Citrus Sinensis ID: 004725


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730---
MSAPKKRTFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKFGEKLYSGLVTTMTFHLTEICKSIEAAQGGLFLEELNRKWADHNKALQMIRDILMYMDRTFIPSTHKTPVHELGLNLWRDVVIHSSKIQTRLQDTLLELVQRERSGEVINRGLMRNITKMLMDLGSFVYQDDFEKHFLEVSADFYRLESQEFIESCDCGDYLKKAERRLNEEMERVSHYLDARSEAKITNVVEKEMIESHMNRLVHMENSGLVNMLVDDKYEDLGRMYCLFRRVPSGLILIRDVMTSYIRDTGKQLVSDPERLKDPVDFVQRLLDLKDKYDKVINSAFNNDKTFQNALNSSFEYFINLNSRSPEFISLFVDDKLRKGLRGVSEEDVENVLDKVMMLFRFLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSQDTMQGFYASLGAESGDSPTLTVQVLTTGSWPTQPSATCNLPAEIMGICEKFRSYYLGTHTGRRLTWQTNMGTADLKGTFGKGQKHELNVSTYQMCVLMLFNSIDRLSYKEIEQATEIPAPELKRCLQSLACVKGKHVLRKEPMSKDIAEDDAFFFNDKFTSKFVKVKIGTVVAQRESEPENQETRQRVEEDRKPQIEAAIVRIMKARRVLDHNNIVTEVTKQLQSRFLPNPVVIKKRIESLIEREFLERDKVDRKLYRYLA
cccccccccEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHHHHHHHHHcccccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEcccccEEEEEECccccCEEEEEcHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHcccccEECcccccccccccccEEEcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccEEEcc
******R*FQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKFGEKLYSGLVTTMTFHLTEICKSIEAAQGGLFLEELNRKWADHNKALQMIRDILMYMDRTFIPSTHKTPVHELGLNLWRDVVIHSSKIQTRLQDTLLELVQRERSGEVINRGLMRNITKMLMDLGSFVYQDDFEKHFLEVSADFYRLESQEFIESCDCGDYLKKAERRLNEEMERVSHYLDARSEAKITNVVEKEMIESHMNRLVHMENSGLVNMLVDDKYEDLGRMYCLFRRVPSGLILIRDVMTSYIRDTGKQLVSDPERLKDPVDFVQRLLDLKDKYDKVINSAFNNDKTFQNALNSSFEYFINLNSRSPEFISLFVDDKLRKGLRGVSEEDVENVLDKVMMLFRFLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSQDTMQGFYASLGAESGDSPTLTVQVLTTGSWPTQPSATCNLPAEIMGICEKFRSYYLGTHTGRRLTWQTNMGTADLKGTFGKGQKHELNVSTYQMCVLMLFNSIDRLSYKEIEQATEIPAPELKRCLQSLACVKGKHVLRKEPMSKDIAEDDAFFFNDKFTSKFVKVKIGTVVA*****************DRKPQIEAAIVRIMKARRVLDHNNIVTEVTKQLQSRFLPNPVVIKKRIESLIEREFLERDKVDRKLYRYLA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAPKKRTFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELYRNAYNMVLHKFGEKLYSGLVTTMTFHLTEICKSIEAAQGGLFLEELNRKWADHNKALQMIRDILMYMDRTFIPSTHKTPVHELGLNLWRDVVIHSSKIQTRLQDTLLELVQRERSGEVINRGLMRNITKMLMDLGSFVYQDDFEKHFLEVSADFYRLESQEFIESCDCGDYxxxxxxxxxxxxxxxxxxxxxRSEAKITNVVEKEMIESHMNRLVHMENSGLVNMLVDDKYEDLGRMYCLFRRVPSGLILIRDVMTSYIRDTGKQLVSDPERLKDPVDFVQRLLDLKDKYDKVINSAFNNDKTFQNALNSSFEYFINLNSRSPEFISLFVDDKLRKGLRGVSEEDVENVLDKVMMLFRFLQEKDVFEKYYKQHLAKRLLSGKTVSDDAERSLIVKLKTECGYQFTSKLEGMFTDMKTSQDTMQGFYASLGAESGDSPTLTVQVLTTGSWPTQPSATCNLPAEIMGICEKFRSYYLGTHTGRRLTWQTNMGTADLKGTFGKGQKHELNVSTYQMCVLMLFNSIDRLSYKEIEQATEIPAPELKRCLQSLACVKGKHVLRKEPMSKDIAEDDAFFFNDKFTSKFVKVKIGTVVAQRESEPENQETRQRVEEDRKPQIEAAIVRIMKARRVLDHNNIVTEVTKQLQSRFLPNPVVIKKRIESLIEREFLERDKVDRKLYRYLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-3B Component of the cullin-RING ubiquitin ligases (CRL), or CUL3-RBX1-BTB protein E3 ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the CRL complex depends on the BTB domain-containing protein as the susbstrate recognition component. Involved in embryo pattern formation and endosperm development. Required for the normal division and organization of the root stem cells and columella root cap cells. Regulates primary root growth by an unknown pathway, but in an ethylene-dependent manner. Functions in distal root patterning, by an ethylene-independent mechanism. Functionally redundant with CUL3A.confidentQ9C9L0
Cullin-3 Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B). BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition.probableQ13618
Cullin-3 Core component of multiple cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. As a scaffold protein may contribute to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. The E3 ubiquitin-protein ligase activity of the complex is dependent on the neddylation of the cullin subunit and is inhibited by the association of the deneddylated cullin subunit with TIP120A/CAND1 (By similarity). The functional specificity of the BCR complex depends on the BTB domain-containing protein as the susbstrate recognition component. BCR(SPOP) is involved in ubiquitination of BMI1/PCGF4, H2AFY and DAXX, and probably GLI2 or GLI3. BCR(KLHL9-KLHL13) controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. BCR(KLHL3) acts as a regulator of ion transport in the distal nephron; possibly by mediating ubiquitination of SLC12A3/NCC. Involved in ubiquitination of cyclin E and of cyclin D1 (in vitro) thus involved in regulation of G1/S transition (By similarity). BCR(KLHL12) is involved in ER-Golgi transport by regulating the size of COPII coats, thereby playing a key role in collagen export, which is required for embryonic stem (ES) cells division: BCR(KLHL12) acts by mediating monoubiquitination of SEC31 (SEC31A or SEC31B).probableQ9JLV5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AP2, chain B
Confidence level:very confident
Coverage over the Query: 10-372
View the alignment between query and template
View the model in PyMOL
Template: 2HYE, chain C
Confidence level:very confident
Coverage over the Query: 7-733
View the alignment between query and template
View the model in PyMOL