Citrus Sinensis ID: 004811


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------73
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHcccccHHHHcccHHHHHHHHHHccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccc
cccEEEccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccHHHHHHHccccccEEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHcccHHHHHHcc
mpgiimddiheegvvselngnstpvkensvsnkspkstpcpqsprdqpdgegvdTSIEQLYENVcdmqssdqspsrhsfgsdgeesriDSELRHlvggemreveimeeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpglgpLLLKQARELISSGDNPQKALELALRAAKSfeigangkpsLELVMCLHVIAAIYCSlgqyneaipvleqsieipvieeGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQkqvlgetdprvGETCRYLAEAHVQALQFSEAQKFCQMALDIhkdngspaslEEAADRRLMGLICETKGDHEAALEHLVLASMTMIAndqdaevasvdcsigdtylslsrydEAGFAYQKALTAFktnkgenhpaVASVFVRLADMYNrtgklreskSYCENALRiyekpvpgvppeeiasgltdVSSIYESMNELEQAIKLLQKALKIyndapgqqstvAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEqecgpyhpdtlgvysnLAGTYDAIGRLDDAIEILEFVVGIREeklgtanpdvdDEKRRLAELLKEAGRVRSRKAQSLETLLDANsrvnndgielcygt
mpgiimddihEEGVVSelngnstpvkensvsnkspkstpcpqsprdqpdGEGVDTSIEQLYENVCDMQSSDQSPSRhsfgsdgeesridsELRHLVGGEMREVEIMEeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpgLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAfktnkgenhpAVASVFVRLADMYNRtgklresksyCENALRIyekpvpgvppeEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIReeklgtanpdvddeKRRLAELLKeagrvrsrkaqsletlldansrvnndgielcygt
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGemreveimeeeevekpeDDshsissskkgsssgskksgkleksqsAGTksissghskkvshsgMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAgldkpglgplllkQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
***************************************************************************************************************************************************************************************************************************************************LALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH**************RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGV****IASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREE*******************************************************
*PGI****I************************************************EQLYE***********************SRIDSELRHLVGGEMREV***********************GSSSGSKKSGKLE*******************************N*****LPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANS**NNDG****YG*
MPGIIMDDIHEEGVVSELNGN******************************GVDTSIEQLYENVC***********************DSELRHLVGGEMREVEIM*************************************************************************KPPIDKG*************************EAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
********IHE***********************************QPDGEGVDTSIEQLYENVCDMQ******************RIDSELRHLVGGEMREVEIMEEEEVEK****************************************************************************************************GLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIELCYGT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDxxxxxxxxxxxxxxxxxxxxxKAQSLETLLDANSRVNNDGIELCYGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query729 2.2.26 [Sep-21-2011]
Q7Z4941330 Nephrocystin-3 OS=Homo sa yes no 0.334 0.183 0.240 7e-14
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.337 0.187 0.232 9e-13
Q7TNH61325 Nephrocystin-3 OS=Mus mus yes no 0.334 0.184 0.229 6e-12
Q6AZT71300 Nephrocystin-3 OS=Xenopus N/A no 0.358 0.200 0.226 2e-11
Q5PQM2619 Kinesin light chain 4 OS= no no 0.215 0.253 0.276 1e-10
Q9DBS5619 Kinesin light chain 4 OS= no no 0.213 0.252 0.278 3e-10
P46822540 Kinesin light chain OS=Ca no no 0.322 0.435 0.254 3e-10
Q9NSK0619 Kinesin light chain 4 OS= no no 0.215 0.253 0.270 6e-10
P0CI651303 Nephrocystin-3 OS=Danio r yes no 0.355 0.198 0.229 7e-10
Q2HJJ0616 Kinesin light chain 4 OS= no no 0.213 0.253 0.265 9e-10
>sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1 Back     alignment and function desciption
 Score = 79.7 bits (195), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 67/279 (24%), Positives = 118/279 (42%), Gaps = 35/279 (12%)

Query: 438  IGDTYLSLSRY-------DEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKL 490
            + D Y +L R+        +A    Q++L   +T    +HP VA    +LA +Y +  K 
Sbjct: 942  LADLYETLGRFLKDLGLLSQAIVPLQRSLEIRETALDPDHPRVAQSLHQLASVYVQWKKF 1001

Query: 491  RESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDA 550
              ++   + AL I E    G      A  L  ++++Y+  N+ EQA    +K+ KI+  A
Sbjct: 1002 GNAEQLYKQALEISENAY-GADHPYTARELEALATLYQKQNKYEQAEHFRKKSFKIHQKA 1060

Query: 551  PGQQSTVAGIEA-------------------------QMGVMYYMLGNYSDSYDSFKNAI 585
              ++  + G                            ++GV+YY+  N   +    K ++
Sbjct: 1061 IKKKGNLYGFALLRRRALQLEELTLGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSL 1120

Query: 586  S-KLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGV 644
              + R +G         +LN +   C ++   ++A EL+E A  I  +   P HP     
Sbjct: 1121 EMRERVLGPDHPDC-AQSLNNLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYT 1179

Query: 645  YSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDV 683
              +LA  Y  +G+LD A+ + E  V IR++  G  +P V
Sbjct: 1180 VKHLAILYKKMGKLDKAVPLYELAVEIRQKSFGPKHPSV 1218




Required for normal ciliary development and function. Inhibits disheveled-1-induced canonical Wnt-signaling activity and may also play a role in the control of non-canonical Wnt signaling which regulates planar cell polarity. Probably acts as a molecular switch between different Wnt signaling pathways. Required for proper convergent extension cell movements.
Homo sapiens (taxid: 9606)
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function description
>sp|Q7TNH6|NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus GN=Nphp3 PE=1 SV=2 Back     alignment and function description
>sp|Q6AZT7|NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis GN=nphp3 PE=2 SV=1 Back     alignment and function description
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function description
>sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 Back     alignment and function description
>sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|P0CI65|NPHP3_DANRE Nephrocystin-3 OS=Danio rerio GN=nphp3 PE=3 SV=1 Back     alignment and function description
>sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
255540685767 kinesin light chain, putative [Ricinus c 0.991 0.942 0.791 0.0
359491584757 PREDICTED: uncharacterized protein LOC10 0.983 0.947 0.782 0.0
449477406736 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.987 0.978 0.738 0.0
449440678736 PREDICTED: uncharacterized protein LOC10 0.987 0.978 0.736 0.0
356507244761 PREDICTED: uncharacterized protein LOC10 0.984 0.943 0.707 0.0
356518977753 PREDICTED: uncharacterized protein LOC10 0.983 0.952 0.696 0.0
224133522624 predicted protein [Populus trichocarpa] 0.850 0.993 0.772 0.0
357461993767 Kinesin light chain [Medicago truncatula 0.986 0.937 0.664 0.0
359488843710 PREDICTED: uncharacterized protein LOC10 0.950 0.976 0.678 0.0
357461995795 Kinesin light chain [Medicago truncatula 0.986 0.904 0.664 0.0
>gi|255540685|ref|XP_002511407.1| kinesin light chain, putative [Ricinus communis] gi|223550522|gb|EEF52009.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1144 bits (2959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/764 (79%), Positives = 660/764 (86%), Gaps = 41/764 (5%)

