Signal transduc 99.98
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
KOG0610 459 consensus Putative serine/threonine protein kinase 99.97
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
KOG0032 382 consensus Ca2+/calmodulin-dependent protein kinase 99.97
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.97
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
PTZ00283 496 serine/threonine protein kinase; Provisional 99.97
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.97
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
KOG0589 426 consensus Serine/threonine protein kinase [General 99.97
PHA03212391 serine/threonine kinase US3; Provisional 99.97
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
KOG4250 732 consensus TANK binding protein kinase TBK1 [Signal 99.97
KOG0196 996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.97
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
KOG0033 355 consensus Ca2+/calmodulin-dependent protein kinase 99.97
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.97
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.97
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.97
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.97
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.97
KOG0599 411 consensus Phosphorylase kinase gamma subunit [Carb 99.97
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.97
KOG0667 586 consensus Dual-specificity tyrosine-phosphorylatio 99.97
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.97
KOG1989 738 consensus ARK protein kinase family [Signal transd 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
KOG4279 1226 consensus Serine/threonine protein kinase [Signal 99.97
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.97
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.97
PTZ00036 440 glycogen synthase kinase; Provisional 99.97
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.97
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.97
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.97
KOG0574 502 consensus STE20-like serine/threonine kinase MST [ 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
PHA03211461 serine/threonine kinase US3; Provisional 99.97
KOG0690 516 consensus Serine/threonine protein kinase [Signal 99.97
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
KOG4236 888 consensus Serine/threonine protein kinase PKC mu/P 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
KOG0986 591 consensus G protein-coupled receptor kinase [Signa 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.97
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.97
KOG0607 463 consensus MAP kinase-interacting kinase and relate 99.97
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.97
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.97
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
PTZ00284 467 protein kinase; Provisional 99.97
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.97
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.97
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.97
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.97
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.97
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.97
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.97
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.97
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.97
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.97
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.97
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.97
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.97
KOG0577 948 consensus Serine/threonine protein kinase [Signal 99.97
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.97
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.97
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.97
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.97
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.97
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.97
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.97
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.97
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.97
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.97
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.97
KOG0586 596 consensus Serine/threonine protein kinase [General 99.97
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.97
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.96
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.96
KOG0584 632 consensus Serine/threonine protein kinase [General 99.96
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.96
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
PHA03209357 serine/threonine kinase US3; Provisional 99.96
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.96
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.96
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.96
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.96
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.96
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.96
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
KOG0666 438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.96
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.96
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 99.96
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.96
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.96
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.96
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.96
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.96
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.96
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.96
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.96
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.96
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
KOG1025 1177 consensus Epidermal growth factor receptor EGFR an 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
KOG0696 683 consensus Serine/threonine protein kinase [Signal 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.96
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.96
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.96
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.96
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.96
KOG4257 974 consensus Focal adhesion tyrosine kinase FAK, cont 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.96
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.96
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.96
PHA03210 501 serine/threonine kinase US3; Provisional 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.96
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.96
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.96
KOG0596677 consensus Dual specificity; serine/threonine and t 99.96
PLN00009294 cyclin-dependent kinase A; Provisional 99.96
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.96
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.96
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.96
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.96
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.96
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.96
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.96
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.95
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.95
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.95
PHA02882294 putative serine/threonine kinase; Provisional 99.95
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 99.95
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.95
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.95
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.95
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.95
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.95
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.95
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.95
KOG0608 1034 consensus Warts/lats-like serine threonine kinases 99.95
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.95
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.95
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.95
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.95
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.95
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.95
PF00954110 S_locus_glycop: S-locus glycoprotein family; Inter 99.95
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.95
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.95
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.95
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.95
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.95
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.95
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.95
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.95
KOG0604 400 consensus MAP kinase-activated protein kinase 2 [S 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 99.94
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.94
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 99.94
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.94
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.94
PLN03224507 probable serine/threonine protein kinase; Provisio 99.94
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.94
KOG0695 593 consensus Serine/threonine protein kinase [Signal 99.94
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 99.94
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.94
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.93
KOG1152772 consensus Signal transduction serine/threonine kin 99.93
KOG0669 376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.93
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.93
KOG0664 449 consensus Nemo-like MAPK-related serine/threonine 99.93
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.92
PLN03225 566 Serine/threonine-protein kinase SNT7; Provisional 99.92
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.92
smart00108114 B_lectin Bulb-type mannose-specific lectin. 99.92
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.91
KOG1027 903 consensus Serine/threonine protein kinase and endo 99.91
KOG0665 369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.89
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.89
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.89
KOG1167 418 consensus Serine/threonine protein kinase of the C 99.89
KOG1345 378 consensus Serine/threonine kinase [Signal transduc 99.88
KOG1290 590 consensus Serine/threonine protein kinase [Signal 99.87
PRK09188 365 serine/threonine protein kinase; Provisional 99.87
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.87
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.84
COG0515 384 SPS1 Serine/threonine protein kinase [General func 99.82
PLN00181 793 protein SPA1-RELATED; Provisional 99.82
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.81
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.79
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.79
KOG1163 341 consensus Casein kinase (serine/threonine/tyrosine 99.78
KOG1165 449 consensus Casein kinase (serine/threonine/tyrosine 99.76
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.76
PRK12274218 serine/threonine protein kinase; Provisional 99.74
PRK10345210 hypothetical protein; Provisional 99.73
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.72
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.7
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.69
smart00090237 RIO RIO-like kinase. 99.68
PRK14879211 serine/threonine protein kinase; Provisional 99.68
KOG0603 612 consensus Ribosomal protein S6 kinase [Signal tran 99.66
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.66
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.66
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.65
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.64
PF0827666 PAN_2: PAN-like domain; InterPro: IPR013227 PAN do 99.62
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.6
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.57
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.56
KOG1023 484 consensus Natriuretic peptide receptor, guanylate 99.5
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.5
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.5
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.49
KOG4158 598 consensus BRPK/PTEN-induced protein kinase [Signal 99.43
cd0012980 PAN_APPLE PAN/APPLE-like domain; present in N-term 99.4
KOG0590 601 consensus Checkpoint kinase and related serine/thr 99.39
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.39
cd0109884 PAN_AP_plant Plant PAN/APPLE-like domain; present 99.27
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.24
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 99.18
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 99.1
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 99.08
KOG1243 690 consensus Protein kinase [General function predict 99.07
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 99.06
KOG3087229 consensus Serine/threonine protein kinase [General 99.02
KOG1266 458 consensus Protein kinase [Signal transduction mech 99.01
KOG0601 524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.86
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 98.76
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.75
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 98.72
KOG0606 1205 consensus Microtubule-associated serine/threonine 98.71
KOG3741 655 consensus Poly(A) ribonuclease subunit [RNA proces 98.7
COG0661 517 AarF Predicted unusual protein kinase [General fun 98.48
smart00108114 B_lectin Bulb-type mannose-specific lectin. 98.46
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 98.46
COG0478304 RIO-like serine/threonine protein kinase fused to 98.45
COG4248 637 Uncharacterized protein with protein kinase and he 98.44
cd00028116 B_lectin Bulb-type mannose-specific lectin. The do 98.4
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 98.32
PRK09902216 hypothetical protein; Provisional 98.29
smart0047378 PAN_AP divergent subfamily of APPLE domains. Apple 98.25
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 98.1
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 98.06
COG1718268 RIO1 Serine/threonine protein kinase involved in c 98.01
KOG1235 538 consensus Predicted unusual protein kinase [Genera 98.01
KOG0576 829 consensus Mitogen-activated protein kinase kinase 98.01
PF01636239 APH: Phosphotransferase enzyme family This family 97.99
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 97.94
KOG2137 700 consensus Protein kinase [Signal transduction mech 97.82
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.8
PF01453114 B_lectin: D-mannose binding lectin; InterPro: IPR0 97.75
PLN02876 822 acyl-CoA dehydrogenase 97.72
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 97.72
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 97.67
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 97.62
PRK10593297 hypothetical protein; Provisional 97.61
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 97.58
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 97.55
PRK09550 401 mtnK methylthioribose kinase; Reviewed 97.4
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 97.29
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 97.27
PLN02236344 choline kinase 96.82
PRK05231319 homoserine kinase; Provisional 96.71
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 96.71
COG3173321 Predicted aminoglycoside phosphotransferase [Gener 96.62
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 96.38
cd0110073 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like d 96.32
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 96.28
KOG2268 465 consensus Serine/threonine protein kinase [Signal 96.23
TIGR01767 370 MTRK 5-methylthioribose kinase. This enzyme is inv 96.23
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 96.1
PRK12396 409 5-methylribose kinase; Reviewed 95.97
PLN02756 418 S-methyl-5-thioribose kinase 95.89
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 95.87
PLN02421330 phosphotransferase, alcohol group as acceptor/kina 95.86
KOG2270 520 consensus Serine/threonine protein kinase involved 95.82
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=8.9e-45  Score=390.08  Aligned_cols=230  Identities=48%  Similarity=0.808  Sum_probs=201.1

Q ss_pred             ccCccCHHHHHHhcCCCCccceecccccEeEEEeeeccccEEEEEEccCCCCcchHHHHHHHHHHhHhcCCCeeeEEeEE
Q 004674          503 ELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCC  582 (738)
Q Consensus       503 ~~~~~~~~~l~~~~~~~~~~~~LG~G~fG~Vykg~~~~g~~vavK~l~~~~~~~~~~~~~Ei~il~~l~H~nIv~l~g~~  582 (738)
                      ....|++.++..+|++|+..+.||+|+||.||+|.+.++..||||++.....+..++|.+|+.++.+++|||+|+|+|||
T Consensus        61 ~~~~fs~~el~~AT~~Fs~~~~ig~Ggfg~VYkG~l~~~~~vAVK~~~~~~~~~~~eF~~Ei~~ls~l~H~Nlv~LlGyC  140 (361)
T KOG1187|consen   61 PLRSFSYDELRKATNNFSESNLIGEGGFGTVYKGVLSDGTVVAVKRLSSNSGQGEREFLNEVEILSRLRHPNLVKLLGYC  140 (361)
T ss_pred             CcceeeHHHHHHHHhCCchhcceecCCCeEEEEEEECCCCEEEEEEecCCCCcchhHHHHHHHHHhcCCCcCcccEEEEE
Confidence            45679999999999999999999999999999999999999999988765443156699999999999999999999999


Q ss_pred             ecCC-cceEEEeeCCCCChhHHHhhcCCCCCCCHHHHHHHHHHHHHHHHHHHhCCCCCeEeCCCCCCcEEEcCCCceEEE
Q 004674          583 TQRD-ERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKIS  661 (738)
Q Consensus       583 ~~~~-~~~lV~Ey~~~gsL~~~l~~~~~~~~l~~~~~~~i~~~ia~gL~yLH~~~~~~ivH~DLkp~NILl~~~~~vkL~  661 (738)
                      .+.+ +++||||||++|+|.++++..... +++|.+|++||.++|+||+|||+...++||||||||+|||||+++++||+
T Consensus       141 ~e~~~~~~LVYEym~nGsL~d~L~~~~~~-~L~W~~R~kIa~g~A~gL~yLH~~~~~~iiHrDiKssNILLD~~~~aKls  219 (361)
T KOG1187|consen  141 LEGGEHRLLVYEYMPNGSLEDHLHGKKGE-PLDWETRLKIALGAARGLAYLHEGCPPPIIHRDIKSSNILLDEDFNAKLS  219 (361)
T ss_pred             ecCCceEEEEEEccCCCCHHHHhCCCCCC-CCCHHHHHHHHHHHHHHHHHHccCCCCCEecCCCCHHHeeECCCCCEEcc
Confidence            9999 599999999999999999875444 89999999999999999999999988899999999999999999999999


Q ss_pred             eecCccccCCCccccccccc-ccccCccchhcccCCCCCchhHHHHHHHHHHHHHcCCCCCCCCCCCCCCccccc
Q 004674          662 DFGLARSFGLDQTEANTKRV-VGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHADHDHNLLGH  735 (738)
Q Consensus       662 DFGla~~~~~~~~~~~~~~~-~gt~~y~aPE~~~~~~~t~ksDVwS~Gvil~elltG~~p~~~~~~~~~~~l~~~  735 (738)
                      |||+|+.....  ....... .||.+|+|||++..+..+.|+|||||||+|+||++|+++.+...+....+++.+
T Consensus       220 DFGLa~~~~~~--~~~~~~~~~gt~gY~~PEy~~~g~lt~KsDVySFGVvllElitgr~~~d~~~~~~~~~l~~w  292 (361)
T KOG1187|consen  220 DFGLAKLGPEG--DTSVSTTVMGTFGYLAPEYASTGKLTEKSDVYSFGVVLLELITGRKAVDQSRPRGELSLVEW  292 (361)
T ss_pred             CccCcccCCcc--ccceeeecCCCCccCChhhhccCCcCcccccccchHHHHHHHhCCcccCCCCCcccccHHHH
Confidence            99999654321  1111112 799999999999999999999999999999999999999887654444455544



