Citrus Sinensis ID: 004989


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MCVFWSSCSTRRIIMEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCccccccccccccccccccccccccccccccccccEEEECcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccEEEECccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccEEEEEEcccccccccccEEEEEEcccccEEEEcccccEEEEEEcccccccccccccccEEEEccccEEEEEccccccccEEcccccccEEEEEcccccEEHHHHHHHHHHHHHHHHHcHHHHHHHccc
*CVFWSSCSTRRII*************************************************************************ENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSD**********NTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLS***CM***SAYGTHVVLVEGMQEHKILDNRV************PMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEER**********DEEELLLEFLLLVQQRK***AKKLQDIVSFICSDIEEVSKQQAILRKK********************************************************************************FKKLESAYFLTRCR**********************************************SGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVFWSSCSTRRIIMEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SPA1-RELATED 3 Repressor of photomorphogenesis in the light. Probably part of the COP1/SPA E3 ubiquitin-protein ligase complex.probableQ9LJR3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G31, chain A
Confidence level:very confident
Coverage over the Query: 42-168,273-367
View the alignment between query and template
View the model in PyMOL
Template: 1X8B, chain A
Confidence level:very confident
Coverage over the Query: 61-155,202-219,269-364
View the alignment between query and template
View the model in PyMOL
Template: 1ERJ, chain A
Confidence level:confident
Coverage over the Query: 582-636,647-717
View the alignment between query and template
View the model in PyMOL