Query: 1   MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQ---------PDGE 51
           MPGI+MD  +EE +V+E+N NS P+KEN++SNKSP+ST  PQSP            P GE
Sbjct: 1   MPGIVMDGNNEEAIVNEMNDNSVPIKENAMSNKSPRSTLSPQSPCSNSVDLPAGGVPVGE 60

Query: 52  --------------------GVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSE 91
                               GVDTSIEQLYENVCDMQSSD SPSRHSFGSDGEESRIDSE
Sbjct: 61  LTVDEVVVNEVAADETSVHGGVDTSIEQLYENVCDMQSSDLSPSRHSFGSDGEESRIDSE 120

Query: 92  LRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISS 151
           LRHLVGGEMREVEIM+EEEV+KPE+D+HS SSSKKGSSSGSKKSGKL K+QSA + SISS
Sbjct: 121 LRHLVGGEMREVEIMQEEEVDKPENDTHSNSSSKKGSSSGSKKSGKLNKNQSASSNSISS 180

Query: 152 GHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDK----GVKKSNAGATPMKKRKG----- 202
             SKK SH  +DSE SSK + K KS PEKPPIDK      KK+N G    KK +      
Sbjct: 181 NTSKKDSHIILDSEASSKLSPKSKSPPEKPPIDKRNDKNFKKANGGVKSTKKWRNSPLGG 240

Query: 203 -KLHKG-QDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKP 260
            KL  G +D S++GL  P LG  LLKQ+R+LISSGDNPQKALELALRA+KSFEI ANGKP
Sbjct: 241 KKLQNGVEDSSDSGLGNPDLGRFLLKQSRDLISSGDNPQKALELALRASKSFEICANGKP 300

Query: 261 SLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 320
           SLELVM LHV+AAIYCS+GQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM
Sbjct: 301 SLELVMSLHVVAAIYCSVGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 360

Query: 321 LGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH 380
           LGQLENS  CYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQF +A++ CQMALDIH
Sbjct: 361 LGQLENSTKCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFDDAKRLCQMALDIH 420

Query: 381 KDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGD 440
           ++NG+PAS EEAADRRLMGLICETKGDHEAALEHLVLASM M+AN Q+AEVASVDCSIGD
Sbjct: 421 RENGAPASPEEAADRRLMGLICETKGDHEAALEHLVLASMAMVANGQEAEVASVDCSIGD 480

Query: 441 TYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENA 500
           TYLSLSRYDEA FAYQKALTAFKT KGENHPAVA+VFVRLAD+YN+TGKLR+SKSYCENA
Sbjct: 481 TYLSLSRYDEAVFAYQKALTAFKTTKGENHPAVAAVFVRLADLYNKTGKLRDSKSYCENA 540

Query: 501 LRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGI 560
           LRIYEKP PG+PPEEIASGLTDVS+IYESMNELEQAIKLLQKALKIYNDAPGQQST+AGI
Sbjct: 541 LRIYEKPAPGIPPEEIASGLTDVSAIYESMNELEQAIKLLQKALKIYNDAPGQQSTIAGI 600

Query: 561 EAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAV 620
           EAQMGVMYYMLGNYS+SY++FKNA+SKLRA GERKSAFFG+ALNQMGLACVQRYSINEA 
Sbjct: 601 EAQMGVMYYMLGNYSESYNTFKNAVSKLRASGERKSAFFGIALNQMGLACVQRYSINEAA 660

Query: 621 ELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTAN 680
           ELFEEA+SILEQECGPYHPDTLGVYSNLAGTYDA+GRLDDAIEILE VVG+REEKLGTAN
Sbjct: 661 ELFEEAKSILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILELVVGMREEKLGTAN 720

Query: 681 PDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSR-VNNDGI 723
           PDVDDEK+RLAELLKEAGRVRSRK +SLE LLD+NS  ++  GI
Sbjct: 721 PDVDDEKKRLAELLKEAGRVRSRKGRSLENLLDSNSHSIDKAGI 764




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491584|ref|XP_002279663.2| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449477406|ref|XP_004155014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440678|ref|XP_004138111.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507244|ref|XP_003522379.1| PREDICTED: uncharacterized protein LOC100791625 [Glycine max] Back     alignment and taxonomy information
>gi|356518977|ref|XP_003528151.1| PREDICTED: uncharacterized protein LOC100783201 [Glycine max] Back     alignment and taxonomy information
>gi|224133522|ref|XP_002321593.1| predicted protein [Populus trichocarpa] gi|222868589|gb|EEF05720.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357461993|ref|XP_003601278.1| Kinesin light chain [Medicago truncatula] gi|355490326|gb|AES71529.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|359488843|ref|XP_002274441.2| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera] Back     alignment and taxonomy information
>gi|357461995|ref|XP_003601279.1| Kinesin light chain [Medicago truncatula] gi|355490327|gb|AES71530.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query729
TAIR|locus:2015959650 KLCR3 "AT1G27500" [Arabidopsis 0.753 0.844 0.680 5.2e-210
TAIR|locus:2086834663 KLCR2 "kinesin light chain-rel 0.761 0.837 0.641 3.7e-207
TAIR|locus:2123411609 KLCR1 "kinesin light chain-rel 0.670 0.802 0.654 6.5e-177
TAIR|locus:2042506617 AT2G31240 "AT2G31240" [Arabido 0.636 0.752 0.276 1.9e-42
ASPGD|ASPL00000183131288 AN3547 [Emericella nidulans (t 0.572 0.323 0.222 6.9e-20
UNIPROTKB|Q5LU72374 SPO1186 "TPR domain protein" [ 0.352 0.687 0.254 1.5e-13
TIGR_CMR|SPO_1186374 SPO_1186 "TPR domain protein" 0.352 0.687 0.254 1.5e-13
ASPGD|ASPL00000469941262 AN9426 [Emericella nidulans (t 0.641 0.370 0.211 2.7e-13
ASPGD|ASPL00000615671185 AN1071 [Emericella nidulans (t 0.589 0.362 0.223 2.4e-12
ASPGD|ASPL0000010369 1488 tprA [Emericella nidulans (tax 0.600 0.294 0.221 2.5e-12
TAIR|locus:2015959 KLCR3 "AT1G27500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1897 (672.8 bits), Expect = 5.2e-210, Sum P(2) = 5.2e-210
 Identities = 382/561 (68%), Positives = 450/561 (80%)

