Citrus Sinensis ID: 004782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-
MDIFDGLPISPEKAYLREELARIEVSWVAPRFDSLPHVVHILTSKDREGEVQILKDQNDIIEEVVDEVVHAYHTGFNKAIQNYSQILRLFSESAESIKELKVDLAEAKRRLGTRNKQLHQLWYRSVTLRHIISLLDQIEGIAKVPARIEKLIAGKQYYAAVQLHAQSALMLEREGLQTVGALQDVRSELTKLRGVLFYKVLEDLHAHLYNRGEYSSAVLSMHEMDDEVPTTVAVAYTTNNSQPLSRRTRLKGDNQFGVHGLADGSHSSTFDGHDEDGSLEAHDETSLDGLSIGWLANSTPDEFVEAIRKSDAPLHVKYLQTMVECLCILGKVAAAGAIICQRLRPTIHEIITSKIKAHAQLINSSRSAIGQAAQTGTTGLHFMKGQLRSYQLPKQKRQNGISLSGTLLAVSPVSALMAPMGKAQAAAKELLDSILDSVVRIFENHVVVGELLESRSSRHDINTPKSMIADANWNPDSEASVTGGYSIGFSMTVLQSECQQLICEILRATPEAASADAAVQTARLASKAPSKEKRDGSEDGLTFAFRFTDATISIPNQGADLIRQGWSRRGTNVLQEGYGTAAVLPEQGIYLAASIYRPVLQFTDKVASMLPQKYSQLGNDGLLAFVENFVKDHLLPTMFVDYRKGVQQAISSPAAFRPRAHTAATYVPSIEKGRPVLQGLLAIDFLAKEVLGWAQAMPKFAADLVKYVQTFLERTYERCRTSYMETLLTLE
cccccccccccHHHHHHHHHHHcHHcccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHcccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccHHccccccccccccccHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
************KAYLREELARIEVSWVAPRFDSLPHVVHILTSKDREGEVQILKDQNDIIEEVVDEVVHAYHTGFNKAIQNYSQILRLFSESAESIKELKVDLAEAKRRLGTRNKQLHQLWYRSVTLRHIISLLDQIEGIAKVPARIEKLIAGKQYYAAVQLHAQSALMLEREGLQTVGALQDVRSELTKLRGVLFYKVLEDLHAHLYNRGEYSSAVLSMHE*****************************************************************************DEFVEAIRKSDAPLHVKYLQTMVECLCILGKVAAAGAIICQRLRPTIHEIITSKIKAHAQLINS**********TGTTGLHFMKGQL*************ISLSGTLLAVSPVSALMAPMGKAQAAAKELLDSILDSVVRIFENHVVVGELLESRS****************W******SVTGGYSIGFSMTVLQSECQQLICEILRAT*******************************LTFAFRFTDATISIPNQGADLIRQGWSRRGTNVLQEGYGTAAVLPEQGIYLAASIYRPVLQFTDKVASMLPQKYSQLGNDGLLAFVENFVKDHLLPTMFVDYRKGVQQAISSPAAFRPRAHTAATYVPSIEKGRPVLQGLLAIDFLAKEVLGWAQAMPKFAADLVKYVQTFLERTYERCRTSYMETLLTL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDIFDGLPISPEKAYLREELARIEVSWVAPRFDSLPHVVHILTSKDREGEVQILKDQNDIIEEVVDEVVHAYHTGFNKAIQNYSQILRLxxxxxxxxxxxxxxxxxxxxxxxxxxxxLHQLWYRSVTLRHIISLLDQIEGIAKVPARIEKLIAGKQYYAAVQLHAQSALMLEREGLQTVGALQDVRSELTKLRGVLFYKVLEDLHAHLYNRGEYSSAVLSMHEMDDEVPTTVAVAYTTNNSQPLSRRTRLKGDNQFGVHGLADGSHSSTFDGHDEDGSLEAHDETSLDGLSIGWLANSTPDEFVEAIRKSDAPLHVKYLQTMVECLCILGKVAAAGAIICQRLRPTIHEIITSKIKAHAQLINSSRSAIGQAAQTGTTGLHFMKGQLRSYQLPKQKRQNGISLSGTLLAVSPVSALMAPMGKAQAAAKELLDSILDSVVRIFENHVVVGELLESRSSRHDINTPKSMIADANWNPDSEASVTGGYSIGFSMTVLQSECQQLICEILRATPEAASADAAVQTARLASKAPSKEKRDGSEDGLTFAFRFTDATISIPNQGADLIRQGWSRRGTNVLQEGYGTAAVLPEQGIYLAASIYRPVLQFTDKVASMLPQKYSQLGNDGLLAFVENFVKDHLLPTMFVDYRKGVQQAISSPAAFRPRAHTAATYVPSIEKGRPVLQGLLAIDFLAKEVLGWAQAMPKFAADLVKYVQTFLERTYERCRTSYMETLLTLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable exocyst complex component 4 Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.probableQ93YU5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D2S, chain A
Confidence level:probable
Coverage over the Query: 136-204
View the alignment between query and template
View the model in PyMOL