Citrus Sinensis ID: 004893

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----
MILRTPPPKRPRDAAGEPIIECPPTAGGSDRRLVIYEDPSPAGRESSHQPSDHLLCTYQCRQMVKSDFLDALTNVEKQVRDYQSKLEELNENFSKAEAERKKFRDQFLYAEQELAAAKGREGVLQEQLLKEVDDSRERLKKQIQLCSELEAKHRNELNLRRKAESAAASAEEKASLLEGKLTHLSDSIEREKKRLNNEVTQLKRESKSSISRIGADLEKMECRAQNAEKESEMLKNQMKDLKEQLNECLNQKSEVEKKLSSSTFQEFSTTDSNILVKHLQEEIRNYEAEVREARKLKASYENTELLKEKLLEEKSRRERVEQELAKLREVQQSMDQLEDELSSWKFLIRDIPGVSCSEDIPVKFAALQKEVIDSMMKLGEANAQLKQMEVALDAAQLGKQSAETEAALVKEKEEVSKSEVKRIESMLSVVTEERDKLRNVVNEFKKPKNDGGGDERANLTLTKELESSLAKKEEFIEELESNLHAQQEINSRQRDEIKSLSEKLNNEERRIKSLERENDRLRSEISLLESKLGHGDFSSENTKVLRMVNTLAVDNEAKQTIEALQTELQKTKEKLQAVEELKSQSGDTGKLVDSYISGKITQLKEQIATLEKREERYKTVFADRISVFRRACCELFGYKIVMDEHQRANGIPVTHFTLQSIYAQGDDEKLEFEYESSNTNIMVNDYTSQPEISRQVDIFVRKMNSIPAFTANLTVESFNRRTLS
cccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEcccHHcccccccccHHHHcccccccccccEEEECcccccEECccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccc
****************************************************HLLCTYQCRQMVKSDFLDALTNVEKQ****************************FLYA*******************************************************************************************************************************************************************ILVKHL*************************************************************LSSWKFLIRDIPGVSCSEDIPVKFAALQKEVIDSMMKL*********************************************************************************************************************************************************************VLRMVNTLAV****************************************SYISGKITQLKEQIATLEKREERYKTVFADRISVFRRACCELFGYKIVMDEHQRANGIPVTHFTLQSIYAQGDDEKLEFEYESSNTNIMVNDYTSQPEISRQVDIFVRKMNSIPAFTANLTVESFNRRTL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILRTPPPKRPRDAAGEPIIECPPTAGGSDRRLVIYEDPSPAGRESSHQPSDHLLCTYQCRQMVKSDFLDAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFLYAEQELAAAKGREGVLQEQLLKExxxxxxxxxxxxxxxxxxxxxHRNELNLxxxxxxxxxxxxxxxxxxxxxLTHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSSSTFQEFSTTDSNILxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIRDIPGVSCSEDIPVKFAALQKEVIDSMMKLGEANAQxxxxxxxxxxxxxxxxxxxxxAALVKEKEEVSKSEVKRIESMLSVVTEERDKLRNVVNEFKKPKNDGGGDERANLTLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGHGDFSSENTKVLRMVNTLAVxxxxxxxxxxxxxxxxxxxxxxxxxxxxKSQSGDTGKLVDSYISGKxxxxxxxxxxxxxxxxxxxxxFADRISVFRRACCELFGYKIVMDEHQRANGIPVTHFTLQSIYAQGDDEKLEFEYESSNTNIMVNDYTSQPEISRQVDIFVRKMNSIPAFTANLTVESFNRRTLS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DZO, chain A
Confidence level:very confident
Coverage over the Query: 597-722
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 223-247
View the alignment between query and template
View the model in PyMOL
Template: 1GO4, chain E
Confidence level:confident
Coverage over the Query: 501-579
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 419-445,458-496
View the alignment between query and template
View the model in PyMOL
Template: 2V66, chain B
Confidence level:probable
Coverage over the Query: 328-412
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 48-120
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 148-185
View the alignment between query and template
View the model in PyMOL
Template: 2EFR, chain A
Confidence level:probable
Coverage over the Query: 222-267
View the alignment between query and template
View the model in PyMOL
Template: 1W1W, chain A
Confidence level:probable
Coverage over the Query: 194-242
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1g8x, chain Aprobable Alignment | Template Structure