>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>PF00954 S_locus_glycop: S-locus glycoprotein family; InterPro: IPR000858 In Brassicaceae, self-incompatible plants have a self/non-self recognition system, which involves the inability of flowering plants to achieve self-fertilisation Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PF08276 PAN_2: PAN-like domain; InterPro: IPR013227 PAN domains have significant functional versatility fulfilling diverse biological functions by mediating protein-protein or protein-carbohydrate interactions [] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00129 PAN_APPLE PAN/APPLE-like domain; present in N-terminal (N) domains of plasminogen/ hepatocyte growth factor proteins, plasma prekallikrein/coagulation factor XI and microneme antigen proteins, plant receptor-like protein kinases, and various nematode and leech anti-platelet proteins Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>cd01098 PAN_AP_plant Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>smart00108 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>cd00028 B_lectin Bulb-type mannose-specific lectin Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>smart00473 PAN_AP divergent subfamily of APPLE domains Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1235 consensus Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PF01453 B_lectin: D-mannose binding lectin; InterPro: IPR001480 A bulb lectin super-family (Amaryllidaceae, Orchidaceae and Aliaceae) contains a ~115-residue-long domain whose overall three dimensional fold is very similar to that of [, ]: Dictyostelium discoideum comitin, an actin binding protein Curculigo latifolia curculin, a sweet tasting and taste-modifying protein This domain generally binds mannose, but in at least one protein, curculin, it is apparently devoid of mannose-binding activity Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>cd01100 APPLE_Factor_XI_like Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>PLN02421 phosphotransferase, alcohol group as acceptor/kinase Back     alignment and domain information
>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query738
3tl8_A349 The Avrptob-Bak1 Complex Reveals Two Structurally S 2e-44
3uim_A326 Structural Basis For The Impact Of Phosphorylation 3e-43
2qkw_B321 Structural Basis For Activation Of Plant Immunity B 3e-40
3hgk_A327 Crystal Structure Of Effect Protein Avrptob Complex 8e-40
2nry_A307 Crystal Structure Of Irak-4 Length = 307 5e-38
2nru_A307 Crystal Structure Of Irak-4 Length = 307 5e-38
2oib_A301 Crystal Structure Of Irak4 Kinase Domain Apo Form L 6e-38
2o8y_A298 Apo Irak4 Kinase Domain Length = 298 3e-36
4gt4_A308 Structure Of Unliganded, Inactive Ror2 Kinase Domai 1e-24
3p86_A309 Crystal Structure Of Ctr1 Kinase Domain Mutant D676 3e-24
3ppz_A309 Crystal Structure Of Ctr1 Kinase Domain In Complex 5e-24
3zzw_A289 Crystal Structure Of The Kinase Domain Of Ror2 Leng 6e-24
3kxz_A287 The Complex Crystal Structure Of Lck With A Probe M 6e-23
3lck_A271 The Kinase Domain Of Human Lymphocyte Kinase (Lck), 7e-23
1qpe_A279 Structural Analysis Of The Lymphocyte-Specific Kina 7e-23
3kmm_A288 Structure Of Human Lck Kinase With A Small Molecule 8e-23
2zm1_A285 Crystal Structure Of Imidazo Pyrazin 1 Bound To The 8e-23
3bym_A272 X-Ray Co-Crystal Structure Aminobenzimidazole Triaz 8e-23
2ofu_A273 X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam 8e-23
3dtc_A271 Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp 9e-23
2pl0_A289 Lck Bound To Imatinib Length = 289 9e-23
3bys_A277 Co-Crystal Structure Of Lck And Aminopyrimidine Ami 1e-22
2ofv_A277 Crystal Structure Of Aminoquinazoline 1 Bound To Lc 1e-22
2of2_A271 Crystal Structure Of Furanopyrimidine 8 Bound To Lc 1e-22
2og8_A265 Crystal Structure Of Aminoquinazoline 36 Bound To L 3e-22
3a4o_X286 Lyn Kinase Domain Length = 286 1e-21
3mpm_A267 Lck Complexed With A Pyrazolopyrimidine Length = 26 1e-21
1qpd_A279 Structural Analysis Of The Lymphocyte-specific Kina 2e-21
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-21
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 3e-21
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 3e-21
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 5e-21
2zv7_A279 Lyn Tyrosine Kinase Domain, Apo Form Length = 279 9e-21
1yi6_A276 C-Term Tail Segment Of Human Tyrosine Kinase (258-5 2e-20
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 2e-20
2r4b_A321 Erbb4 Kinase Domain Complexed With A Thienopyrimidi 3e-20
1yol_A283 Crystal Structure Of Src Kinase Domain In Complex W 3e-20
3dqw_A286 C-Src Kinase Domain Thr338ile Mutant In Complex Wit 3e-20
1yoj_A283 Crystal Structure Of Src Kinase Domain Length = 283 3e-20
3bbt_B328 Crystal Structure Of The Erbb4 Kinase In Complex Wi 3e-20
2bdf_A279 Src Kinase In Complex With Inhibitor Ap23451 Length 4e-20
3g6h_A286 Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma 4e-20
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 4e-20
2dq7_X283 Crystal Structure Of Fyn Kinase Domain Complexed Wi 5e-20
2oiq_A286 Crystal Structure Of Chicken C-Src Kinase Domain In 5e-20
3svv_A286 Crystal Structure Of T338c C-Src Covalently Bound T 5e-20
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 7e-20
2hk5_A270 Hck Kinase In Complex With Lck Targetted Inhibitor 7e-20
2xa4_A298 Inhibitors Of Jak2 Kinase Domain Length = 298 7e-20
3geq_A286 Structural Basis For The Chemical Rescue Of Src Kin 8e-20
3oez_A286 Crystal Structure Of The L317i Mutant Of The Chicke 8e-20
3u4w_A275 Src In Complex With Dna-Templated Macrocyclic Inhib 1e-19
3d7u_B277 Structural Basis For The Recognition Of C-Src By It 1e-19
3e62_A293 Fragment Based Discovery Of Jak-2 Inhibitors Length 1e-19
4e4m_A302 Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 1e-19
2w1i_A326 Structure Determination Of Aurora Kinase In Complex 1e-19
2b7a_A293 The Structural Basis Of Janus Kinase 2 Inhibition B 1e-19
2qq7_A286 Crystal Structure Of Drug Resistant Src Kinase Doma 1e-19
4hge_A300 Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 1e-19
3q32_A301 Structure Of Janus Kinase 2 With A Pyrrolotriazine 1e-19
3tjc_A298 Co-Crystal Structure Of Jak2 With Thienopyridine 8 1e-19
3lpb_A295 Crystal Structure Of Jak2 Complexed With A Potent 2 1e-19
4aqc_A301 Triazolopyridine-Based Inhibitor Of Janus Kinase 2 1e-19
3rvg_A303 Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido 1e-19
2hwo_A286 Crystal Structure Of Src Kinase Domain In Complex W 1e-19
3jy9_A311 Janus Kinase 2 Inhibitors Length = 311 2e-19
3io7_A313 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel 2e-19
4f0f_A287 Crystal Structure Of The Roco4 Kinase Domain Bound 2e-19
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 3e-19
4e6d_A298 Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W 3e-19
3ugc_A295 Structural Basis Of Jak2 Inhibition By The Type Ii 4e-19
3gvu_A292 The Crystal Structure Of Human Abl2 In Complex With 5e-19
4asz_A299 Crystal Structure Of Apo Trkb Kinase Domain Length 6e-19
4f1o_A287 Crystal Structure Of The L1180t Mutant Roco4 Kinase 8e-19
4bbe_A298 Aminoalkylpyrimidine Inhibitor Complexes With Jak2 9e-19
4f1m_A287 Crystal Structure Of The G1179s Roco4 Kinase Domain 9e-19
1mqb_A333 Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro 1e-18
3miy_A266 X-Ray Crystal Structure Of Itk Complexed With Sunit 1e-18
1f3m_C297 Crystal Structure Of Human SerineTHREONINE KINASE P 1e-18
3q4z_A306 Structure Of Unphosphorylated Pak1 Kinase Domain Le 2e-18
3dk6_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 3e-18
2gqg_A278 X-Ray Crystal Structure Of Dasatinib (Bms-354825) B 3e-18
4gt5_A306 Crystal Structure Of The Inactive Trka Kinase Domai 3e-18
4f0i_A300 Crystal Structure Of Apo Trka Length = 300 3e-18
4hct_A269 Crystal Structure Of Itk In Complex With Compound 5 3e-18
4aoj_A329 Human Trka In Complex With The Inhibitor Az-23 Leng 3e-18
3qrj_A277 The Crystal Structure Of Human Abl1 Kinase Domain T 3e-18
2v7a_A286 Crystal Structure Of The T315i Abl Mutant In Comple 3e-18
2hz0_A270 Abl Kinase Domain In Complex With Nvp-Aeg082 Length 4e-18
3v5j_A266 Crystal Structure Of Interleukin-2 Inducible T-Cell 4e-18
3qri_A277 The Crystal Structure Of Human Abl1 Kinase Domain I 4e-18
2hyy_A273 Human Abl Kinase Domain In Complex With Imatinib (S 4e-18
2hzi_A277 Abl Kinase Domain In Complex With Pd180970 Length = 4e-18
1sm2_A264 Crystal Structure Of The Phosphorylated Interleukin 4e-18
3dk7_A277 Crystal Structure Of Mutant Abl Kinase Domain In Co 4e-18
2e2b_A293 Crystal Structure Of The C-Abl Kinase Domain In Com 5e-18
1yhv_A297 Crystal Structure Of Pak1 Kinase Domain With Two Po 5e-18
2hiw_A287 Crystal Structure Of Inactive Conformation Abl Kina 5e-18
2g1t_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 5e-18
3pyy_A298 Discovery And Characterization Of A Cell-Permeable, 5e-18
3v5q_A297 Discovery Of A Selective Trk Inhibitor With Efficac 5e-18
2x7f_A326 Crystal Structure Of The Kinase Domain Of Human Tra 6e-18
3fxz_A297 Crystal Structure Of Pak1 Kinase Domain With Ruthen 6e-18
4fk3_A292 B-Raf Kinase V600e Oncogenic Mutant In Complex With 6e-18
1fpu_A293 Crystal Structure Of Abl Kinase Domain In Complex W 6e-18
3qgw_A286 Crystal Structure Of Itk Kinase Bound To An Inhibit 6e-18
4fnw_A327 Crystal Structure Of The Apo F1174l Anaplastic Lymp 7e-18
3oy3_A284 Crystal Structure Of Abl T315i Mutant Kinase Domain 7e-18
2yjr_A342 Structure Of F1174l Mutant Anaplastic Lymphoma Kina 7e-18
3q52_A306 Structure Of Phosphorylated Pak1 Kinase Domain Leng 7e-18
2z60_A288 Crystal Structure Of The T315i Mutant Of Abl Kinase 7e-18
3oxz_A284 Crystal Structure Of Abl Kinase Domain Bound With A 7e-18
2qoh_A288 Crystal Structure Of Abl Kinase Bound With Ppy-a Le 7e-18
3c4c_A280 B-Raf Kinase In Complex With Plx4720 Length = 280 8e-18
2f4j_A287 Structure Of The Kinase Domain Of An Imatinib-Resis 9e-18
2g2f_A287 A Src-Like Inactive Conformation In The Abl Tyrosin 1e-17
3dk3_A293 Crystal Structure Of Mutant Abl Kinase Domain In Co 1e-17
2ogv_A317 Crystal Structure Of The Autoinhibited Human C-Fms 1e-17
3kul_B325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-17
3og7_A289 B-Raf Kinase V600e Oncogenic Mutant In Complex With 1e-17
2oo8_X317 Synthesis, Structural Analysis, And Sar Studies Of 1e-17
2jiv_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-17
3t9t_A267 Crystal Structure Of Btk Mutant (F435t,K596r) Compl 1e-17
4i24_A329 Structure Of T790m Egfr Kinase Domain Co-crystalliz 1e-17
2jiu_A328 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-17
2jit_A327 Crystal Structure Of Egfr Kinase Domain T790m Mutat 1e-17
4g5p_A330 Crystal Structure Of Egfr Kinase T790m In Complex W 1e-17
3lzb_A327 Egfr Kinase Domain Complexed With An Imidazo[2,1-B] 1e-17
3lcd_A329 Inhibitor Bound To A Dfg-In Structure Of The Kinase 1e-17
3ika_A331 Crystal Structure Of Egfr 696-1022 T790m Mutant Cov 1e-17
1fvr_A327 Tie2 Kinase Domain Length = 327 1e-17
3bel_A315 X-Ray Structure Of Egfr In Complex With Oxime Inhib 1e-17
1m14_A333 Tyrosine Kinase Domain From Epidermal Growth Factor 1e-17
3kul_A325 Kinase Domain Of Human Ephrin Type-A Receptor 8 (Ep 1e-17
2j5e_A327 Crystal Structure Of Egfr Kinase Domain In Complex 2e-17
2yfx_A327 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-17
3com_A314 Crystal Structure Of Mst1 Kinase Length = 314 2e-17
4hjo_A337 Crystal Structure Of The Inactive Egfr Tyrosine Kin 2e-17
3idp_A300 B-Raf V600e Kinase Domain In Complex With An Aminoi 2e-17
2xb7_A315 Structure Of Human Anaplastic Lymphoma Kinase In Co 2e-17
1uwj_A276 The Complex Of Mutant V599e B-raf And Bay439006 Len 2e-17
2gs7_A330 Crystal Structure Of The Inactive Egfr Kinase Domai 2e-17
4i23_A329 Crystal Structure Of The Wild-type Egfr Kinase Doma 2e-17
4g5j_A330 Crystal Structure Of Egfr Kinase In Complex With Bi 2e-17
2gs2_A330 Crystal Structure Of The Active Egfr Kinase Domain 2e-17
2xp2_A327 Structure Of The Human Anaplastic Lymphoma Kinase I 2e-17
2j5f_A327 Crystal Structure Of Egfr Kinase Domain In Complex 2e-17
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-17
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-17
4g9r_A307 B-Raf V600e Kinase Domain Bound To A Type Ii Dihydr 2e-17
2yhv_A342 Structure Of L1196m Mutant Anaplastic Lymphoma Kina 2e-17
3vjo_A334 Crystal Structure Of The Wild-Type Egfr Kinase Doma 2e-17
4fnz_A327 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-17
1xkk_A352 Egfr Kinase Domain Complexed With A Quinazoline Inh 2e-17
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-17
4dce_A333 Crystal Structure Of Human Anaplastic Lymphoma Kina 2e-17
3s95_A310 Crystal Structure Of The Human Limk1 Kinase Domain 2e-17
3aox_A344 X-Ray Crystal Structure Of Human Anaplastic Lymphom 2e-17
4dbn_A284 Crystal Structure Of The Kinase Domain Of Human B-R 2e-17
3q96_A282 B-Raf Kinase Domain In Complex With A Tetrahydronap 2e-17
3lct_A344 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-17
2qok_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 2e-17
2fb8_A281 Structure Of The B-Raf Kinase Domain Bound To Sb-59 2e-17
3l9p_A367 Crystal Structure Of The Anaplastic Lymphoma Kinase 2e-17
4h58_A275 Braf In Complex With Compound 3 Length = 275 2e-17
4fob_A353 Crystal Structure Of Human Anaplastic Lymphoma Kina 3e-17
3ii5_A306 The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimi 3e-17
3d4q_A307 Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 3e-17
3niz_A311 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-17
2yjs_A342 Structure Of C1156y Mutant Anaplastic Lymphoma Kina 3e-17
2rfd_A324 Crystal Structure Of The Complex Between The Egfr K 3e-17
2qkr_A313 Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 3e-17
3omv_A307 Crystal Structure Of C-Raf (Raf-1) Length = 307 3e-17
2qoo_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-17
2wqb_A324 Structure Of The Tie2 Kinase Domain In Complex With 5e-17
2qoc_A 344 Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp 5e-17
2qoi_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 5e-17
3dzq_A 361 Human Epha3 Kinase Domain In Complex With Inhibitor 5e-17
1uwh_A276 The Complex Of Wild Type B-Raf And Bay439006 Length 5e-17
2qof_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f 5e-17
2qod_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y602f 5e-17
2gsf_A 373 The Human Epha3 Receptor Tyrosine Kinase And Juxtam 6e-17
4fnx_A327 Crystal Structure Of The Apo R1275q Anaplastic Lymp 6e-17
3fxx_A 371 Human Epha3 Kinase And Juxtamembrane Region Bound T 6e-17
4i1z_A329 Crystal Structure Of The Monomeric (v948r) Form Of 7e-17
3ug1_A334 Crystal Structure Of The Mutated Egfr Kinase Domain 7e-17
3w2o_A331 Egfr Kinase Domain T790m/l858r Mutant With Tak-285 7e-17
2qol_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596:y 7e-17
4i21_A329 Crystal Structure Of L858r + T790m Egfr Kinase Doma 7e-17
2itn_A327 Crystal Structure Of Egfr Kinase Domain G719s Mutat 8e-17
2itt_A327 Crystal Structure Of Egfr Kinase Domain L858r Mutat 8e-17
2ivt_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 8e-17
3ggf_A301 Crystal Structure Of Human SerineTHREONINE-Protein 8e-17
2eb2_A334 Crystal Structure Of Mutated Egfr Kinase Domain (G7 9e-17
4i20_A329 Crystal Structure Of Monomeric (v948r) Primary Onco 9e-17
2pk9_A317 Structure Of The Pho85-pho80 Cdk-cyclin Complex Of 9e-17
3gop_A361 Crystal Structure Of The Egf Receptor Juxtamembrane 9e-17
3bea_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P 1e-16
2eb3_A334 Crystal Structure Of Mutated Egfr Kinase Domain (L8 1e-16
2ivs_A314 Crystal Structure Of Non-Phosphorylated Ret Tyrosin 1e-16
2i1m_A333 Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An 1e-16
3k54_A283 Structures Of Human Bruton's Tyrosine Kinase In Act 1e-16
2oh4_A316 Crystal Structure Of Vegfr2 With A Benzimidazole-Ur 2e-16
1u5q_A348 Crystal Structure Of The Tao2 Kinase Domain: Activa 2e-16
2ivv_A314 Crystal Structure Of Phosphorylated Ret Tyrosine Ki 2e-16
2gcd_A309 Tao2 Kinase Domain-Staurosporine Structure Length = 2e-16
3sxr_A268 Crystal Structure Of Bmx Non-Receptor Tyrosine Kina 2e-16
3q4t_A322 Crystal Structure Of Activin Receptor Type-Iia (Acv 2e-16
3pp0_A338 Crystal Structure Of The Kinase Domain Of Human Her 2e-16
2i0v_A335 C-Fms Tyrosine Kinase In Complex With A Quinolone I 2e-16
3lco_A324 Inhibitor Bound To A Dfg-Out Structure Of The Kinas 3e-16
2pvy_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-16
1yvj_A290 Crystal Structure Of The Jak3 Kinase Domain In Comp 3e-16
1luf_A343 Crystal Structure Of The Musk Tyrosine Kinase: Insi 4e-16
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 4e-16
4e4l_A302 Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 4e-16
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 4e-16
3oct_A265 Crystal Structure Of Bruton's Tyrosine Kinase Mutan 4e-16
2qon_A 373 Human Epha3 Kinase And Juxtamembrane Region, Y596f: 4e-16
2qob_A 344 Human Epha3 Kinase Domain, Base Structure Length = 4e-16
3ezr_A300 Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ 4e-16
3eyg_A290 Crystal Structures Of Jak1 And Jak2 Inhibitor Compl 4e-16
1gz8_A299 Human Cyclin Dependent Kinase 2 Complexed With The 4e-16