Query:   165 EVSSKTNSKGKSL---P---EKPPIDKGVKKSNAGATPMKKRK-G--KLHKGQDVSEAXX 215
             E   K+NS    L   P   EK    K V KSN G   M+K+K G  KL  G +  E   
Sbjct:    84 EFDVKSNSSNLDLEVMPRDMEKQTGKKNVTKSNVGVGGMRKKKVGGTKLQNGNE--EPSS 141

Query:   216 XXXXXXXXXXXQARELISSGDNPQKALELALRAAKSFEIGA-NGKPSLELVMCLHVIAAI 274
                        QAR L+SSGD+  KALEL  RAAK FE  A NGKP LE +MCLHV AA+
Sbjct:   142 ENVELARFLLNQARNLVSSGDSTHKALELTHRAAKLFEASAENGKPCLEWIMCLHVTAAV 201

Query:   275 YCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTG 334
             +C L +YNEAIPVL++S+EIPV+EEG+EHALAKFAG MQLGDTYAM+GQLE+S+ CYT G
Sbjct:   202 HCKLKEYNEAIPVLQRSVEIPVVEEGEEHALAKFAGLMQLGDTYAMVGQLESSISCYTEG 261

Query:   335 LEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAAD 394
             L +QK+VLGE DPRVGETCRYLAEA VQAL+F EAQ+ C+ AL IH+++G P S+ EAAD
Sbjct:   262 LNIQKKVLGENDPRVGETCRYLAEALVQALRFDEAQQVCETALSIHRESGLPGSIAEAAD 321

Query:   395 RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFA 454
             RRLMGLICETKGDHE ALEHLVLASM M AN Q++EVA VD SIGD+YLSLSR+DEA  A
Sbjct:   322 RRLMGLICETKGDHENALEHLVLASMAMAANGQESEVAFVDTSIGDSYLSLSRFDEAICA 381

Query:   455 YQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPE 514
             YQK+LTA KT KGENHPAV SV++RLAD+YNRTGK+RE+KSYCENALRIYE     + PE
Sbjct:   382 YQKSLTALKTAKGENHPAVGSVYIRLADLYNRTGKVREAKSYCENALRIYESHNLEISPE 441

Query:   515 EIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNY 574
             EIASGLTD+S I ESMNE+EQAI LLQKALKIY D+PGQ+  +AGIEAQMGV+YYM+G Y
Sbjct:   442 EIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMMGKY 501

Query:   575 SDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQEC 634
              +SY++FK+AISKLRA G+++S FFG+ALNQMGLAC+Q  +I EAVELFEEA+ ILEQEC
Sbjct:   502 MESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILEQEC 561

Query:   635 GPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELL 694
             GPYHP+TLG+YSNLAG YDAIGRLDDAI++L  VVG+REEKLGTANP  +DEKRRLA+LL
Sbjct:   562 GPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLAQLL 621

Query:   695 KEAGRVRSRKAQSLETLLDAN 715
             KEAG V  RKA+SL+TL+D++
Sbjct:   622 KEAGNVTGRKAKSLKTLIDSD 642


GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2086834 KLCR2 "kinesin light chain-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123411 KLCR1 "kinesin light chain-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042506 AT2G31240 "AT2G31240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q5LU72 SPO1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1186 SPO_1186 "TPR domain protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ASPGD|ASPL0000046994 AN9426 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061567 AN1071 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000010369 tprA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-09
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 6e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 1e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-06
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
pfam1337442 pfam13374, TPR_10, Tetratricopeptide repeat 5e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-04
pfam05793528 pfam05793, TFIIF_alpha, Transcription initiation f 0.004
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 57.4 bits (139), Expect = 3e-10
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 17/111 (15%)

Query: 436 CSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKS 495
            ++G+ Y  L  YDEA   Y+KAL     N        A  +  LA  Y + GK  E+  
Sbjct: 4   LNLGNLYYKLGDYDEALEYYEKALELDPDN--------ADAYYNLAAAYYKLGKYEEALE 55

Query: 496 YCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKI 546
             E AL +             A    ++   Y  + + E+A++  +KAL++
Sbjct: 56  DYEKALELDPDN---------AKAYYNLGLAYYKLGKYEEALEAYEKALEL 97


Length = 100

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205553 pfam13374, TPR_10, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|218752 pfam05793, TFIIF_alpha, Transcription initiation factor IIF, alpha subunit (TFIIF-alpha) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 729
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.98
KOG0547606 consensus Translocase of outer mitochondrial membr 99.97
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.95
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
KOG2003 840 consensus TPR repeat-containing protein [General f 99.93
PRK14574 822 hmsH outer membrane protein; Provisional 99.91
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.91
KOG1126638 consensus DNA-binding cell division cycle control 99.91
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.91
KOG2003 840 consensus TPR repeat-containing protein [General f 99.91
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.9
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.89
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.88
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.88
PLN03218 1060 maturation of RBCL 1; Provisional 99.87
KOG2076 895 consensus RNA polymerase III transcription factor 99.87
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
PRK14574 822 hmsH outer membrane protein; Provisional 99.87
KOG2076 895 consensus RNA polymerase III transcription factor 99.86
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 99.84
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.84
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.83
PLN03077 857 Protein ECB2; Provisional 99.82
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.82
PRK04841903 transcriptional regulator MalT; Provisional 99.82
PRK04841 903 transcriptional regulator MalT; Provisional 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.79
PLN03077 857 Protein ECB2; Provisional 99.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.78
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.78
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.76
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.74
PRK12370553 invasion protein regulator; Provisional 99.73
KOG1941518 consensus Acetylcholine receptor-associated protei 99.73
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.73
PRK12370553 invasion protein regulator; Provisional 99.72
KOG1941518 consensus Acetylcholine receptor-associated protei 99.72
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.72
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.72
PRK11189296 lipoprotein NlpI; Provisional 99.71
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.71
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.7
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.7
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.69
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.69
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.69
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.69
KOG1125579 consensus TPR repeat-containing protein [General f 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.68
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.68
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.68
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.67
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.67
KOG1125579 consensus TPR repeat-containing protein [General f 99.66
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.64
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.63
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.61
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.59
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.52
PLN02789320 farnesyltranstransferase 99.51
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.47
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.46
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.44
PLN02789320 farnesyltranstransferase 99.41
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.39
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.39
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.35
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.33
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.32
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.31
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.3
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.26
PRK15359144 type III secretion system chaperone protein SscB; 99.26
PRK15359144 type III secretion system chaperone protein SscB; 99.24
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.22
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.22
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.2
PRK10370198 formate-dependent nitrite reductase complex subuni 99.2
KOG1128777 consensus Uncharacterized conserved protein, conta 99.2
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.19
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.19
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.16
KOG1128777 consensus Uncharacterized conserved protein, conta 99.1
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.09
PRK10370198 formate-dependent nitrite reductase complex subuni 99.08
KOG0553 304 consensus TPR repeat-containing protein [General f 99.07
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.05
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.04
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.03
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.03
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.02
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.01
KOG0553304 consensus TPR repeat-containing protein [General f 99.01
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 99.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.0
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.99
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.97
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.96
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.95
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.95
KOG1585308 consensus Protein required for fusion of vesicles 98.93
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.92
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.9
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.89
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.86
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.85
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.82
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.82
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.81
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.81
KOG2471696 consensus TPR repeat-containing protein [General f 98.8
KOG1585308 consensus Protein required for fusion of vesicles 98.8
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.8
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.79
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.78
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.77
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.77
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.76
KOG1586288 consensus Protein required for fusion of vesicles 98.76
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.75
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.73
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.73
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.71
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.7
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.69
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.68
KOG1586288 consensus Protein required for fusion of vesicles 98.67
PRK10803263 tol-pal system protein YbgF; Provisional 98.66
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.66
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.64
COG3898531 Uncharacterized membrane-bound protein [Function u 98.63
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.62
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.6
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.59
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.58
KOG2471696 consensus TPR repeat-containing protein [General f 98.58
PF12688120 TPR_5: Tetratrico peptide repeat 98.56
PF12688120 TPR_5: Tetratrico peptide repeat 98.52
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.52
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.51
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.51
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.5
PRK10803263 tol-pal system protein YbgF; Provisional 98.48
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.46
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.45
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.44
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.42
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.39
KOG4234271 consensus TPR repeat-containing protein [General f 98.38
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.38
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.37
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.36
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.36
KOG4555175 consensus TPR repeat-containing protein [Function 98.35
KOG4555175 consensus TPR repeat-containing protein [Function 98.34
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.33
KOG4234271 consensus TPR repeat-containing protein [General f 98.32
PRK11906458 transcriptional regulator; Provisional 98.29
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.29
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.29
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.29
PF13512142 TPR_18: Tetratricopeptide repeat 98.27
PRK11906458 transcriptional regulator; Provisional 98.26
PRK15331165 chaperone protein SicA; Provisional 98.25
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.25
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.23
PRK15331165 chaperone protein SicA; Provisional 98.23
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.22
COG4700251 Uncharacterized protein conserved in bacteria cont 98.21
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.18
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.16
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.15
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.14
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.12
COG4700251 Uncharacterized protein conserved in bacteria cont 98.11
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.1
PF13512142 TPR_18: Tetratricopeptide repeat 98.09
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.09
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.08
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.07
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 98.07
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.06
PF1337173 TPR_9: Tetratricopeptide repeat 98.05
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.03
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 98.01
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.01
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.94
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.94
PF1337173 TPR_9: Tetratricopeptide repeat 97.91
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.9
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.9
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.9
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.85
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.85
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.84
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.83
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.83
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.81
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.75
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.71
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.68
KOG20411189 consensus WD40 repeat protein [General function pr 97.65
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.65
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.64
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.62
KOG1550552 consensus Extracellular protein SEL-1 and related 97.59
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.58
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.53
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.52
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.52
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.51
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.5
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.48
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.46
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.45
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.45
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.43
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.42
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.41
KOG20411189 consensus WD40 repeat protein [General function pr 97.41
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.39
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.38
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.38
KOG1550552 consensus Extracellular protein SEL-1 and related 97.36
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.33
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.28
PF1342844 TPR_14: Tetratricopeptide repeat 97.27
PF1342844 TPR_14: Tetratricopeptide repeat 97.24
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.24
KOG1258577 consensus mRNA processing protein [RNA processing 97.22
KOG1258577 consensus mRNA processing protein [RNA processing 97.15
PF1343134 TPR_17: Tetratricopeptide repeat 97.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.09
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.07
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.05
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.02
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 96.97
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.96
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.9
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.89
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.86
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.85
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.75
PF1343134 TPR_17: Tetratricopeptide repeat 96.72
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.66
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.65
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.64
KOG4814872 consensus Uncharacterized conserved protein [Funct 96.52
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.5
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 96.46
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.27
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.23
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.09
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.06
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 96.02
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.93
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.83
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.82
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 95.78
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.72
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.61
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 95.58
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 95.54
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.53
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 95.33
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.33
KOG1308 377 consensus Hsp70-interacting protein Hip/Transient 95.33
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.14
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 95.08
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.03
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.99
PRK14707 2710 hypothetical protein; Provisional 94.95
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 94.93
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 94.86
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 94.76
KOG2581493 consensus 26S proteasome regulatory complex, subun 94.76
COG5187412 RPN7 26S proteasome regulatory complex component, 94.76
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.72
KOG2581493 consensus 26S proteasome regulatory complex, subun 94.68
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.67
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 94.57
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.5
PRK14707 2710 hypothetical protein; Provisional 94.49
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.48
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.42
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.42
KOG0687393 consensus 26S proteasome regulatory complex, subun 94.39
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 94.28
KOG4507 886 consensus Uncharacterized conserved protein, conta 94.21
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.91
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.78
PRK10941269 hypothetical protein; Provisional 93.78
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.72
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.66
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 93.62
COG5187412 RPN7 26S proteasome regulatory complex component, 93.44
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 93.35
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.16
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.12
COG3947361 Response regulator containing CheY-like receiver a 93.0
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.84
COG3629280 DnrI DNA-binding transcriptional activator of the 92.74
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 92.53
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.52
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.44
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 92.31
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.29
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 91.96
COG4976 287 Predicted methyltransferase (contains TPR repeat) 91.95
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.9
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 91.28
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.26
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 91.17
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 91.09
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 90.97
KOG2422665 consensus Uncharacterized conserved protein [Funct 90.87
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 90.79
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 90.77
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 90.7
COG4649221 Uncharacterized protein conserved in bacteria [Fun 90.42
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 90.38
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.2
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 90.17
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 89.89
PRK10941269 hypothetical protein; Provisional 89.61
KOG4014248 consensus Uncharacterized conserved protein (conta 89.55
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 89.49
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 89.37
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 89.34
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.34
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 89.3
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 88.95
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.52
KOG1310758 consensus WD40 repeat protein [General function pr 88.35
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 88.16
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 88.08
KOG3364149 consensus Membrane protein involved in organellar 87.69
COG3629280 DnrI DNA-binding transcriptional activator of the 87.55
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 87.45
KOG2908380 consensus 26S proteasome regulatory complex, subun 87.13
COG1747 711 Uncharacterized N-terminal domain of the transcrip 87.06
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 86.96
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 86.93
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 86.68
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 86.52
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 86.48
KOG2908380 consensus 26S proteasome regulatory complex, subun 86.3
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 85.79
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 85.45
PF05053618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 85.4
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 84.92
KOG1310 758 consensus WD40 repeat protein [General function pr 84.91
KOG2422665 consensus Uncharacterized conserved protein [Funct 84.85
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 84.79
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 84.66
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.29
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 84.24
KOG4014248 consensus Uncharacterized conserved protein (conta 83.48
COG4976 287 Predicted methyltransferase (contains TPR repeat) 82.65
PF0421269 MIT: MIT (microtubule interacting and transport) d 82.48
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 82.3
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 81.7
PRK09169 2316 hypothetical protein; Validated 80.76
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.19
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 80.05
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.5e-45  Score=363.62  Aligned_cols=426  Identities=20%  Similarity=0.275  Sum_probs=275.6

Q ss_pred             cccccCcccccCCCCCCChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCCh
Q 004811          202 GKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQY  281 (729)
Q Consensus       202 ~~~~a~~~~~~~~~~~p~~~~~l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~  281 (729)
                      +|.++.+--.-....+|.....++.++..+++..+ +++....-..|++..         |..+.+|.++|.++...|++
T Consensus        63 d~~~a~~h~nmv~~~d~t~~~~llll~ai~~q~~r-~d~s~a~~~~a~r~~---------~q~ae~ysn~aN~~kerg~~  132 (966)
T KOG4626|consen   63 DYKQAEKHCNMVGQEDPTNTERLLLLSAIFFQGSR-LDKSSAGSLLAIRKN---------PQGAEAYSNLANILKERGQL  132 (966)
T ss_pred             CHHHHHHHHhHhhccCCCcccceeeehhhhhcccc-hhhhhhhhhhhhhcc---------chHHHHHHHHHHHHHHhchH
Confidence            33333333333444444444444444444444443 455544444444432         44566666677777777777


Q ss_pred             HHHHHHHHHhcccchhhccccchHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHH
Q 004811          282 NEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHV  361 (729)
Q Consensus       282 ~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~  361 (729)
                      ++|+.+|+.++++.         +..+.+|.++|.++...|+.+.|..+|..++++        +|...-+...+|.++.
T Consensus       133 ~~al~~y~~aiel~---------p~fida~inla~al~~~~~~~~a~~~~~~alql--------nP~l~ca~s~lgnLlk  195 (966)
T KOG4626|consen  133 QDALALYRAAIELK---------PKFIDAYINLAAALVTQGDLELAVQCFFEALQL--------NPDLYCARSDLGNLLK  195 (966)
T ss_pred             HHHHHHHHHHHhcC---------chhhHHHhhHHHHHHhcCCCcccHHHHHHHHhc--------CcchhhhhcchhHHHH
Confidence            77777777776664         123445667777777777777777777777766        5666666666777776


Q ss_pred             HhcCHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHH
Q 004811          362 QALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDT  441 (729)
Q Consensus       362 ~~g~~~~A~~~~~~al~~~~~~~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~  441 (729)
                      ..|+..+|..+|.+|++..+..        +.+|.+||.++...|+...|+.+|++|+.      .+|....+|++||.+
T Consensus       196 a~Grl~ea~~cYlkAi~~qp~f--------AiawsnLg~~f~~~Gei~~aiq~y~eAvk------ldP~f~dAYiNLGnV  261 (966)
T KOG4626|consen  196 AEGRLEEAKACYLKAIETQPCF--------AIAWSNLGCVFNAQGEIWLAIQHYEEAVK------LDPNFLDAYINLGNV  261 (966)
T ss_pred             hhcccchhHHHHHHHHhhCCce--------eeeehhcchHHhhcchHHHHHHHHHHhhc------CCCcchHHHhhHHHH
Confidence            6777777777777776665533        34566677777777777777777766654      356666667777777


Q ss_pred             HHHcCCHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHH
Q 004811          442 YLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLT  521 (729)
Q Consensus       442 ~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~  521 (729)
                      |...+.|+.|+..|.+|+.+        .|..+.++.++|.+|..+|..+-|+..|++++++         .|....+++
T Consensus       262 ~ke~~~~d~Avs~Y~rAl~l--------rpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~---------~P~F~~Ay~  324 (966)
T KOG4626|consen  262 YKEARIFDRAVSCYLRALNL--------RPNHAVAHGNLACIYYEQGLLDLAIDTYKRALEL---------QPNFPDAYN  324 (966)
T ss_pred             HHHHhcchHHHHHHHHHHhc--------CCcchhhccceEEEEeccccHHHHHHHHHHHHhc---------CCCchHHHh
Confidence            77777777777777777666        5666667777777777777777777777777666         444556677


Q ss_pred             HHHHHHHhcchHHHHHHHHHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHH
Q 004811          522 DVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGV  601 (729)
Q Consensus       522 ~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~  601 (729)
                      +||..+...|+..+|..+|.+++.+.+..       +.+.++||.+|..+|.+++|..+|.++++..        +..+.
T Consensus       325 NlanALkd~G~V~ea~~cYnkaL~l~p~h-------adam~NLgni~~E~~~~e~A~~ly~~al~v~--------p~~aa  389 (966)
T KOG4626|consen  325 NLANALKDKGSVTEAVDCYNKALRLCPNH-------ADAMNNLGNIYREQGKIEEATRLYLKALEVF--------PEFAA  389 (966)
T ss_pred             HHHHHHHhccchHHHHHHHHHHHHhCCcc-------HHHHHHHHHHHHHhccchHHHHHHHHHHhhC--------hhhhh
Confidence            77777777777777777777777666555       4566667777777777777777777766653        22456


Q ss_pred             HHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCCh
Q 004811          602 ALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANP  681 (729)
Q Consensus       602 ~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~g~~~p  681 (729)
                      +.++||.+|.++|++++|+.+|++++.+        .|..++++.++|..|..+|+...|+..|.+|+.+        +|
T Consensus       390 a~nNLa~i~kqqgnl~~Ai~~YkealrI--------~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~--------nP  453 (966)
T KOG4626|consen  390 AHNNLASIYKQQGNLDDAIMCYKEALRI--------KPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQI--------NP  453 (966)
T ss_pred             hhhhHHHHHHhcccHHHHHHHHHHHHhc--------CchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhc--------Cc
Confidence            6666777777777777777777777766        6666777777777777777777777777777665        56


Q ss_pred             hHHHHHHHHHHHHHHhCCHhHHHHHHHHHHHhhccc
Q 004811          682 DVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSR  717 (729)
Q Consensus       682 ~~~~~~~~La~~~~~~g~~~~A~~~~l~~al~~~p~  717 (729)
                      ..++++.+||.+|...|+..+|+ ..|+.+|+++|+
T Consensus       454 t~AeAhsNLasi~kDsGni~~AI-~sY~~aLklkPD  488 (966)
T KOG4626|consen  454 TFAEAHSNLASIYKDSGNIPEAI-QSYRTALKLKPD  488 (966)
T ss_pred             HHHHHHhhHHHHhhccCCcHHHH-HHHHHHHccCCC
Confidence            66777777777777777777776 777777777666



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PRK09169 hypothetical protein; Validated Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 6e-10
3ceq_A 283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 8e-05
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 9e-10
3edt_B 283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 7e-05
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-08
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-05
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 42/159 (26%), Positives = 80/159 (50%), Gaps = 2/159 (1%) Query: 430 EVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGK 489 +VA++ + Y ++Y EA AL + G++HPAVA+ LA +Y + GK Sbjct: 41 DVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGK 100 Query: 490 LRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYND 549 +E++ C+ AL I EK + P ++A L++++ + ++ + E+ ++AL+IY Sbjct: 101 YKEAEPLCKRALEIREKVLGKFHP-DVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYAT 159 Query: 550 APG-QQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISK 587 G VA + + Y G Y D+ +K +++ Sbjct: 160 RLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTR 198
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query729
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-42
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 4e-29
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-25
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 1e-19
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-08
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-37
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-17
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-13
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-23
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 3e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-36
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 3e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-08
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 6e-34
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 9e-30
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-21
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 7e-33
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-25
3q15_A378 PSP28, response regulator aspartate phosphatase H; 3e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 7e-23
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-16
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 3e-26
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-18
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-23
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-23
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-18
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-16
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-23
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-21
4g1t_A472 Interferon-induced protein with tetratricopeptide 2e-10
4g1t_A 472 Interferon-induced protein with tetratricopeptide 3e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-23
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 6e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 1e-22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-16
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-09
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-22
2gw1_A514 Mitochondrial precursor proteins import receptor; 5e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-20
2gw1_A514 Mitochondrial precursor proteins import receptor; 8e-16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 2e-22
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-21
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 4e-17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-14
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-21
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-10
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-09
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 8e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 3e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A 272 TPR repeat-containing protein; structural genomics 2e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-16
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-08
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-10
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 1e-07
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-06
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 6e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 2e-15
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-10
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 6e-14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 1e-12
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-08
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-13
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 4e-07
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-05
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-13
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 6e-13
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 5e-11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 7e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-12
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 6e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 6e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-10
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 6e-07
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-04
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-11
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 2e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-06
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-05
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-10
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-07
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 4e-05
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-09
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-07
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 1e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-04
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 2e-08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-06
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 8e-05
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 1e-07
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 8e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 2e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 7e-07
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-04
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 3e-05
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 9e-04
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 5e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-04
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 8e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 4e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 8e-04
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
 Score =  158 bits (401), Expect = 2e-42
 Identities = 67/421 (15%), Positives = 132/421 (31%), Gaps = 42/421 (9%)

Query: 266 MCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLE 325
           + L +     C  G     +   E ++++     G E      A + QLG+ Y  L    
Sbjct: 10  LELALEGERLCKSGDCRAGVSFFEAAVQV-----GTEDLKTLSAIYSQLGNAYFYLHDYA 64

Query: 326 NSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS 385
            +L  +   L + + +  +      +    L         F EA   CQ  LDI ++   
Sbjct: 65  KALEYHHHDLTLARTIGDQLG--EAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELND 122

Query: 386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSL 445
                EA     +G +   KG          +        D                   
Sbjct: 123 KVG--EARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDA------------------ 162

Query: 446 SRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYE 505
                A   Y++ L+        +  A    F  L + +   G  R++    E  L I +
Sbjct: 163 --LQAAVDFYEENLSLVT--ALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAK 218

Query: 506 KPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMG 565
           +   G    E     +++ + Y  + E E A +  +K L +       ++  A     +G
Sbjct: 219 E--FGDKAAE-RRAYSNLGNAYIFLGEFETASEYYKKTLLLARQL-KDRAVEAQSCYSLG 274

Query: 566 VMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE 625
             Y +L +Y  + D     ++  + + +R     G A   +G A     + ++A+   E+
Sbjct: 275 NTYTLLQDYEKAIDYHLKHLAIAQELNDRIGE--GRACWSLGNAYTALGNHDQAMHFAEK 332

Query: 626 ARSILEQECGPY-----HPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTAN 680
              I  +            +   +   L  +Y     +      ++  +     KLG  +
Sbjct: 333 HLEISREVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSSLNGVRPKLGRRH 392

Query: 681 P 681
            
Sbjct: 393 S 393


>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
4g1t_A472 Interferon-induced protein with tetratricopeptide 100.0
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.96
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.9
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.9
3u4t_A272 TPR repeat-containing protein; structural genomics 99.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.89
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.89
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.88
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.88
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.87
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.87
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.86
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.84
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.84
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.83
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.83
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.82
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.82
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.81
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.81
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.81
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.8
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.8
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.77
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.76
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.75
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.74
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.73
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.72
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.7
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.7
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.69
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.68
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.67
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.66
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.66
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.65
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.65
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.65
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.64
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.64
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.64
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.63
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.63
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.62
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.62
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.61
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.6
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.58
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.57
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.56
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.55
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.53
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.53
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.53
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.51
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.51
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.5
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.49
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.49
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.49
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.49
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.48
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.47
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.46
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.46
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.46
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.43
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.42
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.41
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.39
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.38
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.37
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.36
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.36
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.35
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.35
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.34
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.33
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.32
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.31
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.31
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.31
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.31
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.3
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.3
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.29
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.29
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.28
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.27
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.27
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.27
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.26
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.24
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.24
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.23
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.22
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.21
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.2
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.19
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.18
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.17
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.16
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.15
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.14
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.14
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.12
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.11
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.11
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.11
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.1
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.1
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.09
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.09
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.09
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.08
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.07
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.06
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.04
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.02
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.02
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.01
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.97
3k9i_A117 BH0479 protein; putative protein binding protein, 98.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.96
3k9i_A117 BH0479 protein; putative protein binding protein, 98.95
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.87
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.85
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.83
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.83
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.7
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.69
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.66
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.62
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.56
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.56
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.56
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.55
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.48
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.4
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.32
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.26
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.18
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.17
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.14
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.14
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.11
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.1
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.04
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.02
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 98.0
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.99
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.99
4g26_A501 Pentatricopeptide repeat-containing protein AT2G3 97.98
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.84
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.72
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.62
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.48
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.15
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.9
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.82
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.48
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.95
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.64
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.6
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.57
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.55
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 95.52
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 95.3
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.21
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 95.19
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.11
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 94.99
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.92
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.76
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.55
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 94.4
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.21
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.03
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.9
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.84
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.24
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 93.07
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 92.33
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.03
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.18
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 90.86
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 89.97
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.32
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 88.12
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 87.54
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 87.48
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 87.03
3re2_A472 Predicted protein; menin, multiple endocrine neopl 85.63
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 84.81
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 84.51
2o8p_A227 14-3-3 domain containing protein; signaling protei 84.41
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 83.97
3u84_A550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 83.19
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 83.16
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 82.92
3ubw_A261 14-3-3E, 14-3-3 protein epsilon; adapter protein, 82.83
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 82.61
2o8p_A227 14-3-3 domain containing protein; signaling protei 82.52
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 81.98
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 81.27
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 80.62
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 80.3
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=4.8e-37  Score=325.25  Aligned_cols=385  Identities=19%  Similarity=0.210  Sum_probs=345.9

Q ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCChHHHHHHHHHhcccchhhccccchH
Q 004811          226 KQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHAL  305 (729)
Q Consensus       226 ~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~  305 (729)
                      .+|..++..|+ +++|+..+.++++..         |+...++..+|.++...|++++|+.++++++...     +..  
T Consensus         4 ~~a~~~~~~g~-~~~A~~~~~~~~~~~---------p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~-----p~~--   66 (388)
T 1w3b_A            4 ELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLL--   66 (388)
T ss_dssp             THHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTC--
T ss_pred             hHHHHHHHCCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcC-----CCc--
Confidence            56888999997 999999999998762         4456778899999999999999999999999875     333  


Q ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhcCC
Q 004811          306 AKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS  385 (729)
Q Consensus       306 ~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~  385 (729)
                        ..++..+|.++...|++++|+..|++++.+        +|....++..+|.++...|++++|+..|++++...|... 
T Consensus        67 --~~~~~~lg~~~~~~g~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~~-  135 (388)
T 1w3b_A           67 --AEAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDLY-  135 (388)
T ss_dssp             --HHHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTCT-
T ss_pred             --hHHHHHHHHHHHHCCCHHHHHHHHHHHHHc--------CcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCcH-
Confidence              345999999999999999999999999998        788899999999999999999999999999999876543 


Q ss_pred             CCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Q 004811          386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTN  465 (729)
Q Consensus       386 ~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  465 (729)
                             .++..+|.++...|++++|+..|++++..      .|....++..+|.++...|++++|+.+|++++.+    
T Consensus       136 -------~~~~~l~~~~~~~g~~~~A~~~~~~al~~------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~----  198 (388)
T 1w3b_A          136 -------CVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL----  198 (388)
T ss_dssp             -------HHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH----
T ss_pred             -------HHHHHHHHHHHHccCHHHHHHHHHHHHHh------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhc----
Confidence                   56889999999999999999999999864      4556778999999999999999999999999998    


Q ss_pred             cCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHhcchHHHHHHHHHHHHH
Q 004811          466 KGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALK  545 (729)
Q Consensus       466 ~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  545 (729)
                          .|....++..+|.++...|++++|+..|++++.+         .|....++..+|.++...|++++|+..|+++++
T Consensus       199 ----~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~---------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~  265 (388)
T 1w3b_A          199 ----DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE  265 (388)
T ss_dssp             ----CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH---------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             ----CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh---------CcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHh
Confidence                7888899999999999999999999999999998         344467899999999999999999999999998


Q ss_pred             HHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHcCCHHHHHHHHHH
Q 004811          546 IYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE  625 (729)
Q Consensus       546 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~  625 (729)
                      +.+..       ..++..+|.++...|++++|+.+|++++++.        +....++..+|.++...|++++|+.+|++
T Consensus       266 ~~p~~-------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~--------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  330 (388)
T 1w3b_A          266 LQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLYRK  330 (388)
T ss_dssp             TCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             hCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhC--------cccHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            75543       4678999999999999999999999999872        12357889999999999999999999999


Q ss_pred             HHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChhHHHHHHHHHHHHHHhCC
Q 004811          626 ARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGR  699 (729)
Q Consensus       626 al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~g~~~p~~~~~~~~La~~~~~~g~  699 (729)
                      ++++        +|+...++..+|.+|...|++++|+.+|++++++        +|....+++++|.++...|+
T Consensus       331 al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~--------~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          331 ALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--------CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHhc--------CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh--------CCCCHHHHHhHHHHHHHccC
Confidence            9987        7888899999999999999999999999999975        68889999999999998875



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 729
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-23
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.004
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 3e-18
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 1e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 2e-06
d1ya0a1497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-07
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 7e-05
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 2e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 7e-05
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-04
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.004
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.002
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.001
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 99.7 bits (247), Expect = 5e-23
 Identities = 57/475 (12%), Positives = 138/475 (29%), Gaps = 89/475 (18%)

Query: 224 LLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNE 283
            ++ A     +GD  + A    ++  +            +    L ++++I+    + + 
Sbjct: 2   PMELAHREYQAGDF-EAAERHCMQLWRQEP---------DNTGVLLLLSSIHFQCRRLDR 51

Query: 284 AIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLG 343
           +      +I+                 +  L + Y+ LG +          +E  +  L 
Sbjct: 52  SAHFSTLAIKQ----------------NPLLAEAYSNLGNVYKERGQLQEAIEHYRHALR 95

Query: 344 ETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICE 403
                +       A            Q +                           +  +
Sbjct: 96  LKPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL---------------YCVRSD 140

Query: 404 TKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFK 463
                +A        +  + A +     A    ++G  + +      A   ++KA+    
Sbjct: 141 LGNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAV---- 196

Query: 464 TNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDV 523
                  P     ++ L ++         + +    AL +             A    ++
Sbjct: 197 ----TLDPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLSPNH---------AVVHGNL 243

Query: 524 SSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKN 583
           + +Y     ++ AI   ++A+++                 +       G+ +++ D +  
Sbjct: 244 ACVYYEQGLIDLAIDTYRRAIELQPH-------FPDAYCNLANALKEKGSVAEAEDCYNT 296

Query: 584 AISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLG 643
           A+        R       +LN +     ++ +I EAV L+ +A  +         P+   
Sbjct: 297 AL--------RLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEV--------FPEFAA 340

Query: 644 VYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAG 698
            +SNLA      G+L +A+   +  + I        +P   D    +   LKE  
Sbjct: 341 AHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQ 387


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query729
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.92
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.8
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.79
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.75
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.73
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.72
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.72
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.71
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.43
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.37
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.35
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.31
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.31
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.28
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.28
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.26
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.26
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.26
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.26
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.24
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.24
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.23
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.23
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.22
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.21
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.2
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.16
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.08
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.01
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.91
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.81
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.47
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.22
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.76
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.73
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.44
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.18
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 95.53
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 95.53
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.78
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.58
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 94.58
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 92.78
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 92.57
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 90.62
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.67
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 87.82
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 86.38
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 82.87
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.7e-33  Score=292.92  Aligned_cols=387  Identities=19%  Similarity=0.213  Sum_probs=335.8

Q ss_pred             HHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHhHHHHHHHHHHHHHHcCChHHHHHHHHHhcccchhhccccc
Q 004811          224 LLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEH  303 (729)
Q Consensus       224 l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~  303 (729)
                      ++.+|..+++.|+ |++|+..|+++++..         |....++..+|.+|...|++++|+.+|++++++.     +..
T Consensus         2 ll~la~~~~~~G~-~~~A~~~~~~~l~~~---------p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-----p~~   66 (388)
T d1w3ba_           2 PMELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLL   66 (388)
T ss_dssp             CCTHHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTC
T ss_pred             hHHHHHHHHHcCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-----CCC
Confidence            3568999999997 999999999999863         4456789999999999999999999999999886     333


Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCCchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhc
Q 004811          304 ALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDN  383 (729)
Q Consensus       304 ~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  383 (729)
                      +    .++..+|.+|..+|++++|+..+..++..        .+.........+........+..+..............
T Consensus        67 ~----~a~~~l~~~~~~~g~~~~A~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (388)
T d1w3ba_          67 A----EAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL  134 (388)
T ss_dssp             H----HHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC
T ss_pred             H----HHHHHHHHHhhhhcccccccccccccccc--------cccccccccccccccccccccccccccccccccccccc
Confidence            3    35899999999999999999999999988        57777778888888888888888777776665544333


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHH
Q 004811          384 GSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFK  463 (729)
Q Consensus       384 ~~~~~~~~a~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~  463 (729)
                      .        ......+......+....+...+.+.+..      .+....++..+|.++...|++++|...+++++.+  
T Consensus       135 ~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--  198 (388)
T d1w3ba_         135 Y--------CVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--  198 (388)
T ss_dssp             T--------HHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--
T ss_pred             c--------cccccccccccccchhhhhHHHHHHhhcc------CcchhHHHHhhcccccccCcHHHHHHHHHHHHHh--
Confidence            2        34667778888889999999988877643      4556678899999999999999999999999998  


Q ss_pred             HhcCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCChHHHHHHHHHHHHHHHhcchHHHHHHHHHHH
Q 004811          464 TNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKA  543 (729)
Q Consensus       464 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a  543 (729)
                            +|....++..+|.++...|++++|+..++++...         .+.....+..+|.++...|++++|+.+|+++
T Consensus       199 ------~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~---------~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a  263 (388)
T d1w3ba_         199 ------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRA  263 (388)
T ss_dssp             ------CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH---------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             ------CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHH---------hhhHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence                  7888999999999999999999999999999988         2334667889999999999999999999999


Q ss_pred             HHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHcCCHHHHHHHH
Q 004811          544 LKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELF  623 (729)
Q Consensus       544 l~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~  623 (729)
                      +++.+..       ..++..+|.++...|++++|+..|+.++...        +.....+..+|.++...|++++|+.+|
T Consensus       264 l~~~p~~-------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~~~~~~A~~~~  328 (388)
T d1w3ba_         264 IELQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLY  328 (388)
T ss_dssp             HHTCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHH
T ss_pred             HHhCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHhhhccC--------CccchhhhHHHHHHHHCCCHHHHHHHH
Confidence            9876544       5788999999999999999999999988752        224578889999999999999999999


Q ss_pred             HHHHHHHHHhcCCCChhHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHHHcCCCChhHHHHHHHHHHHHHHhCC
Q 004811          624 EEARSILEQECGPYHPDTLGVYSNLAGTYDAIGRLDDAIEILEFVVGIREEKLGTANPDVDDEKRRLAELLKEAGR  699 (729)
Q Consensus       624 ~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~g~~~p~~~~~~~~La~~~~~~g~  699 (729)
                      ++++++        +|+...++..+|.+|..+|++++|+.+|++++++        +|+...++.+||.+|.++||
T Consensus       329 ~~al~~--------~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l--------~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         329 RKALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRI--------SPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTT--------CTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHh--------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHh--------CCCCHHHHHHHHHHHHHcCC
Confidence            999988        8899999999999999999999999999999976        78899999999999999986



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure