Citrus Sinensis ID: 004896

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720----

MKEVEKSIDPQLWHACAGSMVQIPPLNSTVFYFPQGHAEHSLGSVNFPSSSRIPPLIFCRVSSLKFLADSETDEVYAKIKLVPIPANEIDFEDNNLSLNSVGSDSESEKPASFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYTADPPVQTVVAKDVHGEIWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRAQDGDLCVGIRRAKKGIGGGNEYPSSGWNSNNGSCVTGNPFGGFSCFLREEENKMARNGNMNLNSYGSFNSSGNTRGNGGRVKPEMVLEAVALAASGKPFEVVYYPRASTPEFCVKASAVKAAMRVHWLCGMRFKMAFETEDSSRISWFMGTISSVQVADPISWPNSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPVIHLSPFSPARKKLRLPQQLDFPFDGQFTMPLFSGNPLGPSSPLCCLSDNTSAGIQGARHAQFGISSSDFHVNNKLQSGLFLSSLQRFTPNSRDFDGILTSHTNSSENLSCLLTMGNSNQNLEKSENIKKHQFLLFGQPIRTEQQISHSCSDDVVSQVLGKSSSDGHSDKVKASSDGSGSTHEQRISIEKSSSSEFFWNRSFQVTESGLDTGHCKVFLESEDVGRTLDLSVLSSYEELYRRLAIMFGIERSDMLSHVLYQDASGAIKRTGDEPFSDFMKSAKRLTILMGSGSDSVGRTWITGMRTPKNGLDASNKTGLMRQAA

cccccccccHHHHHHcccccccccccccEEEECccccccccccccccccccccccccEEEEcccEEccccccccEEEEEEEECccccccccccccccccccccccccccccEEEEEECccccccccccCEccccccccccccccccccccEEEEEEEccccEEEEEEEEccccccEEEccccHHHHcccccccccEEEEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEccccccccEEEEHHHHHHHHccccccccEEEEEEccccccccEEEccEEEEECcccccccccccccccEEECcccccccccccEEccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEECcccccEEcccccccHHHHHHHHHHHHcccccccccEEEEEcccccEEEcccccHHHHHHccEEEEEEcccccccccccccccccccccccccccccccccccc

*****KSIDPQLWHACAGSMVQIPPLNSTVFYFPQGHAEHSLGSVNFPSSSRIPPLIFCRVSSLKFLADSETDEVYAKIKLVPIPANE***********************SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYTADPPVQTVVAKDVHGEIWKFRHIYRGTPRRHLLTTGWSTFVNQKKLVAGDSIVFLRAQDGDLCVGIRRAKKGI************S**GSCVTGNPFGGFSCFLR************************************MVLEAVALAASGKPFEVVYYPRASTPEFCVKASAVKAAMRVHWLCGMRFKMAFETEDSSRISWFMGTISSVQVADPISWPNSPWRLLQVTWDEPDLLQNVKRVSPWLVELVSNMPVIHLSPFSP*********************************P*********AGIQGARHAQFGISSSDFHVNNKLQS**FLS*LQR******DFDGILTSHTNSSENLS********************HQFLLFGQPIRTEQQISHSCSDDVVSQV********************************SSS****************DTGHCKVFLESEDVGRTLDLSVLSSYEELYRRLAIMFGIERSDMLSHVLYQDASGAIKRTGDEPFSDFMKSAKRLTILMG**********************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Auxin response factor 18	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).	probable	Q653H7
Auxin response factor 10	Auxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression.	probable	Q9SKN5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WID, chain A
Confidence level:very confident
Coverage over the Query: 107-218
View the alignment between query and template
View the model in PyMOL

Template: 1WMH, chain B
Confidence level:probable
Coverage over the Query: 612-681
View the alignment between query and template
View the model in PyMOL