4erw_A306 Cdk2 In Complex With Staurosporine Length = 306 4e-16
3pxf_A306 Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N 4e-16
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 4e-16
3pj8_A299 Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] 5e-16
1pf8_A298 Crystal Structure Of Human Cyclin-dependent Kinase 5e-16
2qo7_A 373 Human Epha3 Kinase And Juxtamembrane Region, Dephos 5e-16
1vyw_A309 Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 5e-16
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 5e-16
2w17_A299 Cdk2 In Complex With The Imidazole Pyrimidine Amide 5e-16
1fin_A298 Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 5e-16
2hel_A306 Crystal Structure Of A Mutant Epha4 Kinase Domain ( 7e-16
1oit_A299 Imidazopyridines: A Potent And Selective Class Of C 7e-16
1jpa_A312 Crystal Structure Of Unphosphorylated Ephb2 Recepto 7e-16
2y6m_A291 Crystal Structure Of Epha4 Kinase Domain Length = 2 8e-16
3ckw_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 8e-16
2pvf_A334 Crystal Structure Of Tyrosine Phosphorylated Activa 8e-16
2xyu_A285 Crystal Structure Of Epha4 Kinase Domain In Complex 8e-16
1k3a_A299 Structure Of The Insulin-Like Growth Factor 1 Recep 8e-16
2r2p_A295 Kinase Domain Of Human Ephrin Type-A Receptor 5 (Ep 8e-16
3cly_A334 Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase 8e-16
4eqm_A294 Structural Analysis Of Staphylococcus Aureus Serine 9e-16
2zm3_A308 Complex Structure Of Insulin-Like Growth Factor Rec 9e-16
3a7f_A303 Human Mst3 Kinase Length = 303 9e-16
3gqi_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 9e-16
4e1z_A291 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-15
3zhp_C294 Human Mst3 (stk24) In Complex With Mo25beta Length 1e-15
3rhx_B306 Crystal Structure Of The Catalytic Domain Of Fgfr1 1e-15
3gen_A283 The 1.6 A Crystal Structure Of Human Bruton's Tyros 1e-15
2xik_A294 Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K 1e-15
4e20_A290 Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda 1e-15
3p08_A267 Crystal Structure Of The Human Btk Kinase Domain Le 1e-15
2pzp_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-15
1u59_A287 Crystal Structure Of The Zap-70 Kinase Domain In Co 1e-15
3pix_A274 Crystal Structure Of Btk Kinase Domain Complexed Wi 1e-15
3ocs_A271 Crystal Structure Of Bruton's Tyrosine Kinase In Co 1e-15
1gii_A298 Human Cyclin Dependent Kinase 2 Complexed With The 1e-15
1k2p_A263 Crystal Structure Of Bruton's Tyrosine Kinase Domai 1e-15
2iw6_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com 1e-15
2pz5_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-15
2pwl_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 2e-15
3q6w_A307 Structure Of Dually-phosphorylated Met Receptor Kin 2e-15
3pjc_A315 Crystal Structure Of Jak3 Complexed With A Potent A 2e-15
4eos_A300 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-15
4eoq_A301 Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co 2e-15
4bcq_A301 Structure Of Cdk2 In Complex With Cyclin A And A 2- 2e-15
3lxk_A327 Structural And Thermodynamic Characterization Of Th 2e-15
1ogu_A302 Structure Of Human Thr160-phospho Cdk2/cyclin A Com 2e-15
1h1p_A303 Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP 2e-15
4hvd_A314 Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h 2e-15
4eop_A300 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-15
1qmz_A299 Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com 2e-15
3bht_A300 Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN 2e-15
1w98_A298 The Structural Basis Of Cdk2 Activation By Cyclin E 2e-15
1e9h_A297 Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex 2e-15
4eoo_A299 Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 2e-15
1ywn_A316 Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]p 2e-15
1fgk_A310 Crystal Structure Of The Tyrosine Kinase Domain Of 2e-15
4f63_A309 Crystal Structure Of Human Fibroblast Growth Factor 2e-15
4i3z_A296 Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES 2e-15
3qhr_A298 Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic 2e-15
2jgz_A289 Crystal Structure Of Phospho-Cdk2 In Complex With C 2e-15
4eoi_A299 Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc 2e-15
3o23_A305 Human Unphosphorylated Igf1-R Kinase Domain In Comp 2e-15
1oir_A299 Imidazopyridines: A Potent And Selective Class Of C 2e-15
1h01_A298 Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili 2e-15
1p4o_A322 Structure Of Apo Unactivated Igf-1r Kinase Domain A 2e-15
3qqu_A301 Cocrystal Structure Of Unphosphorylated Igf With Py 2e-15
3i81_A315 Crystal Structure Of Insulin-Like Growth Factor 1 R 2e-15
3js2_A317 Crystal Structure Of Minimal Kinase Domain Of Fibro 2e-15
2oj9_A307 Structure Of Igf-1r Kinase Domain Complexed With A 2e-15
2p2i_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 2e-15
1jst_A298 Phosphorylated Cyclin-Dependent Kinase-2 Bound To C 2e-15
3lw0_A304 Igf-1rk In Complex With Ligand Msc1609119a-1 Length 2e-15
3tt0_A382 Co-Structure Of Fibroblast Growth Factor Receptor 1 2e-15
1jqh_A308 Igf-1 Receptor Kinase Domain Length = 308 3e-15
1m7n_A322 Crystal Structure Of Unactivated Apo Insulin-Like G 3e-15
3ckx_A304 Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 3e-15
3ri1_A313 Crystal Structure Of The Catalytic Domain Of Fgfr2 3e-15
1gjo_A316 The Fgfr2 Tyrosine Kinase Domain Length = 316 3e-15
3nyx_A302 Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T 3e-15
2pzr_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 3e-15
3lvp_A336 Crystal Structure Of Bisphosphorylated Igf1-R Kinas 3e-15
2psq_A370 Crystal Structure Of Unphosphorylated Unactivated W 3e-15
2p2h_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 3e-15
4eoj_A302 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-15
3dkg_A317 Sgx Clone 5698a109kfg1h1 Length = 317 3e-15
3nz0_A302 Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 3e-15
3b2t_A311 Structure Of Phosphotransferase Length = 311 3e-15
4bc6_A293 Crystal Structure Of Human Serine Threonine Kinase- 3e-15
3i5n_A309 Crystal Structure Of C-Met With Triazolopyridazine 3e-15
2wd1_A292 Human C-Met Kinase In Complex With Azaindole Inhibi 3e-15
1vr2_A316 Human Vascular Endothelial Growth Factor Receptor 2 3e-15
4eok_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma 3e-15
3f66_A298 Human C-Met Kinase In Complex With Quinoxaline Inhi 3e-15
2j7t_A302 Crystal Structure Of Human Serine Threonine Kinase- 3e-15
3q6u_A308 Structure Of The Apo Met Receptor Kinase In The Dua 3e-15
4aw5_A291 Complex Of The Ephb4 Kinase Domain With An Oxindole 3e-15
2g15_A318 Structural Characterization Of Autoinhibited C-Met 3e-15
3c4f_A302 Fgfr Tyrosine Kinase Domain In Complex With 3-(3- M 4e-15
2wgj_A306 X-Ray Structure Of Pf-02341066 Bound To The Kinase 4e-15
3lq8_A302 Structure Of The Kinase Domain Of C-Met Bound To Xl 4e-15
2rfn_A310 X-ray Structure Of C-met With Inhibitor. Length = 3 4e-15
4eom_A301 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-15
3cjg_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 4e-15
4gg5_A319 Crystal Structure Of Cmet In Complex With Novel Inh 4e-15
2vwu_A302 Ephb4 Kinase Domain Inhibitor Complex Length = 302 4e-15
3kex_A325 Crystal Structure Of The Catalytically Inactive Kin 4e-15
3lmg_A344 Crystal Structure Of The Erbb3 Kinase Domain In Com 4e-15
4eon_A300 Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum 4e-15
2xir_A316 Crystal Structure Of The Vegfr2 Kinase Domain In Co 4e-15
3kxx_A317 Structure Of The Mutant Fibroblast Growth Factor Re 4e-15
2ozo_A613 Autoinhibited Intact Human Zap-70 Length = 613 5e-15
3gql_A326 Crystal Structure Of Activated Receptor Tyrosine Ki 5e-15
2iw8_A302 Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 5e-15
3cjf_A309 Crystal Structure Of Vegfr2 In Complex With A 3,4,5 5e-15
3c7q_A316 Structure Of Vegfr2 Kinase Domain In Complex With B 5e-15
2hen_A286 Crystal Structure Of The Ephb2 Receptor Kinase Doma 5e-15
2j51_A325 Crystal Structure Of Human Ste20-Like Kinase Bound 6e-15
3ewh_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-15
3u6j_A314 Crystal Structure Of The Vegfr2 Kinase Domain In Co 6e-15
2a19_B284 Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng 6e-15
3vnt_A318 Crystal Structure Of The Kinase Domain Of Human Veg 6e-15
4agc_A353 Crystal Structure Of Vegfr2 (Juxtamembrane And Kina 6e-15
3d94_A301 Crystal Structure Of The Insulin-Like Growth Factor 7e-15
3txo_A 353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 7e-15
2jfm_A325 Crystal Structure Of Human Ste20-Like Kinase (Unlig 7e-15
2jfl_A325 Crystal Structure Of Human Ste20-Like Kinase ( Diph 7e-15
2wqm_A310 Structure Of Apo Human Nek7 Length = 310 7e-15
3pls_A298 Ron In Complex With Ligand Amp-Pnp Length = 298 8e-15
2q0b_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 8e-15
3rzf_A 677 Crystal Structure Of Inhibitor Of Kappab Kinase Bet 9e-15
3qa8_A 676 Crystal Structure Of Inhibitor Of Kappa B Kinase Be 9e-15
3lxn_A318 Structural And Thermodynamic Characterization Of Th 1e-14
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 1e-14
1v0o_A288 Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho 1e-14
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-14
3cth_A314 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-14
1v0b_A288 Crystal Structure Of The T198a Mutant Of Pfpk5 Leng 1e-14
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 1e-14
3dkc_A317 Sgx Clone 5698a65kfg1h1 Length = 317 1e-14
1r0p_A312 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-14
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 1e-14
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 1e-14
2py3_A324 Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D 1e-14
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 1e-14
3a4p_A319 Human C-Met Kinase Domain Complexed With 6-Benzylox 1e-14
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 1e-14
3uiu_A306 Crystal Structure Of Apo-Pkr Kinase Domain Length = 1e-14
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 1e-14
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 1e-14
3qti_A314 C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 1e-14
3c1x_A373 Crystal Structure Of The Tyrosine Kinase Domain Of 1e-14
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-14
2clq_A295 Structure Of Mitogen-Activated Protein Kinase Kinas 1e-14
3igo_A 486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 1e-14
1ob3_A288 Structure Of P. Falciparum Pfpk5 Length = 288 2e-14
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-14
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 2e-14
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-14
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 2e-14
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 2e-14
3vw6_A269 Crystal Structure Of Human Apoptosis Signal-Regulat 2e-14
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-14
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 2e-14
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-14
1zys_A273 Co-Crystal Structure Of Checkpoint Kinase Chk1 With 2e-14
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 2e-14
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 2e-14
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 2e-14
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-14
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 2e-14
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 2e-14
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 2e-14
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 2e-14
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 3e-14
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 3e-14
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 3e-14
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 3e-14
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 3e-14
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 3e-14
1rqq_A306 Crystal Structure Of The Insulin Receptor Kinase In 3e-14
2z8c_A303 Phosphorylated Insulin Receptor Tyrosine Kinase In 3e-14
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 3e-14
1ir3_A306 Phosphorylated Insulin Receptor Tyrosine Kinase In 3e-14
3oz6_A 388 Crystal Structure Of Mapk From Cryptosporidium Parv 3e-14
2f57_A317 Crystal Structure Of The Human P21-activated Kinase 3e-14
3g2f_A336 Crystal Structure Of The Kinase Domain Of Bone Morp 4e-14
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 4e-14
3i7c_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 4e-14
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 4e-14
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 4e-14
3dak_A290 Crystal Structure Of Domain-Swapped Osr1 Kinase Dom 4e-14
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-14
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 5e-14
2hog_A322 Crystal Structure Of Chek1 In Complex With Inhibito 5e-14
3qc9_A 543 Crystal Structure Of Cross-Linked Bovine Grk1 T8cN4 5e-14
2vwi_A303 Structure Of The Osr1 Kinase, A Hypertension Drug T 5e-14
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 5e-14
2p0c_A313 Catalytic Domain Of The Proto-Oncogene Tyrosine-Pro 5e-14
3t8o_A 543 Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolu 5e-14
3c4x_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-14
3c4w_A 543 Crystal Structure Of G Protein Coupled Receptor Kin 5e-14
2r0u_A323 Crystal Structure Of Chek1 In Complex With Inhibito 6e-14
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 6e-14
3q5i_A 504 Crystal Structure Of Pbanka_031420 Length = 504 6e-14
4fsn_A278 Crystal Structure Of The Chk1 Length = 278 7e-14
3gbz_A329 Structure Of The Cmgc Cdk Kinase From Giardia Lambl 7e-14
2rei_A318 Kinase Domain Of Human Ephrin Type-a Receptor 7 (ep 7e-14
2br1_A297 Structure-Based Design Of Novel Chk1 Inhibitors: In 7e-14
1ia8_A289 The 1.7 A Crystal Structure Of Human Cell Cycle Che 7e-14
1zlt_A295 Crystal Structure Of Chk1 Complexed With A Hymenald 7e-14
4fie_A423 Full-Length Human Pak4 Length = 423 7e-14
4fsm_A279 Crystal Structure Of The Chk1 Length = 279 7e-14
2ghg_A269 H-Chk1 Complexed With A431994 Length = 269 7e-14
2e9v_A268 Structure Of H-Chk1 Complexed With A859017 Length = 7e-14
4fsy_A279 Crystal Structure Of The Chk1 Length = 279 8e-14
2x8e_A276 Discovery Of A Novel Class Of Triazolones As Checkp 8e-14
3jvr_A271 Characterization Of The Chk1 Allosteric Inhibitor B 8e-14
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 8e-14
2ayp_A269 Crystal Structure Of Chk1 With An Indol Inhibitor L 8e-14
4fsw_A279 Crystal Structure Of The Chk1 Length = 279 8e-14
3ot3_A273 X-Ray Crystal Structure Of Compound 22k Bound To Hu 8e-14
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 8e-14
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 8e-14
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 9e-14
4fst_A269 Crystal Structure Of The Chk1 Length = 269 9e-14
2ydj_A276 Discovery Of Checkpoint Kinase Inhibitor Azd7762 By 9e-14
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 9e-14
1irk_A306 Crystal Structure Of The Tyrosine Kinase Domain Of 9e-14
4fsz_A279 Crystal Structure Of The Chk1 Length = 279 9e-14
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 9e-14
4ft3_A279 Crystal Structure Of The Chk1 Length = 279 1e-13
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-13
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-13
2hak_A328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 1e-13
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 1e-13
3eta_A317 Kinase Domain Of Insulin Receptor Complexed With A 1e-13
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-13
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 1e-13
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 1e-13
1i44_A306 Crystallographic Studies Of An Activation Loop Muta 1e-13
2qlu_A314 Crystal Structure Of Activin Receptor Type Ii Kinas 1e-13
1rjb_A344 Crystal Structure Of Flt3 Length = 344 1e-13
3nup_A307 Cdk6 (Monomeric) In Complex With Inhibitor Length = 1e-13
1bi8_A326 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-13
1jow_B308 Crystal Structure Of A Complex Of Human Cdk6 And A 2e-13
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 2e-13
2uv2_A287 Crystal Structure Of Human Ste20-Like Kinase Bound 2e-13
3kk9_A282 Camkii Substrate Complex B Length = 282 2e-13
3kk8_A284 Camkii Substrate Complex A Length = 284 2e-13
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 2e-13
1ua2_A 346 Crystal Structure Of Human Cdk7 Length = 346 2e-13
2bdw_A 362 Crystal Structure Of The Auto-Inhibited Kinase Doma 2e-13
4fsu_A279 Crystal Structure Of The Chk1 Length = 279 3e-13
2acx_A 576 Crystal Structure Of G Protein Coupled Receptor Kin 3e-13
3ekk_A307 Insulin Receptor Kinase Complexed With An Inhibitor 3e-13
3nyn_A 576 Crystal Structure Of G Protein-Coupled Receptor Kin 3e-13
4gs6_A315 Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz 3e-13
1p14_A306 Crystal Structure Of A Catalytic-Loop Mutant Of The 3e-13
2eva_A307 Structural Basis For The Interaction Of Tak1 Kinase 3e-13
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 4e-13
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 5e-13
1zxe_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 5e-13
2w99_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 6e-13
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 6e-13
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-13
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 6e-13
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-13
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 1e-12
2jed_A 352 The Crystal Structure Of The Kinase Domain Of The P 1e-12
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-12
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-12
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 1e-12
2w5a_A279 Human Nek2 Kinase Adp-Bound Length = 279 1e-12
2w96_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 2e-12
3d7t_A269 Structural Basis For The Recognition Of C-Src By It 2e-12
4apc_A 350 Crystal Structure Of Human Nima-Related Kinase 1 (N 2e-12
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 2e-12
2y4i_B319 Ksr2-Mek1 Heterodimer Length = 319 2e-12
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 2e-12
3mtl_A 324 Crystal Structure Of The Pctaire1 Kinase In Complex 2e-12
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-12
4a4x_A279 Nek2-Ede Bound To Cct248662 Length = 279 2e-12
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 2e-12
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 2e-12
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 2e-12
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 2e-12
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 2e-12
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 2e-12
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 2e-12
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 2e-12
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 2e-12
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 2e-12
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 2e-12
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 2e-12
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 2e-12
1xjd_A 345 Crystal Structure Of Pkc-Theta Complexed With Staur 2e-12
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 2e-12
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 2e-12
1h4l_A292 Structure And Regulation Of The Cdk5-P25(Nck5a) Com 2e-12
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 3e-12
2jav_A279 Human Kinase With Pyrrole-Indolinone Ligand Length 3e-12
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 3e-12
2w9f_B306 Crystal Structure Of Cdk4 In Complex With A D-Type 3e-12
3d7u_A263 Structural Basis For The Recognition Of C-Src By It 3e-12
4aaa_A331 Crystal Structure Of The Human Cdkl2 Kinase Domain 3e-12
1byg_A278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 3e-12
3h4j_B 336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 4e-12
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 4e-12
2jkk_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 5e-12
3f69_A311 Crystal Structure Of The Mycobacterium Tuberculosis 5e-12
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-12
4bcf_A331 Structure Of Cdk9 In Complex With Cyclin T And A 2- 6e-12
3mfr_A 351 Cask-4m Cam Kinase Domain, Native Length = 351 6e-12
2j0l_A276 Crystal Structure Of A The Active Conformation Of T 6e-12
3fzo_A277 Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin 6e-12
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 6e-12
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 7e-12
4h1j_A293 Crystal Structure Of Pyk2 With The Pyrazole 13a Len 7e-12
3cc6_A281 Crystal Structure Of Kinase Domain Of Protein Tyros 7e-12
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 7e-12
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 7e-12
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 7e-12
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 7e-12
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 8e-12
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 8e-12
4ec8_A 373 Structure Of Full Length Cdk9 In Complex With Cycli 8e-12
4ebw_A304 Structure Of Focal Adhesion Kinase Catalytic Domain 8e-12
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 8e-12
2etm_A281 Crystal Structure Of Focal Adhesion Kinase Domain C 8e-12
1mp8_A281 Crystal Structure Of Focal Adhesion Kinase (Fak) Le 8e-12
3ori_A311 Mycobacterium Tuberculosis Pknb Kinase Domain L33d 8e-12
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 8e-12
2jkm_A276 Focal Adhesion Kinase Catalytic Domain In Complex W 9e-12
3o17_A 370 Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 9e-12
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 9e-12
2j0m_B276 Crystal Structure A Two-Chain Complex Between The F 9e-12
3bz3_A276 Crystal Structure Analysis Of Focal Adhesion Kinase 9e-12
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 9e-12
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-11
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 1e-11
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 1e-11
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 1e-11
2j0k_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 1e-11
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-11
3mi9_A 351 Crystal Structure Of Hiv-1 Tat Complexed With Human 1e-11
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-11
3blh_A331 Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 1e-11
3pxk_A282 Focal Adhesion Kinase Catalytic Domain In Complex W 1e-11
1t46_A313 Structural Basis For The Autoinhibition And Sti-571 1e-11
1pkg_A329 Structure Of A C-kit Kinase Product Complex Length 1e-11
3oht_A 389 Crystal Structure Of Salmo Salar P38alpha Length = 1e-11
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 1e-11
3g33_A308 Crystal Structure Of Cdk4CYCLIN D3 Length = 308 1e-11
1ung_A292 Structural Mechanism For The Inhibition Of Cdk5-P25 1e-11
1t45_A331 Structural Basis For The Autoinhibition And Sti-571 1e-11
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 1e-11
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 1e-11
3g0e_A336 Kit Kinase Domain In Complex With Sunitinib Length 1e-11
3g0f_A336 Kit Kinase Domain Mutant D816h In Complex With Suni 1e-11
2puu_A 348 Crystal Structure Of P38 Complex With 1-(5-Tert-But 2e-11
2ghl_A 348 Mutant Mus Musculus P38 Kinase Domain In Complex Wi 2e-11
3elj_A 369 Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine 2e-11
3pze_A 358 Jnk1 In Complex With Inhibitor Length = 358 2e-11
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 2e-11
2g01_A 370 Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit 2e-11
1ywr_A 360 Crystal Structure Analysis Of Inactive P38 Kinase D 2e-11
2gtm_A 348 Mutated Mouse P38 Map Kinase Domain In Complex With 2e-11
3tg1_A 380 Crystal Structure Of P38alpha In Complex With A Map 2e-11
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-11
2zoq_A 382 Structural Dissection Of Human Mitogen-Activated Ki 2e-11
1bmk_A 379 The Complex Structure Of The Map Kinase P38SB218655 2e-11
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-11
1yw2_A 360 Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 2e-11
3py3_A 380 Crystal Structure Of Phosphorylated P38alpha Map Ki 2e-11
1lew_A 360 Crystal Structure Of Map Kinase P38 Complexed To Th 2e-11
3orm_A311 Mycobacterium Tuberculosis Pknb Kinase Domain D76a 2e-11
3fi4_A 372 P38 Kinase Crystal Structure In Complex With Ro4499 2e-11
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-11
4e5a_X 360 The W197a Mutant Of P38a Map Kinase Length = 360 2e-11
2oza_B 366 Structure Of P38alpha Complex Length = 366 2e-11
2j0j_A656 Crystal Structure Of A Fragment Of Focal Adhesion K 2e-11
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 3e-11
3vum_A 370 Crystal Structure Of A Cysteine-deficient Mutant M7 3e-11
3vul_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 3e-11
2baq_A 365 P38alpha Bound To Ro3201195 Length = 365 3e-11
3npc_A 364 Crystal Structure Of Jnk2 Complexed With Birb796 Le 3e-11
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 3e-11
3k3i_A 350 P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 4e-11
3gc9_A 370 The Structure Of P38beta C119s, C162s In Complex Wi 4e-11
1mru_A311 Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob 4e-11
3vuh_A 370 Crystal Structure Of A Cysteine-deficient Mutant M3 4e-11
3s3i_A 349 P38 Kinase Crystal Structure In Complex With Small 4e-11
3p4k_A 370 The Third Conformation Of P38a Map Kinase Observed 4e-11
3nnx_A 354 Crystal Structure Of Phosphorylated P38 Alpha In Co 4e-11
3hec_A 348 P38 In Complex With Imatinib Length = 348 4e-11
3d83_A 360 Crystal Structure Of P38 Kinase In Complex With A B 4e-11
2bal_A 365 P38alpha Map Kinase Bound To Pyrazoloamine Length = 4e-11
4hzs_A 341 Crystal Structure Of Ack1 Kinase Domain With C-term 4e-11
4fv6_A 360 Crystal Structure Of The Erk2 Complexed With E57 Le 4e-11
4ewh_B275 Co-Crystal Structure Of Ack1 With Inhibitor Length 4e-11
2y9q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 4e-11
3nnu_A 354 Crystal Structure Of P38 Alpha In Complex With Dp13 4e-11
1oz1_A 372 P38 Mitogen-Activated Kinase In Complex With 4-Azai 4e-11
4fux_A 360 Crystal Structure Of The Erk2 Complexed With E75 Le 4e-11
2gfs_A 372 P38 Kinase Crystal Structure In Complex With Ro3201 4e-11
1zzl_A 351 Crystal Structure Of P38 With Triazolopyridine Leng 4e-11
3od6_X 360 Crystal Structure Of P38alpha Y323t Active Mutant L 4e-11
3e92_A 371 Crystal Structure Of P38 Kinase In Complex With A B 4e-11
3oef_X 360 Crystal Structure Of Y323f Inactive Mutant Of P38al 4e-11
3d7z_A 360 Crystal Structure Of P38 Kinase In Complex With A B 4e-11
3soa_A 444 Full-Length Human Camkii Length = 444 4e-11
1bl6_A 379 The Complex Structure Of The Map Kinase P38SB216995 4e-11
3zsg_A 362 X-Ray Structure Of P38alpha Bound To Tak-715 Length 4e-11
2lgc_A 359 Joint Nmr And X-Ray Refinement Reveals The Structur 4e-11
3odz_X 360 Crystal Structure Of P38alpha Y323r Active Mutant L 4e-11
3k3j_A 362 P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 4e-11
2baj_A 365 P38alpha Bound To Pyrazolourea Length = 365 4e-11
3ody_X 360 Crystal Structure Of P38alpha Y323q Active Mutant L 4e-11
3hrb_A 359 P38 Kinase Crystal Structure In Complex With Small 4e-11
1di9_A 360 The Structure Of P38 Mitogen-Activated Protein Kina 4e-11
3mpt_A 371 Crystal Structure Of P38 Kinase In Complex With A P 4e-11
3gcp_A 360 Human P38 Map Kinase In Complex With Sb203580 Lengt 4e-11
1m7q_A 366 Crystal Structure Of P38 Map Kinase In Complex With 5e-11
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-11
1wzy_A 368 Crystal Structure Of Human Erk2 Complexed With A Py 5e-11
1tvo_A 368 The Structure Of Erk2 In Complex With A Small Molec 5e-11
3kq7_A 380 Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ 5e-11
3hvc_A 362 Crystal Structure Of Human P38alpha Map Kinase Leng 5e-11
4ewq_A 383 Human P38 Alpha Mapk In Complex With A Pyridazine B 5e-11
3gcu_A 360 Human P38 Map Kinase In Complex With Rl48 Length = 5e-11
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-11
2npq_A 367 A Novel Lipid Binding Site In The P38 Alpha Map Kin 5e-11
3vug_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 5e-11
3dt1_A 383 P38 Complexed With A Quinazoline Inhibitor Length = 5e-11
1u54_A291 Crystal Structures Of The Phosphorylated And Unphos 5e-11
2wel_A 327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 5e-11
2ojg_A 380 Crystal Structure Of Erk2 In Complex With N,n-dimet 5e-11
3sa0_A 360 Complex Of Erk2 With Norathyriol Length = 360 5e-11
4fv7_A 360 Crystal Structure Of The Erk2 Complexed With E94 Le 5e-11
3e7o_A 360 Crystal Structure Of Jnk2 Length = 360 5e-11
3v3v_A 379 Structural And Functional Analysis Of Quercetagetin 5e-11
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-11
1o6y_A299 Catalytic Domain Of Pknb Kinase From Mycobacterium 5e-11
2y8o_A 362 Crystal Structure Of Human P38alpha Complexed With 5e-11
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-11
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 5e-11
1ian_A 366 Human P38 Map Kinase Inhibitor Complex Length = 366 5e-11
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 5e-11
1ove_A 366 The Structure Of P38 Alpha In Complex With A Dihydr 6e-11
3zuv_A 364 Crystal Structure Of A Designed Selected Ankyrin Re 6e-11
2erk_A 365 Phosphorylated Map Kinase Erk2 Length = 365 6e-11
1u46_A291 Crystal Structure Of The Unphosphorylated Kinase Do 6e-11
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 6e-11
4id7_A273 Ack1 Kinase In Complex With The Inhibitor Cis-3-[8- 6e-11
3zu7_A 365 Crystal Structure Of A Designed Selected Ankyrin Re 6e-11
2z7l_A 366 Unphosphorylated Mitogen Activated Protein Kinase E 6e-11
3c9w_A 357 Crystal Structure Of Erk-2 With Hypothemycin Covale 6e-11
2fys_B 364 Crystal Structure Of Erk2 Complex With Kim Peptide 6e-11
3qyw_A 364 Crystal Structure Of Erk2 In Complex With An Inhibi 6e-11
3iw4_A 360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 6e-11
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 6e-11
3eqp_B276 Crystal Structure Of Ack1 With Compound T95 Length 6e-11
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 6e-11
3cqu_A 342 Crystal Structure Of Akt-1 Complexed With Substrate 6e-11
2z7q_A321 Crystal Structure Of The N-Terminal Kinase Domain O 6e-11
4hzr_A277 Crystal Structure Of Ack1 Kinase Domain Length = 27 6e-11
4gv1_A 340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-11
3ocb_A 341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 7e-11
1pme_A 380 Structure Of Penta Mutant Human Erk2 Map Kinase Com 7e-11
3o71_A 358 Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length 7e-11
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-11
4exu_A 371 Mapk13, Inactive Form Length = 371 7e-11
4gsb_A 364 Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 7e-11
3r63_A 358 Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 7e-11
2fsl_X 367 Mitogen Activated Protein Kinase P38alpha (D176a+f3 7e-11
3coi_A 353 Crystal Structure Of P38delta Kinase Length = 353 8e-11
2fst_X 367 Mitogen Activated Protein Kinase P38alpha (d176a+f3 8e-11
3g51_A325 Structural Diversity Of The Active Conformation Of 8e-11
2jam_A304 Crystal Structure Of Human Calmodulin-Dependent Pro 8e-11
3tei_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 8e-11
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 8e-11
2xrw_A 371 Linear Binding Motifs For Jnk And For Calcineurin A 8e-11
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 8e-11
2fso_X 367 Mitogen Activated Protein Kinase P38alpha (D176a) A 8e-11
2gph_A 364 Docking Motif Interactions In The Map Kinase Erk2 L 9e-11
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 9e-11
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 9e-11
3vud_A 370 Crystal Structure Of A Cysteine-deficient Mutant M1 9e-11
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 9e-11
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 9e-11
3gp0_A 348 Crystal Structure Of Human Mitogen Activated Protei 1e-10
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 1e-10
1ukh_A 369 Structural Basis For The Selective Inhibition Of Jn 1e-10
3mh2_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 1e-10
4h3q_A 362 Crystal Structure Of Human Erk2 Complexed With A Ma 1e-10
1gol_A 364 Coordinates Of Rat Map Kinase Erk2 With An Arginine 1e-10
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 1e-10
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 1e-10
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 1e-10
3kvx_A 364 Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le 1e-10
3gc8_A 370 The Structure Of P38beta C162s In Complex With A Di 1e-10
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-10
2xs0_A 386 Linear Binding Motifs For Jnk And For Calcineurin A 1e-10
3vuk_A 370 Crystal Structure Of A Cysteine-deficient Mutant M5 1e-10
2r9s_A 356 C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu 1e-10
1h8f_A 352 Glycogen Synthase Kinase 3 Beta. Length = 352 2e-10
1uv5_A 350 Glycogen Synthase Kinase 3 Beta Complexed With 6-Br 2e-10
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 2e-10
3vui_A 370 Crystal Structure Of A Cysteine-deficient Mutant M2 2e-10
3gi3_A 360 Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana 2e-10
3ttj_A 464 Crystal Structure Of Jnk3 Complexed With Cc-359, A 2e-10
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 2e-10
1o9u_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 2e-10
3pfq_A 674 Crystal Structure And Allosteric Activation Of Prot 3e-10
4an2_A301 Crystal Structures Of Human Mek1 With Carboxamide-B 3e-10
3orn_A307 Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In 3e-10
2y4i_C 395 Ksr2-Mek1 Heterodimer Length = 395 3e-10
2p55_A 333 X-Ray Structure Of The Human Mitogen-Activated Prot 3e-10
1jnk_A 423 The C-Jun N-Terminal Kinase (Jnk3s) Complexed With 3e-10
3ptg_A 363 Design And Synthesis Of A Novel, Orally Efficacious 3e-10
2o0u_A 364 Crystal Structure Of Human Jnk3 Complexed With N-{3 3e-10
1pmn_A 364 Crystal Structure Of Jnk3 In Complex With An Imidaz 3e-10
4h36_A 356 Crystal Structure Of Jnk3 In Complex With Atf2 Pept 3e-10
2b1p_A 355 Inhibitor Complex Of Jnk3 Length = 355 3e-10
2ok1_A 365 Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 3e-10
3oxi_A 362 Design And Synthesis Of Disubstituted Thiophene And 3e-10
2exc_X 356 Inhibitor Complex Of Jnk3 Length = 356 3e-10
2jdo_A 342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 3e-10
3fi3_A 364 Crystal Structure Of Jnk3 With Indazole Inhibitor, 3e-10
1s9j_A 341 X-Ray Structure Of The Human Mitogen-Activated Prot 4e-10
3o8p_A 360 Conformational Plasticity Of P38 Map Kinase Dfg Mot 4e-10
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 4e-10
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 4e-10
3mbl_A 328 Crystal Structure Of The Human Mitogen-Activated Pr 4e-10
3dv3_A 322 Mek1 With Pf-04622664 Bound Length = 322 4e-10
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 4e-10
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 4e-10
1gzn_A 335 Structure Of Pkb Kinase Domain Length = 335 4e-10
1o6l_A 337 Crystal Structure Of An Activated Akt/protein Kinas 4e-10
2i0e_A 353 Structure Of Catalytic Domain Of Human Protein Kina 4e-10
3hng_A360 Crystal Structure Of Vegfr1 In Complex With N-(4-ch 5e-10
3mh0_A 360 Mutagenesis Of P38 Map Kinase Eshtablishes Key Role 5e-10
3eqc_A 360 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-10
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 5e-10
1mrv_A 339 Crystal Structure Of An Inactive Akt2 Kinase Domain 5e-10
1o6k_A 336 Structure Of Activated Form Of Pkb Kinase Domain S4 5e-10
1s9i_A 354 X-Ray Structure Of The Human Mitogen-Activated Prot 5e-10
3e87_A 335 Crystal Structures Of The Kinase Domain Of Akt2 In 5e-10
3bhy_A283 Crystal Structure Of Human Death Associated Protein 6e-10
3sls_A304 Crystal Structure Of Human Mek-1 Kinase In Complex 6e-10
3mh3_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 6e-10
3say_A 430 Crystal Structure Of Human Glycogen Synthase Kinase 6e-10
3tac_A 361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 7e-10
1q5k_A 414 Crystal Structure Of Glycogen Synthase Kinase 3 In 7e-10
1pyx_A 422 Gsk-3 Beta Complexed With Amp-Pnp Length = 422 7e-10
3mh1_A 360 Mutagenesis Of P38 Map Kinase Establishes Key Roles 7e-10
1cm8_A 367 Phosphorylated Map Kinase P38-Gamma Length = 367 7e-10
3c0g_A 351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 7e-10
3fv8_A 355 Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le 7e-10
4acc_A 465 Gsk3b In Complex With Inhibitor Length = 465 7e-10
3fi2_A 353 Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib 7e-10
1i09_A 420 Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len 8e-10
1q3d_A 424 Gsk-3 Beta Complexed With Staurosporine Length = 42 8e-10
1y6a_A366 Crystal Structure Of Vegfr2 In Complex With A 2-Ani 8e-10
3vhe_A359 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 8e-10
3vhk_A368 Crystal Structure Of The Vegfr2 Kinase Domain In Co 8e-10
3vid_A356 Crystal Structure Of Human Vegfr2 Kinase Domain Wit 8e-10
3qup_A323 Inhibitor Bound Structure Of The Kinase Domain Of T 8e-10
3my0_A305 Crystal Structure Of The Acvrl1 (Alk1) Kinase Domai 8e-10
3lij_A 494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 9e-10
1r0e_A 391 Glycogen Synthase Kinase-3 Beta In Complex With 3-I 9e-10
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 9e-10
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 9e-10
4afj_A 367 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec 9e-10
3gb2_A 353 Gsk3beta Inhibitor Complex Length = 353 9e-10
1gng_A 378 Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With 9e-10
4dit_A 382 Crystal Structure Of Gsk3beta In Complex With A Imi 1e-09
3zrk_A 371 Identification Of 2-(4-Pyridyl)thienopyridinones As 1e-09
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 1e-09
2ow3_A 352 Glycogen Synthase Kinase-3 Beta In Complex With Bis 1e-09
3srv_A277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-09
2o5k_A 372 Crystal Structure Of Gsk3beta In Complex With A Ben 1e-09
3zdi_A 350 Glycogen Synthase Kinase 3 Beta Complexed With Axin 1e-09
3sd0_A 350 Identification Of A Glycogen Synthase Kinase-3b Inh 1e-09
3krw_A 688 Human Grk2 In Complex With Gbetgamma Subunits And B 1e-09
3f7z_A 350 X-ray Co-crystal Structure Of Glycogen Synthase Kin 1e-09
1omw_A 689 Crystal Structure Of The Complex Between G Protein- 1e-09
3psc_A 695 Bovine Grk2 In Complex With Gbetagamma Subunits Len 1e-09
3cik_A 689 Human Grk2 In Complex With Gbetagamma Subunits Leng 1e-09
3mdy_A337 Crystal Structure Of The Cytoplasmic Domain Of The 1e-09
3emg_A291 Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylami 1e-09
4f4p_A273 Syk In Complex With Ligand Lasw836 Length = 273 1e-09
3tub_A293 Crystal Structure Of Syk Kinase Domain With 1-(5-(6 1e-09
3vf8_A299 Crystal Structure Of Spleen Tyrosine Kinase Syk Cat 1e-09
4dfl_A274 Crystal Structure Of Spleen Tyrosine Kinase Complex 1e-09
3srv_B277 Crystal Structure Of Spleen Tyrosine Kinase (Syk) I 1e-09
3f88_A 349 Glycogen Synthase Kinase 3beta Inhibitor Complex Le 1e-09
1xba_A291 Crystal Structure Of Apo Syk Tyrosine Kinase Domain 2e-09
4dym_A301 Crystal Structure Of The Acvr1 Kinase Domain In Com 2e-09
1xh9_A350 Crystal Structures Of Protein Kinase B Selective In 2e-09
3mtf_A301 Crystal Structure Of The Acvr1 Kinase In Complex Wi 2e-09
4fl3_A635 Structural And Biophysical Characterization Of The 2e-09
4fl2_A636 Structural And Biophysical Characterization Of The 2e-09
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 2e-09
3h9r_A330 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-09
3fpq_A290 Crystal Structure Of The Kinase Domain Of Wnk1 Leng 2e-09
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 2e-09
2x9e_A317 Human Mps1 In Complex With Nms-P715 Length = 317 3e-09
3hmn_A342 Crystal Structure Of Human Mps1 Catalytic Domain In 3e-09
2gng_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-09
2f9g_A 353 Crystal Structure Of Fus3 Phosphorylated On Tyr182 3e-09
2gnf_A350 Protein Kinase A Fivefold Mutant Model Of Rho-Kinas 3e-09
2b9f_A 353 Crystal Structure Of Non-Phosphorylated Fus3 Length 3e-09
2b9h_A 353 Crystal Structure Of Fus3 With A Docking Motif From 3e-09
3cek_A313 Crystal Structure Of Human Dual Specificity Protein 3e-09
3uto_A 573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 3e-09
3dbq_A 343 Crystal Structure Of Ttk Kinase Domain Length = 343 3e-09
3ujg_A 361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 3e-09
3vqu_A320 Crystal Structure Of Human Mps1 Catalytic Domain In 4e-09
4ae9_A343 Structure And Function Of The Human Sperm-specific 4e-09
4agu_A311 Crystal Structure Of The Human Cdkl1 Kinase Domain 4e-09
1smh_A350 Protein Kinase A Variant Complex With Completely Or 4e-09
2zmc_A 390 Crystal Structure Of Human Mitotic Checkpoint Kinas 4e-09
1koa_A 491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 4e-09
1ctp_E350 Structure Of The Mammalian Catalytic Subunit Of Cam 4e-09
3vn9_A340 Rifined Crystal Structure Of Non-Phosphorylated Map 5e-09
1xh7_A350 Crystal Structures Of Protein Kinase B Selective In 5e-09
3fme_A290 Crystal Structure Of Human Mitogen-Activated Protei 5e-09
1cdk_A350 Camp-Dependent Protein Kinase Catalytic Subunit (E. 5e-09
2jds_A351 Structure Of Camp-Dependent Protein Kinase Complexe 5e-09
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 5e-09
1cmk_E350 Crystal Structures Of The Myristylated Catalytic Su 5e-09
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 5e-09
3uc4_A 362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 5e-09
1q8w_A350 The Catalytic Subunit Of Camp-Dependent Protein Kin 5e-09
2gnj_A350 Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 5e-09
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 5e-09
4ae6_A343 Structure And Function Of The Human Sperm-specific 6e-09
1szm_A350 Dual Binding Mode Of Bisindolylmaleimide 2 To Prote 6e-09
4e7w_A 394 Structure Of Gsk3 From Ustilago Maydis Length = 394 6e-09
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 6e-09
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 6e-09
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 7e-09
4dc2_A 396 Structure Of Pkc In Complex With A Substrate Peptid 7e-09
1svh_A350 Crystal Structure Of Protein Kinase A In Complex Wi 7e-09
2bil_B313 The Human Protein Kinase Pim1 In Complex With Its C 7e-09
3cy3_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-09
3nx8_A351 Human Camp Dependent Protein Kinase In Complex With 7e-09
3agm_A351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-09
3agl_A351 Complex Of Pka With The Bisubstrate Protein Kinase 7e-09
2f7e_E351 Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu 7e-09
2c1a_A351 Structure Of Camp-Dependent Protein Kinase Complexe 7e-09
3mvj_A371 Human Cyclic Amp-Dependent Protein Kinase Pka Inhib 7e-09
3cxw_A314 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-09
3jpv_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-09
3dnd_A350 Camp-Dependent Protein Kinase Pka Catalytic Subunit 7e-09
3ma3_A313 Crystal Structure Of Human Proto-Oncogene Serine Th 7e-09
2uzt_A336 Pka Structures Of Akt, Indazole-Pyridine Inhibitors 7e-09
2j2i_B312 Crystal Structure Of The Humab Pim1 In Complex With 7e-09
1zrz_A 364 Crystal Structure Of The Catalytic Domain Of Atypic 8e-09
2bik_B313 Human Pim1 Phosphorylated On Ser261 Length = 313 8e-09
1stc_E350 Camp-Dependent Protein Kinase, Alpha-Catalytic Subu 8e-09
4as0_A273 Cyclometalated Phthalimides As Protein Kinase Inhib 8e-09
3a8w_A 345 Crystal Structure Of Pkciota Kinase Domain Length = 8e-09
1q61_A350 Pka Triple Mutant Model Of Pkb Length = 350 9e-09
3zh8_A 349 A Novel Small Molecule Apkc Inhibitor Length = 349 9e-09
1yhs_A273 Crystal Structure Of Pim-1 Bound To Staurosporine L 9e-09
3l9m_A351 Crystal Structure Of Pkab3 (Pka Triple Mutant V123a 9e-09
4fr4_A 384 Crystal Structure Of Human SerineTHREONINE-Protein 1e-08
3f2a_A300 Crystal Structure Of Human Pim-1 In Complex With Da 1e-08
2xj0_A301 Protein Kinase Pim-1 In Complex With Fragment-4 Fro 1e-08
1xws_A313 Crystal Structure Of The Human Pim1 Kinase Domain L 1e-08
2xix_A301 Protein Kinase Pim-1 In Complex With Fragment-1 Fro 1e-08
1xqz_A300 Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut 1e-08
2xiy_A301 Protein Kinase Pim-1 In Complex With Fragment-2 Fro 1e-08
2obj_A333 Crystal Structure Of Human Pim-1 Kinase In Complex 1e-08
4alv_A328 Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 1e-08
3zut_A 362 The Structure Of Ost1 (D160a) Kinase Length = 362 1e-08
3r00_A299 The Discovery Of Novel Benzofuran-2-Carboxylic Acid 1e-08
3a99_A320 Structure Of Pim-1 Kinase Crystallized In The Prese 1e-08
3jxw_A294 Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- 1e-08
3uix_A298 Crystal Structure Of Pim1 Kinase In Complex With Sm 1e-08
3dcv_A328 Crystal Structure Of Human Pim1 Kinase Complexed Wi 1e-08
1ywv_A293 Crystal Structures Of Proto-Oncogene Kinase Pim1: A 1e-08
4dtk_A276 Novel And Selective Pan-Pim Kinase Inhibitor Length 1e-08
3c4e_A273 Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 1e-08
2zmd_A 390 Crystal Structure Of Human Mps1 Catalytic Domain T6 1e-08
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 2e-08
3h9f_A313 Crystal Structure Of Human Dual Specificity Protein 2e-08
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 2e-08
3zuu_A 362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 2e-08
3ama_A351 Protein Kinase A Sixfold Mutant Model Of Aurora B W 2e-08
1py5_A326 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 2e-08
2uvy_A351 Structure Of Pka-pkb Chimera Complexed With Methyl- 2e-08
1b6c_B342 Crystal Structure Of The Cytoplasmic Domain Of The 2e-08
4a7c_A308 Crystal Structure Of Pim1 Kinase With Etp46546 Leng 2e-08
1q24_A350 Pka Double Mutant Model Of Pkb In Complex With Mgat 2e-08
2jdt_A351 Structure Of Pka-Pkb Chimera Complexed With Isoquin 3e-08
3tzm_A309 Tgf-Beta Receptor Type 1 In Complex With Sb431542 L 3e-08
1rw8_A301 Crystal Structure Of Tgf-Beta Receptor I Kinase Wit 3e-08
2vo0_A351 Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 3e-08
1vjy_A303 Crystal Structure Of A Naphthyridine Inhibitor Of H 3e-08
2wot_A306 Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl) 3e-08
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 4e-08
2iwi_A312 Crystal Structure Of The Human Pim2 In Complex With 5e-08
4dfx_E350 Crystal Structure Of Myristoylated K7c Catalytic Su 5e-08
4dg3_E371 Crystal Structure Of R336a Mutant Of Camp-dependent 5e-08
2qcs_A350 A Complex Structure Between The Catalytic And Regul 5e-08
2r5t_A 373 Crystal Structure Of Inactive Serum And Glucocortic 5e-08
1l3r_E350 Crystal Structure Of A Transition State Mimic Of Th 6e-08
1apm_E350 2.0 Angstrom Refined Crystal Structure Of The Catal 6e-08
1yxs_A293 Crystal Structure Of Kinase Pim1 With P123m Mutatio 6e-08
3pvb_A345 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 6e-08
3fhi_A350 Crystal Structure Of A Complex Between The Catalyti 6e-08
3o7l_B350 Crystal Structure Of Phospholamban (1-19):pka C-Sub 7e-08
2erz_E351 Crystal Structure Of C-amp Dependent Kinase (pka) B 8e-08
2qur_A350 Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe 8e-08
1j3h_A350 Crystal Structure Of Apoenzyme Camp-Dependent Prote 8e-08
1ydt_E350 Structure Of Camp-Dependent Protein Kinase, Alpha-C 8e-08
1bkx_A350 A Binary Complex Of The Catalytic Subunit Of Camp-D 8e-08
1fmo_E350 Crystal Structure Of A Polyhistidine-Tagged Recombi 8e-08
3qal_E350 Crystal Structure Of Arg280ala Mutant Of Catalytic 8e-08
1jbp_E350 Crystal Structure Of The Catalytic Subunit Of Camp- 9e-08
2gu8_A337 Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel 9e-08
2qr8_A 342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 1e-07
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 1e-07
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 1e-07
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 1e-07
4dfy_A371 Crystal Structure Of R194a Mutant Of Camp-Dependent 1e-07
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 1e-07
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 1e-07
3enm_A316 The Structure Of The Map2k Mek6 Reveals An Autoinhi 1e-07
1kob_A 387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-07
2f2u_A 402 Crystal Structure Of The Rho-Kinase Kinase Domain L 2e-07
4ic7_A 442 Crystal Structure Of The Erk5 Kinase Domain In Comp 2e-07
1syk_A350 Crystal Structure Of E230q Mutant Of Camp-Dependent 2e-07
4fvp_A289 Crystal Structure Of The Jak2 Pseudokinase Domain ( 3e-07
4g3d_A371 Crystal Structure Of Human Nf-kappab Inducing Kinas 3e-07
4b99_A 398 Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le 3e-07
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 3e-07
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 3e-07
1tki_A 321 Autoinhibited Serine Kinase Domain Of The Giant Mus 3e-07
2qr7_A 342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 4e-07
3rny_A 346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 4e-07
3qam_E350 Crystal Structure Of Glu208ala Mutant Of Catalytic 4e-07
3e3p_A 360 Glycogen Synthase Kinase From Leishmania Major Leng 4e-07
2dyl_A318 Crystal Structure Of Human Mitogen-Activated Protei 5e-07
4g3g_A350 Crystal Structure Of Murine Nf-kappab Inducing Kina 5e-07
3p23_A 432 Crystal Structure Of The Human Kinase And Rnase Dom 7e-07
4dn5_A356 Crystal Structure Of Nf-kb-inducing Kinase (nik) Le 7e-07
4fvr_A289 Crystal Structure Of The Jak2 Pseudokinase Domain M 7e-07
4g3f_A336 Crystal Structure Of Murine Nf-kappab Inducing Kina 9e-07
1rdq_E350 Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of 9e-07
3p1a_A311 Structure Of Human Membrane-Associated Tyrosine- An 1e-06
4g3c_A352 Crystal Structure Of Apo Murine Nf-kappab Inducing 1e-06
3ll6_A337 Crystal Structure Of The Human Cyclin G Associated 1e-06
1x8b_A289 Structure Of Human Wee1a Kinase: Kinase Domain Comp 2e-06
3bi6_A287 Wee1 Kinase Complex With Inhibitor Pd352396 Length 2e-06
2in6_A287 Wee1 Kinase Complex With Inhibitor Pd311839 Length 2e-06
3uib_A 362 Map Kinase Lmampk10 From Leishmania Major In Comple 2e-06
3pg1_A 362 Map Kinase Lmampk10 From Leishmania Major (1.95 Ang 2e-06
2buj_A317 Crystal Structure Of The Human Serine-Threonine Kin 2e-06
1na7_A329 Crystal Structure Of The Catalytic Subunit Of Human 2e-06
2z2w_A285 Humand Wee1 Kinase Complexed With Inhibitor Pf03357 3e-06
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 4e-06
3rgf_A 405 Crystal Structure Of Human Cdk8CYCC Length = 405 6e-06
3rp9_A 458 Crystal Structure Of The Apo Mapk From Toxoplasma G 7e-06
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 9e-06
3dls_A335 Crystal Structure Of Human Pas Kinase Bound To Adp 9e-06
4anm_A335 Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 1e-05
2pvh_A352 Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri 1e-05
1ds5_A332 Dimeric Crystal Structure Of The Alpha Subunit In C 1e-05
4dgm_A326 Crystal Structure Of Maize Ck2 In Complex With The 1e-05
2qc6_A332 Protein Kinase Ck2 In Complex With Dbc Length = 332 1e-05
3pvg_A331 Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C 1e-05
>pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 Back     alignment and structure

Iteration: 1

Score = 177 bits (449), Expect = 2e-44, Method: Compositional matrix adjust. Identities = 102/227 (44%), Positives = 141/227 (62%), Gaps = 7/227 (3%) Query: 503 ELPIFDLKIIANATDNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGME-EFK 561 +L F L+ + A+DNFS KN LG GGFG VYKG L +G +AVKRL + QG E +F+ Sbjct: 24 QLKRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRLKEERXQGGELQFQ 83 Query: 562 NEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKL-LDWSKRSH 620 EV +I+ HRNL++L G C ER+L+Y Y+ N S+ + + S+ LDW KR Sbjct: 84 TEVEMISMAVHRNLLRLRGFCMTPTERLLVYPYMANGSVASCLRERPESQPPLDWPKRQR 143 Query: 621 IIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKR 680 I G ARGL YLH +IIHRD+KA+N+LLD + DFGLA+ +D + + Sbjct: 144 IALGSARGLAYLHDHCDPKIIHRDVKAANILLDEEFEAVVGDFGLAKL--MDYKDXHVXX 201 Query: 681 VV-GTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNHA 726 V GT G+++PEY G S K+DVF +GV++LE+I G+ R F+ A Sbjct: 202 AVRGTIGHIAPEYLSTGKSSEKTDVFGYGVMLLELITGQ--RAFDLA 246
>pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 Back     alignment and structure
>pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 Back     alignment and structure
>pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 Back     alignment and structure
>pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 Back     alignment and structure
>pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 Back     alignment and structure
>pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 Back     alignment and structure
>pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 Back     alignment and structure
>pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 Back     alignment and structure
>pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 Back     alignment and structure
>pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 Back     alignment and structure
>pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 Back     alignment and structure
>pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 Back     alignment and structure
>pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 Back     alignment and structure
>pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 Back     alignment and structure
>pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 Back     alignment and structure
>pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 Back     alignment and structure
>pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 Back     alignment and structure
>pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 Back     alignment and structure
>pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 Back     alignment and structure
>pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 Back     alignment and structure
>pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 Back     alignment and structure
>pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 Back     alignment and structure
>pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 Back     alignment and structure
>pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 Back     alignment and structure
>pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 Back     alignment and structure
>pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 Back     alignment and structure
>pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 Back     alignment and structure
>pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 Back     alignment and structure
>pdb|3BBT|B Chain B, Crystal Structure Of The Erbb4 Kinase In Complex With Lapatinib Length = 328 Back     alignment and structure
>pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 Back     alignment and structure
>pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 Back     alignment and structure
>pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 Back     alignment and structure
>pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 Back     alignment and structure
>pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 Back     alignment and structure
>pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 Back     alignment and structure
>pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 Back     alignment and structure
>pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 Back     alignment and structure
>pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 Back     alignment and structure
>pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 Back     alignment and structure
>pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 Back     alignment and structure
>pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 Back     alignment and structure
>pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 Back     alignment and structure
>pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 Back     alignment and structure
>pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 Back     alignment and structure
>pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 Back     alignment and structure
>pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 Back     alignment and structure
>pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 Back     alignment and structure
>pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 Back     alignment and structure
>pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 Back     alignment and structure
>pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 Back     alignment and structure
>pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 Back     alignment and structure
>pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 Back     alignment and structure
>pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 Back     alignment and structure
>pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 Back     alignment and structure
>pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 Back     alignment and structure
>pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 Back     alignment and structure
>pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 Back     alignment and structure
>pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 Back     alignment and structure
>pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 Back     alignment and structure
>pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 Back     alignment and structure
>pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 Back     alignment and structure
>pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 Back     alignment and structure
>pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 Back     alignment and structure
>pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 Back     alignment and structure
>pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 Back     alignment and structure
>pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 Back     alignment and structure
>pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 Back     alignment and structure
>pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 Back     alignment and structure
>pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 Back     alignment and structure
>pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 Back     alignment and structure
>pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 Back     alignment and structure
>pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 Back     alignment and structure
>pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 Back     alignment and structure
>pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 Back     alignment and structure
>pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 Back     alignment and structure
>pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 Back     alignment and structure
>pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 Back     alignment and structure
>pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 Back     alignment and structure
>pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 Back     alignment and structure
>pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 Back     alignment and structure
>pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 Back     alignment and structure
>pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 Back     alignment and structure
>pdb|4FK3|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx3203 Length = 292 Back     alignment and structure
>pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 Back     alignment and structure
>pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 Back     alignment and structure
>pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 Back     alignment and structure
>pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 Back     alignment and structure
>pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 Back     alignment and structure
>pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 Back     alignment and structure
>pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 Back     alignment and structure
>pdb|3C4C|A Chain A, B-Raf Kinase In Complex With Plx4720 Length = 280 Back     alignment and structure
>pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 Back     alignment and structure
>pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 Back     alignment and structure
>pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 Back     alignment and structure
>pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 Back     alignment and structure
>pdb|3KUL|B Chain B, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|3OG7|A Chain A, B-Raf Kinase V600e Oncogenic Mutant In Complex With Plx4032 Length = 289 Back     alignment and structure
>pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 Back     alignment and structure
>pdb|2JIV|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Compex With Hki-272 Length = 328 Back     alignment and structure
>pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 Back     alignment and structure
>pdb|4I24|A Chain A, Structure Of T790m Egfr Kinase Domain Co-crystallized With Dacomitinib Length = 329 Back     alignment and structure
>pdb|2JIU|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation In Complex With Aee788 Length = 328 Back     alignment and structure
>pdb|2JIT|A Chain A, Crystal Structure Of Egfr Kinase Domain T790m Mutation Length = 327 Back     alignment and structure
>pdb|4G5P|A Chain A, Crystal Structure Of Egfr Kinase T790m In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|3LZB|A Chain A, Egfr Kinase Domain Complexed With An Imidazo[2,1-B]thiazole Inhibitor Length = 327 Back     alignment and structure
>pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 Back     alignment and structure
>pdb|3IKA|A Chain A, Crystal Structure Of Egfr 696-1022 T790m Mutant Covalently Binding To Wz4002 Length = 331 Back     alignment and structure
>pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 Back     alignment and structure
>pdb|3BEL|A Chain A, X-Ray Structure Of Egfr In Complex With Oxime Inhibitor Length = 315 Back     alignment and structure
>pdb|1M14|A Chain A, Tyrosine Kinase Domain From Epidermal Growth Factor Receptor Length = 333 Back     alignment and structure
>pdb|3KUL|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 8 (Epha8) Length = 325 Back     alignment and structure
>pdb|2J5E|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 13-Jab Length = 327 Back     alignment and structure
>pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 Back     alignment and structure
>pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 Back     alignment and structure
>pdb|4HJO|A Chain A, Crystal Structure Of The Inactive Egfr Tyrosine Kinase Domain With Erlotinib Length = 337 Back     alignment and structure
>pdb|3IDP|A Chain A, B-Raf V600e Kinase Domain In Complex With An Aminoisoquinoline Inhibitor Length = 300 Back     alignment and structure
>pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 Back     alignment and structure
>pdb|1UWJ|A Chain A, The Complex Of Mutant V599e B-raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2GS7|A Chain A, Crystal Structure Of The Inactive Egfr Kinase Domain In Complex With Amp-Pnp Length = 330 Back     alignment and structure
>pdb|4I23|A Chain A, Crystal Structure Of The Wild-type Egfr Kinase Domain In Complex With Dacomitinib (soaked) Length = 329 Back     alignment and structure
>pdb|4G5J|A Chain A, Crystal Structure Of Egfr Kinase In Complex With Bibw2992 Length = 330 Back     alignment and structure
>pdb|2GS2|A Chain A, Crystal Structure Of The Active Egfr Kinase Domain Length = 330 Back     alignment and structure
>pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 Back     alignment and structure
>pdb|2J5F|A Chain A, Crystal Structure Of Egfr Kinase Domain In Complex With An Irreversible Inhibitor 34-Jab Length = 327 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|4G9R|A Chain A, B-Raf V600e Kinase Domain Bound To A Type Ii Dihydroquinazoline Inhibitor Length = 307 Back     alignment and structure
>pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|3VJO|A Chain A, Crystal Structure Of The Wild-Type Egfr Kinase Domain In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 Back     alignment and structure
>pdb|1XKK|A Chain A, Egfr Kinase Domain Complexed With A Quinazoline Inhibitor- Gw572016 Length = 352 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 Back     alignment and structure
>pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 Back     alignment and structure
>pdb|4DBN|A Chain A, Crystal Structure Of The Kinase Domain Of Human B-Raf With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 284 Back     alignment and structure
>pdb|3Q96|A Chain A, B-Raf Kinase Domain In Complex With A Tetrahydronaphthalene Inhibitor Length = 282 Back     alignment and structure
>pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 Back     alignment and structure
>pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2FB8|A Chain A, Structure Of The B-Raf Kinase Domain Bound To Sb-590885 Length = 281 Back     alignment and structure
>pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 Back     alignment and structure
>pdb|4H58|A Chain A, Braf In Complex With Compound 3 Length = 275 Back     alignment and structure
>pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 Back     alignment and structure
>pdb|3II5|A Chain A, The Complex Of Wild-Type B-Raf With Pyrazolo Pyrimidine Inhibitor Length = 306 Back     alignment and structure
>pdb|3D4Q|A Chain A, Pyrazole-Based Inhibitors Of B-Raf Kinase Length = 307 Back     alignment and structure
>pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 Back     alignment and structure
>pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 Back     alignment and structure
>pdb|2RFD|A Chain A, Crystal Structure Of The Complex Between The Egfr Kinase Domain And A Mig6 Peptide Length = 324 Back     alignment and structure
>pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 Back     alignment and structure
>pdb|3OMV|A Chain A, Crystal Structure Of C-Raf (Raf-1) Length = 307 Back     alignment and structure
>pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 Back     alignment and structure
>pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 Back     alignment and structure
>pdb|2QOC|A Chain A, Human Epha3 Kinase Domain, Phosphorylated, Amp-Pnp Bound Structure Length = 344 Back     alignment and structure
>pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 Back     alignment and structure
>pdb|3DZQ|A Chain A, Human Epha3 Kinase Domain In Complex With Inhibitor Awl-Ii- 38.3 Length = 361 Back     alignment and structure
>pdb|1UWH|A Chain A, The Complex Of Wild Type B-Raf And Bay439006 Length = 276 Back     alignment and structure
>pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 Back     alignment and structure
>pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 Back     alignment and structure
>pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 Back     alignment and structure
>pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 Back     alignment and structure
>pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 Back     alignment and structure
>pdb|4I1Z|A Chain A, Crystal Structure Of The Monomeric (v948r) Form Of The Gefitinib/erlotinib Resistant Egfr Kinase Domain L858r+t790m Length = 329 Back     alignment and structure
>pdb|3UG1|A Chain A, Crystal Structure Of The Mutated Egfr Kinase Domain (G719sT790M) IN The Apo Form Length = 334 Back     alignment and structure
>pdb|3W2O|A Chain A, Egfr Kinase Domain T790m/l858r Mutant With Tak-285 Length = 331 Back     alignment and structure
>pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 Back     alignment and structure
>pdb|4I21|A Chain A, Crystal Structure Of L858r + T790m Egfr Kinase Domain In Complex With Mig6 Peptide Length = 329 Back     alignment and structure
>pdb|2ITN|A Chain A, Crystal Structure Of Egfr Kinase Domain G719s Mutation In Complex With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|2ITT|A Chain A, Crystal Structure Of Egfr Kinase Domain L858r Mutation In Complex With Aee788 Length = 327 Back     alignment and structure
>pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|3GGF|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase Mst4 In Complex With An Quinazolin Length = 301 Back     alignment and structure
>pdb|2EB2|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (G719s) Length = 334 Back     alignment and structure
>pdb|4I20|A Chain A, Crystal Structure Of Monomeric (v948r) Primary Oncogenic Mutant L858r Egfr Kinase Domain Length = 329 Back     alignment and structure
>pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 Back     alignment and structure
>pdb|3GOP|A Chain A, Crystal Structure Of The Egf Receptor Juxtamembrane And Kinase Domains Length = 361 Back     alignment and structure
>pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 Back     alignment and structure
>pdb|2EB3|A Chain A, Crystal Structure Of Mutated Egfr Kinase Domain (L858r) In Complex With Amppnp Length = 334 Back     alignment and structure
>pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 Back     alignment and structure
>pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 Back     alignment and structure
>pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 Back     alignment and structure
>pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 Back     alignment and structure
>pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 Back     alignment and structure
>pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 Back     alignment and structure
>pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 Back     alignment and structure
>pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 Back     alignment and structure
>pdb|3Q4T|A Chain A, Crystal Structure Of Activin Receptor Type-Iia (Acvr2a) Kinase Domain In Complex With Dorsomorphin Length = 322 Back     alignment and structure
>pdb|3PP0|A Chain A, Crystal Structure Of The Kinase Domain Of Human Her2 (Erbb2). Length = 338 Back     alignment and structure
>pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 Back     alignment and structure
>pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 Back     alignment and structure
>pdb|2PVY|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K659n Mutation Responsible For An Unclassified Craniosynostosis Syndrome. Length = 324 Back     alignment and structure
>pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 Back     alignment and structure
>pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 Back     alignment and structure
>pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 Back     alignment and structure
>pdb|2QOB|A Chain A, Human Epha3 Kinase Domain, Base Structure Length = 344 Back     alignment and structure
>pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 Back     alignment and structure
>pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 Back     alignment and structure
>pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 Back     alignment and structure
>pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 Back     alignment and structure
>pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 Back     alignment and structure
>pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 Back     alignment and structure
>pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 Back     alignment and structure
>pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 Back     alignment and structure
>pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 Back     alignment and structure
>pdb|2HEL|A Chain A, Crystal Structure Of A Mutant Epha4 Kinase Domain (Y742a) Length = 306 Back     alignment and structure
>pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 Back     alignment and structure
>pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 Back     alignment and structure
>pdb|2Y6M|A Chain A, Crystal Structure Of Epha4 Kinase Domain Length = 291 Back     alignment and structure
>pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 Back     alignment and structure
>pdb|2PVF|A Chain A, Crystal Structure Of Tyrosine Phosphorylated Activated Fgf Receptor 2 (Fgfr2) Kinase Domain In Complex With Atp Analog And Substrate Peptide Length = 334 Back     alignment and structure
>pdb|2XYU|A Chain A, Crystal Structure Of Epha4 Kinase Domain In Complex With Vuf 12058 Length = 285 Back     alignment and structure
>pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 Back     alignment and structure
>pdb|2R2P|A Chain A, Kinase Domain Of Human Ephrin Type-A Receptor 5 (Epha5) Length = 295 Back     alignment and structure
>pdb|3CLY|A Chain A, Crystal Structure Of Fgf Receptor 2 (Fgfr2) Kinase Domains Trapped In Trans-Phosphorylation Reaction Length = 334 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 Back     alignment and structure
>pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 Back     alignment and structure
>pdb|3GQI|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 Back     alignment and structure
>pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 Back     alignment and structure
>pdb|3RHX|B Chain B, Crystal Structure Of The Catalytic Domain Of Fgfr1 Kinase In Complex With Arq 069 Length = 306 Back     alignment and structure
>pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 Back     alignment and structure
>pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 Back     alignment and structure
>pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 Back     alignment and structure
>pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 Back     alignment and structure
>pdb|2PZP|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K526e Mutation Responsible For Crouzon Syndrome Length = 324 Back     alignment and structure
>pdb|1U59|A Chain A, Crystal Structure Of The Zap-70 Kinase Domain In Complex With Staurosporine Length = 287 Back     alignment and structure
>pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 Back     alignment and structure
>pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 Back     alignment and structure
>pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 Back     alignment and structure
>pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2PWL|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549h Mutation Responsible For Crouzon Syndrome. Length = 324 Back     alignment and structure
>pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 Back     alignment and structure
>pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 Back     alignment and structure
>pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 Back     alignment and structure
>pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 Back     alignment and structure
>pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 Back     alignment and structure
>pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 Back     alignment and structure
>pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 Back     alignment and structure
>pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 Back     alignment and structure
>pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 Back     alignment and structure
>pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 Back     alignment and structure
>pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 Back     alignment and structure
>pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 Back     alignment and structure
>pdb|1YWN|A Chain A, Vegfr2 In Complex With A Novel 4-amino-furo[2,3-d]pyrimidine Length = 316 Back     alignment and structure
>pdb|1FGK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of Fibroblast Growth Factor Receptor 1 Length = 310 Back     alignment and structure
>pdb|4F63|A Chain A, Crystal Structure Of Human Fibroblast Growth Factor Receptor 1 Kinase Domain In Complex With Compound 1 Length = 309 Back     alignment and structure
>pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 Back     alignment and structure
>pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 Back     alignment and structure
>pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 Back     alignment and structure
>pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 Back     alignment and structure
>pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 Back     alignment and structure
>pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 Back     alignment and structure
>pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 Back     alignment and structure
>pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 Back     alignment and structure
>pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 Back     alignment and structure
>pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 Back     alignment and structure
>pdb|3JS2|A Chain A, Crystal Structure Of Minimal Kinase Domain Of Fibroblast Growth Factor Receptor 1 In Complex With 5-(2-Thienyl) Nicotinic Acid Length = 317 Back     alignment and structure
>pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 Back     alignment and structure
>pdb|2P2I|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Nicotinamide Inhibitor Length = 314 Back     alignment and structure
>pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 Back     alignment and structure
>pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 Back     alignment and structure
>pdb|3TT0|A Chain A, Co-Structure Of Fibroblast Growth Factor Receptor 1 Kinase Domain With 3-(2,6-Dichloro-3, 5-Dimethoxy-Phenyl)-1-{6-[4-(4-Ethyl-Piperazin-1- Yl)-Phenylamino]-Pyrimidin-4-Yl}-1-Methyl-Urea (Bgj398) Length = 382 Back     alignment and structure
>pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 Back     alignment and structure
>pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 Back     alignment and structure
>pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 Back     alignment and structure
>pdb|3RI1|A Chain A, Crystal Structure Of The Catalytic Domain Of Fgfr2 Kinase In Complex With Arq 069 Length = 313 Back     alignment and structure
>pdb|1GJO|A Chain A, The Fgfr2 Tyrosine Kinase Domain Length = 316 Back     alignment and structure
>pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 Back     alignment and structure
>pdb|2PZR|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic K641r Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 Back     alignment and structure
>pdb|2PSQ|A Chain A, Crystal Structure Of Unphosphorylated Unactivated Wild Type Fgf Receptor 2 (Fgfr2) Kinase Domain Length = 370 Back     alignment and structure
>pdb|2P2H|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridinyl-Triazine Inhibitor Length = 314 Back     alignment and structure
>pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 Back     alignment and structure
>pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 Back     alignment and structure
>pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 Back     alignment and structure
>pdb|3B2T|A Chain A, Structure Of Phosphotransferase Length = 311 Back     alignment and structure
>pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 Back     alignment and structure
>pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 Back     alignment and structure
>pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 Back     alignment and structure
>pdb|1VR2|A Chain A, Human Vascular Endothelial Growth Factor Receptor 2 (Kdr) Kinase Domain Length = 316 Back     alignment and structure
>pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 Back     alignment and structure
>pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 Back     alignment and structure
>pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 Back     alignment and structure
>pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 Back     alignment and structure
>pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 Back     alignment and structure
>pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 Back     alignment and structure
>pdb|3C4F|A Chain A, Fgfr Tyrosine Kinase Domain In Complex With 3-(3- Methoxybenzyl)-7-Azaindole Length = 302 Back     alignment and structure
>pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 Back     alignment and structure
>pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 Back     alignment and structure
>pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 Back     alignment and structure
>pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 Back     alignment and structure
>pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 Back     alignment and structure
>pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 Back     alignment and structure
>pdb|3KEX|A Chain A, Crystal Structure Of The Catalytically Inactive Kinase Domain Of The Human Epidermal Growth Factor Receptor 3 (Her3) Length = 325 Back     alignment and structure
>pdb|3LMG|A Chain A, Crystal Structure Of The Erbb3 Kinase Domain In Complex With Amp-Pnp Length = 344 Back     alignment and structure
>pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 Back     alignment and structure
>pdb|2XIR|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With Pf-00337210 (N,2-Dimethyl-6-(7-(2-Morpholinoethoxy) Quinolin-4-Yloxy)benzofuran-3-Carboxamide) Length = 316 Back     alignment and structure
>pdb|3KXX|A Chain A, Structure Of The Mutant Fibroblast Growth Factor Receptor 1 Length = 317 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|3GQL|A Chain A, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 326 Back     alignment and structure
>pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 Back     alignment and structure
>pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 Back     alignment and structure
>pdb|3C7Q|A Chain A, Structure Of Vegfr2 Kinase Domain In Complex With Bibf1120 Length = 316 Back     alignment and structure
>pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 Back     alignment and structure
>pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|3EWH|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyridyl-Pyrimidine Benzimidazole Inhibitor Length = 314 Back     alignment and structure
>pdb|3U6J|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Pyrazolone Inhibitor Length = 314 Back     alignment and structure
>pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 Back     alignment and structure
>pdb|3VNT|A Chain A, Crystal Structure Of The Kinase Domain Of Human Vegfr2 With A [1, 3]thiazolo[5,4-B]pyridine Derivative Length = 318 Back     alignment and structure
>pdb|4AGC|A Chain A, Crystal Structure Of Vegfr2 (Juxtamembrane And Kinase Domains) In Complex With Axitinib (Ag-013736) (N-Methyl-2-( 3-((E)-2-Pyridin-2-Yl-Vinyl)-1h-Indazol-6-Ylsulfanyl)- Benzamide) Length = 353 Back     alignment and structure
>pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 Back     alignment and structure
>pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 Back     alignment and structure
>pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 Back     alignment and structure
>pdb|3PLS|A Chain A, Ron In Complex With Ligand Amp-Pnp Length = 298 Back     alignment and structure
>pdb|2Q0B|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565a Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 Back     alignment and structure
>pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 Back     alignment and structure
>pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 Back     alignment and structure
>pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 Back     alignment and structure
>pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|2PY3|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic E565g Mutation Responsible For Pfeiffer Syndrome Length = 324 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure
>pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 Back     alignment and structure
>pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 Back     alignment and structure
>pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 Back     alignment and structure
>pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 Back     alignment and structure
>pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 Back     alignment and structure
>pdb|3G2F|A Chain A, Crystal Structure Of The Kinase Domain Of Bone Morphogenetic Protein Receptor Type Ii (Bmpr2) At 2.35 A Resolution Length = 336 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 Back     alignment and structure
>pdb|3QC9|A Chain A, Crystal Structure Of Cross-Linked Bovine Grk1 T8cN480C DOUBLE MUTANT Complexed With Adp And Mg Length = 543 Back     alignment and structure
>pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|2P0C|A Chain A, Catalytic Domain Of The Proto-Oncogene Tyrosine-Protein Kina Length = 313 Back     alignment and structure
>pdb|3T8O|A Chain A, Rhodopsin Kinase (grk1) L166k Mutant At 2.5a Resolution Length = 543 Back     alignment and structure
>pdb|3C4X|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.9a Length = 543 Back     alignment and structure
>pdb|3C4W|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 1 Bound To Atp And Magnesium Chloride At 2.7a Length = 543 Back     alignment and structure
>pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 Back     alignment and structure
>pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 Back     alignment and structure
>pdb|2REI|A Chain A, Kinase Domain Of Human Ephrin Type-a Receptor 7 (epha7) Length = 318 Back     alignment and structure
>pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 Back     alignment and structure
>pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 Back     alignment and structure
>pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 Back     alignment and structure
>pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 Back     alignment and structure
>pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 Back     alignment and structure
>pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 Back     alignment and structure
>pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 Back     alignment and structure
>pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 Back     alignment and structure
>pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|3ETA|A Chain A, Kinase Domain Of Insulin Receptor Complexed With A Pyrrolo Pyridine Inhibitor Length = 317 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2QLU|A Chain A, Crystal Structure Of Activin Receptor Type Ii Kinase Domain From Human Length = 314 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 Back     alignment and structure
>pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 Back     alignment and structure
>pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3EKK|A Chain A, Insulin Receptor Kinase Complexed With An Inhibitor Length = 307 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 Back     alignment and structure
>pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 Back     alignment and structure
>pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|1ZXE|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: D835n Inactivating Mutant In Apo Form Length = 303 Back     alignment and structure
>pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|2Y4I|B Chain B, Ksr2-Mek1 Heterodimer Length = 319 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|2JKK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|2J0L|A Chain A, Crystal Structure Of A The Active Conformation Of The Kinase Domain Of Focal Adhesion Kinase With A Phosphorylated Activation Loop Length = 276 Back     alignment and structure
>pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 Back     alignment and structure
>pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 Back     alignment and structure
>pdb|4EBW|A Chain A, Structure Of Focal Adhesion Kinase Catalytic Domain In Complex With Novel Allosteric Inhibitor Length = 304 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|2ETM|A Chain A, Crystal Structure Of Focal Adhesion Kinase Domain Complexed With 7h-Pyrrolo [2,3-D] Pyrimidine Derivative Length = 281 Back     alignment and structure
>pdb|1MP8|A Chain A, Crystal Structure Of Focal Adhesion Kinase (Fak) Length = 281 Back     alignment and structure
>pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2JKM|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Bis- Anilino Pyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure
>pdb|2J0M|B Chain B, Crystal Structure A Two-Chain Complex Between The Ferm And Kinase Domains Of Focal Adhesion Kinase. Length = 276 Back     alignment and structure
>pdb|3BZ3|A Chain A, Crystal Structure Analysis Of Focal Adhesion Kinase With A Methanesulfonamide Diaminopyrimidine Inhibitor Length = 276 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|2J0K|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains. Length = 656 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 Back     alignment and structure
>pdb|3PXK|A Chain A, Focal Adhesion Kinase Catalytic Domain In Complex With Pyrrolo[2,3- D]thiazole Length = 282 Back     alignment and structure
>pdb|1T46|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C-kit Tyrosine Kinase Length = 313 Back     alignment and structure
>pdb|1PKG|A Chain A, Structure Of A C-kit Kinase Product Complex Length = 329 Back     alignment and structure
>pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 Back     alignment and structure
>pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 Back     alignment and structure
>pdb|1T45|A Chain A, Structural Basis For The Autoinhibition And Sti-571 Inhibition Of C- Kit Tyrosine Kinase Length = 331 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|3G0E|A Chain A, Kit Kinase Domain In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|3G0F|A Chain A, Kit Kinase Domain Mutant D816h In Complex With Sunitinib Length = 336 Back     alignment and structure
>pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 Back     alignment and structure
>pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 Back     alignment and structure
>pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 Back     alignment and structure
>pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 Back     alignment and structure
>pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 Back     alignment and structure
>pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 Back     alignment and structure
>pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 Back     alignment and structure
>pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 Back     alignment and structure
>pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 Back     alignment and structure
>pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 Back     alignment and structure
>pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 Back     alignment and structure
>pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 Back     alignment and structure
>pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 Back     alignment and structure
>pdb|2J0J|A Chain A, Crystal Structure Of A Fragment Of Focal Adhesion Kinase Containing The Ferm And Kinase Domains Length = 656 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 Back     alignment and structure
>pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 Back     alignment and structure
>pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 Back     alignment and structure
>pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 Back     alignment and structure
>pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 Back     alignment and structure
>pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 Back     alignment and structure
>pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 Back     alignment and structure
>pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 Back     alignment and structure
>pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 Back     alignment and structure
>pdb|4HZS|A Chain A, Crystal Structure Of Ack1 Kinase Domain With C-terminal Sh3 Domain Length = 341 Back     alignment and structure
>pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 Back     alignment and structure
>pdb|4EWH|B Chain B, Co-Crystal Structure Of Ack1 With Inhibitor Length = 275 Back     alignment and structure
>pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 Back     alignment and structure
>pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 Back     alignment and structure
>pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 Back     alignment and structure
>pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 Back     alignment and structure
>pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 Back     alignment and structure
>pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 Back     alignment and structure
>pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 Back     alignment and structure
>pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 Back     alignment and structure
>pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 Back     alignment and structure
>pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 Back     alignment and structure
>pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 Back     alignment and structure
>pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 Back     alignment and structure
>pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 Back     alignment and structure
>pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 Back     alignment and structure
>pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 Back     alignment and structure
>pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 Back     alignment and structure
>pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 Back     alignment and structure
>pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 Back     alignment and structure
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 Back     alignment and structure
>pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 Back     alignment and structure
>pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 Back     alignment and structure
>pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 Back     alignment and structure
>pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 Back     alignment and structure
>pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 Back     alignment and structure
>pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 Back     alignment and structure
>pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 Back     alignment and structure
>pdb|1U54|A Chain A, Crystal Structures Of The Phosphorylated And Unphosphorylated Kinase Domains Of The Cdc42-Associated Tyrosine Kinase Ack1 Bound To Amp-Pcp Length = 291 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 Back     alignment and structure
>pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 Back     alignment and structure
>pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 Back     alignment and structure
>pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 Back     alignment and structure
>pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 Back     alignment and structure
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 Back     alignment and structure
>pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|1U46|A Chain A, Crystal Structure Of The Unphosphorylated Kinase Domain Of The Tyrosine Kinase Ack1 Length = 291 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|4ID7|A Chain A, Ack1 Kinase In Complex With The Inhibitor Cis-3-[8-amino-1-(4- Phenoxyphenyl)imidazo[1,5-a]pyrazin-3-yl]cyclobutanol Length = 273 Back     alignment and structure
>pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 Back     alignment and structure
>pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 Back     alignment and structure
>pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 Back     alignment and structure
>pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 Back     alignment and structure
>pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3EQP|B Chain B, Crystal Structure Of Ack1 With Compound T95 Length = 276 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 Back     alignment and structure
>pdb|4HZR|A Chain A, Crystal Structure Of Ack1 Kinase Domain Length = 277 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 Back     alignment and structure
>pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 Back     alignment and structure
>pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 Back     alignment and structure
>pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 Back     alignment and structure
>pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 Back     alignment and structure
>pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 Back     alignment and structure
>pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 Back     alignment and structure
>pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 Back     alignment and structure
>pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 Back     alignment and structure
>pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 Back     alignment and structure
>pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 Back     alignment and structure
>pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 Back     alignment and structure
>pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 Back     alignment and structure
>pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 Back     alignment and structure
>pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 Back     alignment and structure
>pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 Back     alignment and structure
>pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 Back     alignment and structure
>pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 Back     alignment and structure
>pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 Back     alignment and structure
>pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 Back     alignment and structure
>pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 Back     alignment and structure
>pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 Back     alignment and structure
>pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 Back     alignment and structure
>pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 Back     alignment and structure
>pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 Back     alignment and structure
>pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 Back     alignment and structure
>pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 Back     alignment and structure
>pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 Back     alignment and structure
>pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 Back     alignment and structure
>pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 Back     alignment and structure
>pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 Back     alignment and structure
>pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 Back     alignment and structure
>pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 Back     alignment and structure
>pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 Back     alignment and structure
>pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 Back     alignment and structure
>pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 Back     alignment and structure
>pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 Back     alignment and structure
>pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 Back     alignment and structure
>pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 Back     alignment and structure
>pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 Back     alignment and structure
>pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 Back     alignment and structure
>pdb|1Y6A|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 2-Anilino-5-Aryl-Oxazole Inhibitor Length = 366 Back     alignment and structure
>pdb|3VHE|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With A Novel Pyrrolopyrimidine Inhibitor Length = 359 Back     alignment and structure
>pdb|3VHK|A Chain A, Crystal Structure Of The Vegfr2 Kinase Domain In Complex With A Back Pocket Binder Length = 368 Back     alignment and structure
>pdb|3VID|A Chain A, Crystal Structure Of Human Vegfr2 Kinase Domain With Compound A Length = 356 Back     alignment and structure
>pdb|3QUP|A Chain A, Inhibitor Bound Structure Of The Kinase Domain Of The Murine Receptor Tyrosine Kinase Tyro3 (Sky) Length = 323 Back     alignment and structure
>pdb|3MY0|A Chain A, Crystal Structure Of The Acvrl1 (Alk1) Kinase Domain Bound To Ldn- 193189 Length = 305 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 Back     alignment and structure
>pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 Back     alignment and structure
>pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 Back     alignment and structure
>pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 Back     alignment and structure
>pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 Back     alignment and structure
>pdb|3SRV|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 Back     alignment and structure
>pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 Back     alignment and structure
>pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 Back     alignment and structure
>pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 Back     alignment and structure
>pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 Back     alignment and structure
>pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 Back     alignment and structure
>pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 Back     alignment and structure
>pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 Back     alignment and structure
>pdb|3MDY|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Bone Morp Protein Receptor Type-1b (Bmpr1b) In Complex With Fkbp12 An 193189 Length = 337 Back     alignment and structure
>pdb|3EMG|A Chain A, Discovery And Sar Of Novel 4-Thiazolyl-2- Phenylaminopyrimidines As Potent Inhibitors Of Spleen Tyrosine Kinase (Syk) Length = 291 Back     alignment and structure
>pdb|4F4P|A Chain A, Syk In Complex With Ligand Lasw836 Length = 273 Back     alignment and structure
>pdb|3TUB|A Chain A, Crystal Structure Of Syk Kinase Domain With 1-(5-(6,7- Dimethoxyquinolin-4-Yloxy)pyridin-2-Yl)-3-((1r,2s)-2- Phenylcyclopropyl)urea Length = 293 Back     alignment and structure
>pdb|3VF8|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Syk Catalytic Domain With Pyrazolylbenzimidazole Inhibitor 416 Length = 299 Back     alignment and structure
>pdb|4DFL|A Chain A, Crystal Structure Of Spleen Tyrosine Kinase Complexed With A Sulfonamidopyrazine Piperidine Inhibitor Length = 274 Back     alignment and structure
>pdb|3SRV|B Chain B, Crystal Structure Of Spleen Tyrosine Kinase (Syk) In Complex With A Diaminopyrimidine Carboxamide Inhibitor Length = 277 Back     alignment and structure
>pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 Back     alignment and structure
>pdb|1XBA|A Chain A, Crystal Structure Of Apo Syk Tyrosine Kinase Domain Length = 291 Back     alignment and structure
>pdb|4DYM|A Chain A, Crystal Structure Of The Acvr1 Kinase Domain In Complex With The Imidazo[1,2-B]pyridazine Inhibitor K00135 Length = 301 Back     alignment and structure
>pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3MTF|A Chain A, Crystal Structure Of The Acvr1 Kinase In Complex With A 2- Aminopyridine Inhibitor Length = 301 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3H9R|A Chain A, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 330 Back     alignment and structure
>pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 Back     alignment and structure
>pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 Back     alignment and structure
>pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 Back     alignment and structure
>pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 Back     alignment and structure
>pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 Back     alignment and structure
>pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 Back     alignment and structure
>pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 Back     alignment and structure
>pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 Back     alignment and structure
>pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 Back     alignment and structure
>pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 Back     alignment and structure
>pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 Back     alignment and structure
>pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 Back     alignment and structure
>pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 Back     alignment and structure
>pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 Back     alignment and structure
>pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 Back     alignment and structure
>pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 Back     alignment and structure
>pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 Back     alignment and structure
>pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 Back     alignment and structure
>pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 Back     alignment and structure
>pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 Back     alignment and structure
>pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 Back     alignment and structure
>pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 Back     alignment and structure
>pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 Back     alignment and structure
>pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 Back     alignment and structure
>pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 Back     alignment and structure
>pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 Back     alignment and structure
>pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 Back     alignment and structure
>pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 Back     alignment and structure
>pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 Back     alignment and structure
>pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 Back     alignment and structure
>pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 Back     alignment and structure
>pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 Back     alignment and structure
>pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 Back     alignment and structure
>pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 Back     alignment and structure
>pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 Back     alignment and structure
>pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 Back     alignment and structure
>pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 Back     alignment and structure
>pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 Back     alignment and structure
>pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 Back     alignment and structure
>pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 Back     alignment and structure
>pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 Back     alignment and structure
>pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 Back     alignment and structure
>pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 Back     alignment and structure
>pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 Back     alignment and structure
>pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 Back     alignment and structure
>pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 Back     alignment and structure
>pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 Back     alignment and structure
>pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 Back     alignment and structure
>pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 Back     alignment and structure
>pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 Back     alignment and structure
>pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 Back     alignment and structure
>pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 Back     alignment and structure
>pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 Back     alignment and structure
>pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 Back     alignment and structure
>pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 Back     alignment and structure
>pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 Back     alignment and structure
>pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 Back     alignment and structure
>pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 Back     alignment and structure
>pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 Back     alignment and structure
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 Back     alignment and structure
>pdb|1PY5|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Inhibitor Length = 326 Back     alignment and structure
>pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 Back     alignment and structure
>pdb|1B6C|B Chain B, Crystal Structure Of The Cytoplasmic Domain Of The Type I Tgf-Beta Receptor In Complex With Fkbp12 Length = 342 Back     alignment and structure
>pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 Back     alignment and structure
>pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 Back     alignment and structure
>pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 Back     alignment and structure
>pdb|3TZM|A Chain A, Tgf-Beta Receptor Type 1 In Complex With Sb431542 Length = 309 Back     alignment and structure
>pdb|1RW8|A Chain A, Crystal Structure Of Tgf-Beta Receptor I Kinase With Atp Site Inhibitor Length = 301 Back     alignment and structure
>pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 Back     alignment and structure
>pdb|1VJY|A Chain A, Crystal Structure Of A Naphthyridine Inhibitor Of Human Tgf- Beta Type I Receptor Length = 303 Back     alignment and structure
>pdb|2WOT|A Chain A, Alk5 In Complex With 4-((5,6-Dimethyl-2-(2-Pyridyl)-3- Pyridyl)oxy)-N-(3,4,5-Trimethoxyphenyl)pyridin-2-Amine Length = 306 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 Back     alignment and structure
>pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 Back     alignment and structure
>pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 Back     alignment and structure
>pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 Back     alignment and structure
>pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 Back     alignment and structure
>pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 Back     alignment and structure
>pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 Back     alignment and structure
>pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 Back     alignment and structure
>pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 Back     alignment and structure
>pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 Back     alignment and structure
>pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 Back     alignment and structure
>pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 Back     alignment and structure
>pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 Back     alignment and structure
>pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 Back     alignment and structure
>pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 Back     alignment and structure
>pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 Back     alignment and structure
>pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 Back     alignment and structure
>pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 Back     alignment and structure
>pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 Back     alignment and structure
>pdb|4FVP|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain (Apo Form) Length = 289 Back     alignment and structure
>pdb|4G3D|A Chain A, Crystal Structure Of Human Nf-kappab Inducing Kinase (nik) Length = 371 Back     alignment and structure
>pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 Back     alignment and structure
>pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 Back     alignment and structure
>pdb|4G3G|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) V408l Bound To A 2-(aminothiazolyl)phenol (cmp3) Length = 350 Back     alignment and structure
>pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 Back     alignment and structure
>pdb|4DN5|A Chain A, Crystal Structure Of Nf-kb-inducing Kinase (nik) Length = 356 Back     alignment and structure
>pdb|4FVR|A Chain A, Crystal Structure Of The Jak2 Pseudokinase Domain Mutant V617f (Mg- Atp-Bound Form) Length = 289 Back     alignment and structure
>pdb|4G3F|A Chain A, Crystal Structure Of Murine Nf-kappab Inducing Kinase (nik) Bound To A 2-(aminothiazoly)phenol (cmp2) Length = 336 Back     alignment and structure
>pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 Back     alignment and structure
>pdb|3P1A|A Chain A, Structure Of Human Membrane-Associated Tyrosine- And Threonine- Specific Cdc2-Inhibitory Kinase Myt1 (Pkmyt1) Length = 311 Back     alignment and structure
>pdb|4G3C|A Chain A, Crystal Structure Of Apo Murine Nf-kappab Inducing Kinase (nik) Length = 352 Back     alignment and structure
>pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 Back     alignment and structure
>pdb|1X8B|A Chain A, Structure Of Human Wee1a Kinase: Kinase Domain Complexed With Inhibitor Pd0407824 Length = 289 Back     alignment and structure
>pdb|3BI6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd352396 Length = 287 Back     alignment and structure
>pdb|2IN6|A Chain A, Wee1 Kinase Complex With Inhibitor Pd311839 Length = 287 Back     alignment and structure
>pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 Back     alignment and structure
>pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 Back     alignment and structure
>pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 Back     alignment and structure
>pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 Back     alignment and structure
>pdb|2Z2W|A Chain A, Humand Wee1 Kinase Complexed With Inhibitor Pf0335770 Length = 285 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 Back     alignment and structure
>pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 Back     alignment and structure
>pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 Back     alignment and structure
>pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 Back     alignment and structure
>pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 Back     alignment and structure
>pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 Back     alignment and structure
>pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 Back     alignment and structure
>pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query738
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 1e-122
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 1e-118
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-107
3soc_A322 Activin receptor type-2A; structural genomics cons 4e-82
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 2e-66
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 2e-62
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 1e-59
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 8e-59
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 8e-58
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-57
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 2e-57
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 2e-57
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-56
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 1e-54
3q4u_A301 Activin receptor type-1; structural genomics conso 9e-49
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 1e-48
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 4e-48
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 3e-47
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 1e-46
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 2e-46
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 2e-45
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-45
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 6e-45
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 1e-44
3lzb_A327 Epidermal growth factor receptor; epidermal growth 1e-44
4aoj_A329 High affinity nerve growth factor receptor; transf 1e-43
3v5q_A297 NT-3 growth factor receptor; kinase domain, kinase 1e-43
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 3e-43
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 7e-43
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 9e-43
3zzw_A289 Tyrosine-protein kinase transmembrane receptor RO; 1e-42
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 2e-42
3poz_A327 Epidermal growth factor receptor; kinase domain, a 3e-42
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-42
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-42
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 5e-42
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 6e-42
3pls_A298 Macrophage-stimulating protein receptor; protein k 7e-42
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 8e-42
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 8e-42
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 9e-42
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 1e-41
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 1e-41
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 2e-41
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 2e-41
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 2e-41
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 3e-41
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 3e-41
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 3e-41
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-41
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 5e-41
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 8e-41
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 1e-40
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 1e-40
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 1e-40
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 1e-40
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 2e-40
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 3e-40
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-40
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-40
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 4e-40
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 6e-40
2xir_A316 Vascular endothelial growth factor receptor 2; ang 6e-40
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 8e-40
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 2e-39
2a19_B284 Interferon-induced, double-stranded RNA-activated 3e-39
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 8e-39
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 9e-39
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 2e-38
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 3e-38
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 4e-38
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 2e-37
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 2e-37
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 5e-37
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 5e-37
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 2e-36
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 3e-36
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-36
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 5e-36
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 8e-36
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-35
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 5e-35
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 1e-34
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 4e-34
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-34
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-33
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 4e-33
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 5e-33
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-32
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-32
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 4e-32
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 5e-32
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 5e-32
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 7e-32
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 8e-32
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-31
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-31
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 8e-31
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 9e-31
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 1e-30
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-30
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 2e-30
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 2e-30
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 4e-30
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 7e-30
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 9e-30
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 2e-29
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 3e-29
3aln_A327 Dual specificity mitogen-activated protein kinase; 7e-29
3fme_A290 Dual specificity mitogen-activated protein kinase; 8e-29
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-28
3an0_A340 Dual specificity mitogen-activated protein kinase; 2e-28
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 2e-28
3ork_A311 Serine/threonine protein kinase; structural genomi 4e-28
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 5e-28
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 8e-28
3niz_A311 Rhodanese family protein; structural genomics, str 1e-27
2dyl_A318 Dual specificity mitogen-activated protein kinase 1e-27
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 1e-27
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 2e-27
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-27
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 3e-27
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 4e-27
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 4e-27
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 4e-27
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 5e-27
3o0g_A292 Cell division protein kinase 5; kinase activator c 6e-27
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 8e-27
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 9e-27
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 1e-26
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 1e-26
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 1e-26
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-26
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-26
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 3e-26
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 4e-26
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 8e-26
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-25
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 1e-25
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-25
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 2e-25
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 3e-25
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 5e-25
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 6e-25
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 7e-25
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 7e-25
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-24
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 1e-24
3bhy_A283 Death-associated protein kinase 3; death associate 1e-24
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 2e-24
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 2e-24
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 2e-24
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 3e-24
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 4e-24
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 5e-24
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 7e-24
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 8e-24
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 9e-24
2y0a_A326 Death-associated protein kinase 1; transferase, ca 9e-24
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-23
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 4e-23
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 4e-23
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 1e-22
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 1e-22
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 1e-22
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 2e-22
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-22
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 3e-22
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 3e-22
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 3e-22
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 4e-22
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 7e-22
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-22
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-21
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-21
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 6e-21
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 7e-21
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 9e-21
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 1e-20
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-19
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 2e-19
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 2e-19
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-19
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 7e-19
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 1e-18
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 1e-18
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 2e-18
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 2e-18
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 2e-18
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 3e-18
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 1e-12
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 2e-17
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 3e-17
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 2e-16
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 2e-16
3rp9_A 458 Mitogen-activated protein kinase; structural genom 2e-16
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 4e-16
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 4e-16
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 8e-16
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 9e-16
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-15
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 3e-15
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 3e-15
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 4e-15
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 5e-15
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 5e-15
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 9e-15
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 9e-15
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 1e-14
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-14
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-14
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 2e-14
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-14
3uqc_A286 Probable conserved transmembrane protein; structur 2e-14
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-14
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 3e-14
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 3e-14
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 5e-14
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 6e-14
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 2e-13
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 4e-13
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-12
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 3e-12
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-11
1kj1_A109 Lectin I, lecgna 1; BULB lectin, mannose, plant pr 2e-11
3a0c_A110 Mannose/sialic acid-binding lectin; beta-prism II, 6e-11
1xd5_A112 Gastrodianin-1, antifungal protein GAFP-1; monocot 3e-09
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 5e-09
2dpf_A115 Curculin; sweet taste, taste modifying, plant prot 7e-09
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 7e-09
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 1e-08
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 2e-08
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 4e-08
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 4e-08
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 7e-08
3dzw_A109 Agglutinin; lectin, mannobiose, mannose-alpha1, 3- 1e-07
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-07
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 3e-07
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-04
3r0e_A109 Lectin; carbohydrate binding, carbohydrate, sugar 6e-06
3r0e_B110 Lectin; carbohydrate binding, carbohydrate, sugar 1e-05
1b2p_A119 Protein (lectin); mannose-binding lectin, monocot, 2e-05
3m7h_A276 Putidacin L1; monocot mannose-binding lectin, bact 1e-04
3mez_B113 Mannose-specific lectin 3 chain 2; heterotetramer, 2e-04
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 6e-04
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure
 Score =  366 bits (941), Expect = e-122
 Identities = 95/253 (37%), Positives = 137/253 (54%), Gaps = 17/253 (6%)

Query: 494 NQGNEKEEMELPIFDLKIIANATDNFSEK------NKLGEGGFGPVYKGMLIEGQEIAVK 547
           N+  E  +     F    + N T+NF E+      NK+GEGGFG VYKG  +    +AVK
Sbjct: 2   NKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKG-YVNNTTVAVK 60

Query: 548 RLSKG----SGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEYLPNKSLDYF 603
           +L+      + +  ++F  E+ ++AK QH NLV+LLG  +  D+  L+Y Y+PN SL   
Sbjct: 61  KLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDR 120

Query: 604 IFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDF 663
           +     +  L W  R  I  G A G+ +LH++     IHRD+K++N+LLD     KISDF
Sbjct: 121 LSCLDGTPPLSWHMRCKIAQGAANGINFLHENH---HIHRDIKSANILLDEAFTAKISDF 177

Query: 664 GLARSFGLDQTEANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGF 723
           GLAR+         T R+VGT  YM+PE  + G  + KSD++SFGV++LEII G      
Sbjct: 178 GLARASEKFAQTVMTSRIVGTTAYMAPEA-LRGEITPKSDIYSFGVVLLEIITGLPA--V 234

Query: 724 NHADHDHNLLGHV 736
           +       LL   
Sbjct: 235 DEHREPQLLLDIK 247


>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1kj1_A Lectin I, lecgna 1; BULB lectin, mannose, plant protein; HET: MAN; 2.20A {Allium sativum} SCOP: b.78.1.1 PDB: 1bwu_P* 1kj1_D* 1bwu_Q* 1bwu_A* 1bwu_D* Length = 109 Back     alignment and structure
>3a0c_A Mannose/sialic acid-binding lectin; beta-prism II, sugar binding protein; 2.00A {Polygonatum cyrtonema} PDB: 3a0d_A* 3a0e_A* Length = 110 Back     alignment and structure
>1xd5_A Gastrodianin-1, antifungal protein GAFP-1; monocot mannose binding lectin, monomer, homogeneous beta- sheet; 2.00A {Gastrodia elata} SCOP: b.78.1.1 PDB: 1xd6_A Length = 112 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 Back     alignment and structure
>2dpf_A Curculin; sweet taste, taste modifying, plant protein; 1.50A {Curculigo latifolia} PDB: 2d04_B* 2d04_A* Length = 115 Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 Back     alignment and structure
>3dzw_A Agglutinin; lectin, mannobiose, mannose-alpha1, 3-mannose, D sugar binding protein; HET: MAN; 1.70A {Narcissus pseudonarcissus} PDB: 1npl_A* 1jpc_A* 1msa_A* 1niv_A* Length = 109 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3r0e_A Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 109 Back     alignment and structure
>3r0e_B Lectin; carbohydrate binding, carbohydrate, sugar binding protein; 2.40A {Remusatia vivipara} Length = 110 Back     alignment and structure
>1b2p_A Protein (lectin); mannose-binding lectin, monocot, aglutinin, bluebell bulbs, carbohydrate interactions, sugar binding protein; 1.70A {Hyacinthoides hispanica} SCOP: b.78.1.1 Length = 119 Back     alignment and structure
>3m7h_A Putidacin L1; monocot mannose-binding lectin, bacteriocin, LLPA, pseudomon bacterial toxin, siras, antimicrobial protein; 2.20A {Pseudomonas SP} PDB: 3m7j_A* Length = 276 Back     alignment and structure
>3mez_B Mannose-specific lectin 3 chain 2; heterotetramer, sugar binding protein; 1.94A {Crocus vernus} Length = 113 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 738
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 2e-63
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 9e-63
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 4e-59
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-57
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 1e-56
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 6e-56
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 6e-56
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 8e-56
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-55
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-55
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 4e-55
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 9e-54
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 1e-53
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 2e-53
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 2e-53
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 3e-53
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 4e-53
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 7e-53
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 9e-53
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-52
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-51
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-51
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-51
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 3e-50
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-50
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-50
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 4e-50
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 6e-49
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 7e-49
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 6e-48
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 6e-48
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 4e-47
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 7e-46
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 2e-45
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-44
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-44
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-44
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-43
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-43
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 1e-43
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-43
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-42
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-41
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 4e-41
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 9e-41
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-40
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 7e-40
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-39
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-38
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-38
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 4e-38
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-37
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 2e-37
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-36
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-36
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 1e-35
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-34
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 1e-32
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-32
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 2e-31
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-31
d1q8ya_ 362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 2e-27
d1zara2191 d.144.1.9 (A:91-281) Rio2 serine protein kinase C- 9e-24
d1kj1a_109 b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium 1e-18
d1jpca_108 b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galan 5e-14
d1dlpa2120 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet 9e-14
d1xd5a_112 b.78.1.1 (A:) Gastrodianin (antifungal protein) {G 4e-13
d1b2pa_119 b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scill 4e-10
d1dlpa1115 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet p 2e-08
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: B-Raf kinase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  210 bits (536), Expect = 2e-63
 Identities = 57/206 (27%), Positives = 103/206 (50%), Gaps = 9/206 (4%)

Query: 517 DNFSEKNKLGEGGFGPVYKGMLIEGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLV 576
              +   ++G G FG VYKG       + +  ++  + Q ++ FKNEV ++ K +H N++
Sbjct: 8   GQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNIL 67

Query: 577 KLLGCCTQRDERMLIYEYLPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDS 636
             +G  T   +  ++ ++    SL + +         +  K   I    A+G+ YLH  S
Sbjct: 68  LFMGYSTA-PQLAIVTQWCEGSSLYHHLHI--IETKFEMIKLIDIARQTAQGMDYLHAKS 124

Query: 637 RLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGTYGYMSPEYA--- 693
              IIHRDLK++N+ L   +  KI DFGLA            +++ G+  +M+PE     
Sbjct: 125 ---IIHRDLKSNNIFLHEDLTVKIGDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQ 181

Query: 694 IDGLFSVKSDVFSFGVLVLEIICGKK 719
               +S +SDV++FG+++ E++ G+ 
Sbjct: 182 DKNPYSFQSDVYAFGIVLYELMTGQL 207


>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Length = 109 Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Length = 108 Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 120 Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Length = 112 Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 119 Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Length = 115 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query738
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.82
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 99.79
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 99.77
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 99.76
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 99.67
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 99.52
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 99.5
d1dlpa1115 Fetuin-binding protein Scafet precursor {Bluebell 99.2
d1b2pa_119 Lectin (agglutinin) {Bluebell (Scilla campanulata) 99.0
d1dlpa2120 Fetuin-binding protein Scafet precursor {Bluebell 98.94
d1jpca_108 Lectin (agglutinin) {Snowdrop (Galanthus nivalis) 98.85
d1kj1a_109 Lectin (agglutinin) {Garlic (Allium sativum) [TaxI 98.8
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 98.68
d1xd5a_112 Gastrodianin (antifungal protein) {Gastrodia elata 98.62
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 98.05
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.98
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 97.42
d1nw1a_ 395 Choline kinase {Caenorhabditis elegans [TaxId: 623 97.1
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.42
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.4e-44  Score=310.88  Aligned_cols=201  Identities=27%  Similarity=0.479  Sum_probs=179.5

Q ss_pred             CCCCCCCCEECCCCCEEEEEEEEC-CCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEEECCCCCEEEEEE
Q ss_conf             079895651055564769974504-6638999981589975668899999999671277723588477417821699841
Q 004674          516 TDNFSEKNKLGEGGFGPVYKGMLI-EGQEIAVKRLSKGSGQGMEEFKNEVLLIAKLQHRNLVKLLGCCTQRDERMLIYEY  594 (738)
Q Consensus       516 ~~~y~~~~~IG~G~fG~Vykg~~~-~g~~VavK~l~~~~~~~~~~~~~Ei~~l~~l~H~nIv~l~g~~~~~~~~~lV~E~  594 (738)
                      .++|++.+.||+|+||.||++... .++.||+|++........+.+.+|+.++++++||||+++++++.+.+..++||||
T Consensus        19 ~~~Y~~~~~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~~~~~~~E~~il~~l~HpnIv~~~~~~~~~~~~~ivmEy   98 (293)
T d1yhwa1          19 KKKYTRFEKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEY   98 (293)
T ss_dssp             TTTBCSCEECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHHCCCTTBCCEEEEEEETTEEEEEEEC
T ss_pred             CCCCEEEEEEECCCCCEEEEEEECCCCCEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCEEEEEEEE
T ss_conf             10538878981285829999999899989999998430172799999999999867999880585779889998999970


Q ss_pred             CCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCEEECCCCCEEEEEECCCCCCCCCCC
Q ss_conf             79999457886138888899999999999999999998739999747479899968984899539995247511498865
Q 004674          595 LPNKSLDYFIFDTTRSKLLDWSKRSHIIAGIARGLLYLHQDSRLRIIHRDLKASNVLLDNTMNPKISDFGLARSFGLDQT  674 (738)
Q Consensus       595 ~~~gsL~~~l~~~~~~~~l~~~~~~~i~~~ia~gL~yLH~~~~~~ivH~DLkp~NILl~~~~~vkL~DfGla~~~~~~~~  674 (738)
                      +++|+|..++..    ..+++..+..++.|++.||.|||+.+   |+||||||+|||++.++.+||+|||+++.+.....
T Consensus        99 ~~gg~L~~~~~~----~~l~~~~~~~i~~qi~~aL~yLH~~~---iiHrDiKp~NILl~~~~~vkl~DFG~a~~~~~~~~  171 (293)
T d1yhwa1          99 LAGGSLTDVVTE----TCMDEGQIAAVCRECLQALEFLHSNQ---VIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQS  171 (293)
T ss_dssp             CTTCBHHHHHHH----SCCCHHHHHHHHHHHHHHHHHHHHTT---EECCCCSGGGEEECTTCCEEECCCTTCEECCSTTC
T ss_pred             CCCCCHHHHHHC----CCCCHHHHHHHHHHHHHHHHHHHHCC---CCCCCCCHHHEEECCCCCEEECCCHHHEEECCCCC
T ss_conf             379808988641----59999999999999999999999879---72267768886887899686425156413213666


Q ss_pred             CCCCCCCCCCCCCCCHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCC
Q ss_conf             545333346667455011037988904589999999999993998999999
Q 004674          675 EANTKRVVGTYGYMSPEYAIDGLFSVKSDVFSFGVLVLEIICGKKNRGFNH  725 (738)
Q Consensus       675 ~~~~~~~~gt~~y~aPE~~~~~~~t~~sDVwSlGviL~elltG~~p~~~~~  725 (738)
                        .....+||+.|+|||++.+..++.++||||+|+++|||++|+.||....
T Consensus       172 --~~~~~~gt~~Y~aPE~~~~~~~~~~~DiwSlGvilyemltG~~Pf~~~~  220 (293)
T d1yhwa1         172 --KRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNEN  220 (293)
T ss_dssp             --CBCCCCSCGGGCCHHHHSSSCBCTHHHHHHHHHHHHHHHHSSCTTTTSC
T ss_pred             --CCCCCCCCCCCCCHHHHCCCCCCCHHCEEHHHHHHHHHHHCCCCCCCCC
T ss_conf             --4444444777368266447998801203137299999804889989979



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1dlpa1 b.78.1.1 (A:1-115) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1b2pa_ b.78.1.1 (A:) Lectin (agglutinin) {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1dlpa2 b.78.1.1 (A:116-235) Fetuin-binding protein Scafet precursor {Bluebell (Scilla campanulata) [TaxId: 81759]} Back     information, alignment and structure
>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]} Back     information, alignment and structure
>d1kj1a_ b.78.1.1 (A:) Lectin (agglutinin) {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xd5a_ b.78.1.1 (A:) Gastrodianin (antifungal protein) {Gastrodia elata [TaxId: 91201]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure