Citrus Sinensis ID: 004989

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720
MCVFWSSCSTRRIIMEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccEEEEEcccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccEEEccccccccccccccEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccEEEEEEcccccccccccEEEEEEcccccEEEEcccccEEEEEEcccccccccccccccEEEEccccEEEEEccccccccEEcccccccEEEEEcccccEEHHHHHHHHHHHHHHHHHcHHHHHHHccc
cEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccEEEEccccccEEEccccEEEEEcccccccccccccccccccccccccccccccccHccccccccEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccHHHHcccccccHHHHHHHHHEEHHHccccccHHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHcccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEcccccccccccccccEccccccccHHHHcccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccEEEEEEEcccHHHHHHHcccEEEEEEEEcHEEcccccccccEEEEcccccEEEEEccHHHHHHEcccccccEEEEEHHHHHHHHHHHcEEEEEccccccHccHHHHHHHHcc
mcvfwsscstrriimegssdsawqdsdssralnisgvsdrnprllrgerfgvrgddsndfelrkhsdgvelthgdhlrnqgglsgvceneaaidpfvhaieWGDVSlrqwldkpkrsvdVYECLHIFRQIVEIVYAAHSQGIvvhnvrpscfvmssfnhvsfiesascsdsgsdsheeglntqnmetkdlssplpldMLQRRTRLRRedlqlvtaptndlseascmqsssaygTHVVLVEGMqehkildnrvnveqveekkqpfpmkQILLMEtnwyaspeelagapvscasdiYRLGVLLFELfcpfstgeektrtmsslrhrvlppqlllkfpkeASFCLWllhpepsgrpkmgELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKkgglgsfaelanddlsglnipslniidndcsatmgsrkrfrpelqlHHLEecddnlddnqkhnltgneerslFKSSRLMKNFKKLESAYFltrcrpvkpsgrplvrhsqlssdgrtskplvnerssinnlgskegysegrrsgwinpFLEGLCKYLSFSKLRVkadlnqgdllnssnlvcslsfdrDGELFAAAGVNKKIKVFECDAiinenrdihypVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
mcvfwsscsTRRIIMegssdsawqdsdssralnisgvsdrnprllrgerfgvrgddsndfELRKHSdgvelthgdHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTqnmetkdlssplpLDMLQRRTRLRREDLQlvtaptndlseasCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNltgneerslfkssRLMKNFKKLESAYFltrcrpvkpsgrplvrhsqlssdgrtskplvnerssinnlgskegysegrrsGWINPFLEGLCKYLSFSKLRVKADlnqgdllnssNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
MCVFWSSCSTRRIIMEGssdsawqdsdssRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIEsascsdsgsdsHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIelreqideeellleflllVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDllnssnlvcslsFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
*CVFWSSCSTRRII**************************************************************LRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIE******************************************************************AYGTHVVLVEGMQEHKILDNRVNVE********FPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTG*********LRHRVLPPQLLLKFPKEASFCLWLLH**************************************DEEELLLEFLLLVQQRK***AKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSA*************************************************FKKLESAYFLTRCR**********************************************SGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKY***
***********************************************************************************************FVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLS***CM***SAYGTHVVLVEGMQEHKILDNRV****************ILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEER****************************************ICS************************************************************************************************KKLE*************************************************************FLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQ*
MCVFWSSCSTRRIIMEG***********SRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIES***************NTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFST**********LRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPS******************PLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
MCVFWSSCSTRRIIMEG**********************************************************************ENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSD**********************************LRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVE************************PMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKK*******************************************************************ERSLFKSSRLMKNFKKLESAYFLTRCRP*********************************************SGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCVFWSSCSTRRIIMEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSALYCIVLNKLLIIFRYGMFQEVKYLQK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query720 2.2.26 [Sep-21-2011]
Q9LJR3 845 Protein SPA1-RELATED 3 OS yes no 0.840 0.715 0.570 0.0
Q94BM7 794 Protein SPA1-RELATED 4 OS no no 0.773 0.701 0.539 1e-175
Q9SYX2 1029 Protein SUPPRESSOR OF PHY no no 0.698 0.488 0.341 5e-76
Q9T014 1036 Protein SPA1-RELATED 2 OS no no 0.425 0.295 0.342 3e-42
P93471 672 E3 ubiquitin-protein liga N/A no 0.384 0.412 0.323 2e-32
P43254 675 E3 ubiquitin-protein liga no no 0.4 0.426 0.296 4e-28
Q8NHY2 731 E3 ubiquitin-protein liga yes no 0.344 0.339 0.280 4e-21
Q9R1A8 733 E3 ubiquitin-protein liga yes no 0.344 0.338 0.274 5e-20
Q9Z1Z11108 Eukaryotic translation in no no 0.220 0.143 0.257 3e-13
Q9NZJ51116 Eukaryotic translation in no no 0.220 0.142 0.253 2e-11
>sp|Q9LJR3|SPA3_ARATH Protein SPA1-RELATED 3 OS=Arabidopsis thaliana GN=SPA3 PE=1 SV=1 Back     alignment and function desciption
 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/680 (57%), Positives = 483/680 (71%), Gaps = 75/680 (11%)

Query: 15  MEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHG 74
           MEGSS+S      +SR  N SGVSDRN   L  ER   R   S+  +     + V    G
Sbjct: 1   MEGSSNS------NSRGFNTSGVSDRNTEFLPVERLTTRSKPSSHVD-----EYVRSLFG 49

Query: 75  DHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIV 134
               ++ G     ++   IDPFV ++EWGDVSLRQWLDKP+RSVDV+ECLH+FRQIVEIV
Sbjct: 50  STSTHKSGE----DDSLGIDPFVRSLEWGDVSLRQWLDKPERSVDVFECLHVFRQIVEIV 105

Query: 135 YAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPL 194
            AAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDS E+G  +Q    K++ S  
Sbjct: 106 NAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSLEDGPISQ----KEIGSS- 160

Query: 195 PLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNV 254
                      RRE+          +S+A  ++    Y            +K+L+ ++  
Sbjct: 161 -----------RREEA---------VSKAIAIEEKGVY------------NKLLERKIEK 188

Query: 255 EQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEK 314
            + EEK QPFPMK IL MET+WY SPEE  G+  +CASD+YRLGVLLFELFCP  + EEK
Sbjct: 189 LE-EEKTQPFPMKHILAMETSWYTSPEEDFGSSSTCASDVYRLGVLLFELFCPVPSREEK 247

Query: 315 TRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEER 374
           +RTMSSLRHRVLPPQ+LLK PKEASFCLWLLHPEP+ RP M +LLQSEF+ EPRD++EER
Sbjct: 248 SRTMSSLRHRVLPPQILLKCPKEASFCLWLLHPEPTCRPSMSDLLQSEFITEPRDNLEER 307

Query: 375 EAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGG 434
           EAAIELR++I+E+E LLEFLLL+QQRKQESA +LQD VS + SDIE+V K+Q IL+K+G 
Sbjct: 308 EAAIELRDRIEEQESLLEFLLLIQQRKQESAYRLQDTVSLLSSDIEQVVKRQLILKKRG- 366

Query: 435 LGSFAELANDD---LSGLNIPSLNIIDNDCSATMGSRKRFRPE-LQLHHLEECDDNLDDN 490
             S ++ + DD    SG  + S    + + SA + SRKR R   L L +  E D+     
Sbjct: 367 -SSLSDFSKDDHQYTSGQPLMSFQ-ANEEPSAFLASRKRVRQGILALENGVEVDEE---- 420

Query: 491 QKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVK--PSGRPLVRHSQLSSDGRTS 548
                  ++  +L +SSRLM+NFKKLES YFLTR R +K   SG+ L RHS LSS+    
Sbjct: 421 -------SQGSTLLESSRLMRNFKKLESVYFLTRRRQMKAAASGKSLTRHSPLSSENGRG 473

Query: 549 KPLVNERSSINNLGSKEGY--SEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNS 606
             +V+E+SS++N  + + +  ++ R+ GWI+PFLEGLC+YLSFS+LRVKADL QGDLLNS
Sbjct: 474 SMIVSEKSSVSNPVAPKAFFNNDSRQGGWIDPFLEGLCRYLSFSQLRVKADLKQGDLLNS 533

Query: 607 SNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNS 666
           SNLVC+L+FDR+GELFA AGVNKKIK+FEC++I+N+NRDIHYPVVE+A RSKLSS+CWNS
Sbjct: 534 SNLVCALAFDREGELFATAGVNKKIKIFECNSIVNDNRDIHYPVVELAGRSKLSSLCWNS 593

Query: 667 YIKSQIASSNFEGVVQVGQV 686
           YIKSQIASSNF+GVVQ+  V
Sbjct: 594 YIKSQIASSNFDGVVQIWDV 613
Repressor of photomorphogenesis in the light. Probably part of the COP1/SPA E3 ubiquitin-protein ligase complex.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94BM7|SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana GN=SPA4 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYX2|SPA1_ARATH Protein SUPPRESSOR OF PHYA-105 1 OS=Arabidopsis thaliana GN=SPA1 PE=1 SV=1 Back     alignment and function description
>sp|Q9T014|SPA2_ARATH Protein SPA1-RELATED 2 OS=Arabidopsis thaliana GN=SPA2 PE=1 SV=2 Back     alignment and function description
>sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 Back     alignment and function description
>sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 Back     alignment and function description
>sp|Q8NHY2|RFWD2_HUMAN E3 ubiquitin-protein ligase RFWD2 OS=Homo sapiens GN=RFWD2 PE=1 SV=1 Back     alignment and function description
>sp|Q9R1A8|RFWD2_MOUSE E3 ubiquitin-protein ligase RFWD2 OS=Mus musculus GN=Rfwd2 PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1Z1|E2AK3_RAT Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Rattus norvegicus GN=Eif2ak3 PE=1 SV=1 Back     alignment and function description
>sp|Q9NZJ5|E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
255585740 889 ubiquitin ligase protein cop1, putative 0.912 0.739 0.689 0.0
359493656 903 PREDICTED: protein SPA1-RELATED 3-like [ 0.923 0.736 0.669 0.0
356542282 892 PREDICTED: protein SPA1-RELATED 3-like [ 0.913 0.737 0.661 0.0
356546870 892 PREDICTED: protein SPA1-RELATED 3-like [ 0.908 0.733 0.661 0.0
224114936 851 predicted protein [Populus trichocarpa] 0.868 0.734 0.651 0.0
357452949 875 SPA1-like protein [Medicago truncatula] 0.884 0.728 0.631 0.0
224128308 857 predicted protein [Populus trichocarpa] 0.865 0.726 0.650 0.0
357519507814 SPA1-like protein [Medicago truncatula] 0.884 0.782 0.618 0.0
449446929 850 PREDICTED: protein SPA1-RELATED 3-like [ 0.833 0.705 0.670 0.0
22331100 837 ubiquitin-protein ligase RFWD2 [Arabidop 0.840 0.722 0.570 0.0
>gi|255585740|ref|XP_002533551.1| ubiquitin ligase protein cop1, putative [Ricinus communis] gi|223526576|gb|EEF28831.1| ubiquitin ligase protein cop1, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/673 (68%), Positives = 546/673 (81%), Gaps = 16/673 (2%)

Query: 15  MEGSSDSAWQDSDSSRALNISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHG 74
           M+  S+SAWQ S++S ALN S  SD NP           G  S D   RK +D V L H 
Sbjct: 1   MKDLSESAWQKSNNSGALNTSRASDWNP-----------GPLSRDSVFRKKTDRVVLAHH 49

Query: 75  DHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIV 134
           + L+NQ GLSG  ++E A+DPF  AIEWGDVSLRQWLDKP+RSVD +ECLHIFRQIV IV
Sbjct: 50  N-LKNQVGLSGGYKDEVAVDPFARAIEWGDVSLRQWLDKPERSVDEFECLHIFRQIVGIV 108

Query: 135 YAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPL 194
             AHSQGIVVHNVRPSCFVM+SFNHVSFIESASCSDSGSDS E+GLN++ +E K+ SS L
Sbjct: 109 NLAHSQGIVVHNVRPSCFVMTSFNHVSFIESASCSDSGSDSLEDGLNSRTLEVKNPSSLL 168

Query: 195 PLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNV 254
           P D+ Q RTRLR ED Q  + P N LSEASC+QSSS + THV + E  +E K  D  +  
Sbjct: 169 PNDIFQLRTRLRSEDFQPASTPINALSEASCIQSSSVHATHVPVGENTEEDKANDRTIIE 228

Query: 255 EQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEK 314
           ++ EE+KQPFPMKQILLMET+WY SPEE  G+P SCASDIYRLGVLLFELFCPFS+ E+K
Sbjct: 229 QEEEERKQPFPMKQILLMETSWYTSPEEATGSPSSCASDIYRLGVLLFELFCPFSSREDK 288

Query: 315 TRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEER 374
           +RTMSSLRHRVLPPQLLLK+PKEASFCLWLLHPEPS RPKM ELLQSEFLNEPR+++EER
Sbjct: 289 SRTMSSLRHRVLPPQLLLKWPKEASFCLWLLHPEPSSRPKMCELLQSEFLNEPRENLEER 348

Query: 375 EAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGG 434
           EAAI+L E+I+E++LLL+FLLL+QQRKQE+A KLQD VS +CSDIEEV K +  L+KKG 
Sbjct: 349 EAAIQLSERIEEQDLLLDFLLLIQQRKQEAADKLQDTVSLLCSDIEEVLKHRTFLKKKG- 407

Query: 435 LGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHN 494
            GS  E   DD    N+P  +I+DND S+++GSRKRFRP +Q+ ++EE DDN DD Q  +
Sbjct: 408 -GSCLERMKDDNLVSNLPPFSIVDNDDSSSLGSRKRFRPGIQIFNMEEFDDNRDDAQHSD 466

Query: 495 L-TGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVN 553
           + T +++  L KSSRLMKNFKKLESAYFLTRCRP++ SG+P +R+S +SSDGR S  +V+
Sbjct: 467 MVTESQDSLLLKSSRLMKNFKKLESAYFLTRCRPIRSSGKPFIRYSPISSDGRGST-VVS 525

Query: 554 ERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSL 613
           ERSSINNL  KE + E R+SGWI+PFLEGLCKYLSF+KL++KADL QGDLLNSSNLVCSL
Sbjct: 526 ERSSINNLAPKEQHVESRQSGWISPFLEGLCKYLSFNKLKIKADLKQGDLLNSSNLVCSL 585

Query: 614 SFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIA 673
           SFDRDGE FA AGVNKKIK+FECDAIINENRDIHYPVVE+A+RSKLSS+CWNSYIKSQIA
Sbjct: 586 SFDRDGEFFATAGVNKKIKIFECDAIINENRDIHYPVVEIATRSKLSSVCWNSYIKSQIA 645

Query: 674 SSNFEGVVQVGQV 686
           SSNFEGVVQV  +
Sbjct: 646 SSNFEGVVQVWDI 658

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359493656|ref|XP_002282441.2| PREDICTED: protein SPA1-RELATED 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356542282|ref|XP_003539598.1| PREDICTED: protein SPA1-RELATED 3-like [Glycine max] Back     alignment and taxonomy information
>gi|356546870|ref|XP_003541845.1| PREDICTED: protein SPA1-RELATED 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224114936|ref|XP_002316897.1| predicted protein [Populus trichocarpa] gi|222859962|gb|EEE97509.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357452949|ref|XP_003596751.1| SPA1-like protein [Medicago truncatula] gi|355485799|gb|AES67002.1| SPA1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|224128308|ref|XP_002329131.1| predicted protein [Populus trichocarpa] gi|222869800|gb|EEF06931.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357519507|ref|XP_003630042.1| SPA1-like protein [Medicago truncatula] gi|355524064|gb|AET04518.1| SPA1-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|449446929|ref|XP_004141223.1| PREDICTED: protein SPA1-RELATED 3-like [Cucumis sativus] gi|449498653|ref|XP_004160596.1| PREDICTED: protein SPA1-RELATED 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|22331100|ref|NP_683567.1| ubiquitin-protein ligase RFWD2 [Arabidopsis thaliana] gi|332642126|gb|AEE75647.1| ubiquitin-protein ligase RFWD2 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query720
TAIR|locus:2037005 794 SPA4 "SPA1-related 4" [Arabido 0.297 0.269 0.578 1.3e-122
TAIR|locus:2136133 1036 SPA2 "SPA1-related 2" [Arabido 0.468 0.325 0.310 2e-62
TAIR|locus:2039139 1029 SPA1 "SUPPRESSOR OF PHYA-105 1 0.416 0.291 0.333 3.4e-60
TAIR|locus:2059359 675 COP1 "CONSTITUTIVE PHOTOMORPHO 0.195 0.208 0.401 1.3e-18
DICTYBASE|DDB_G0288453 970 DDB_G0288453 "E3 ubiquitin-pro 0.176 0.130 0.424 2.1e-18
UNIPROTKB|H0Y339 566 RFWD2 "E3 ubiquitin-protein li 0.156 0.199 0.412 1.4e-14
RGD|1304773 433 Rfwd2 "ring finger and WD repe 0.156 0.260 0.403 2.4e-14
ZFIN|ZDB-GENE-070410-134 694 rfwd2 "ring finger and WD repe 0.156 0.162 0.421 5.4e-14
UNIPROTKB|Q8NHY2 731 RFWD2 "E3 ubiquitin-protein li 0.156 0.154 0.412 1.2e-13
UNIPROTKB|F1MHX1 735 RFWD2 "Uncharacterized protein 0.156 0.153 0.403 2.2e-13
TAIR|locus:2037005 SPA4 "SPA1-related 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 617 (222.3 bits), Expect = 1.3e-122, Sum P(2) = 1.3e-122
 Identities = 125/216 (57%), Positives = 154/216 (71%)

Query:   220 LSEASCMQSSSAYG--THVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWY 277
             +  ASC  S S     T    +   ++ +IL  R + +Q E KKQPFPMKQIL ME +WY
Sbjct:   122 IESASCSDSGSDEDATTKSREIGSSRQEEILSERRSKQQEEVKKQPFPMKQILAMEMSWY 181

Query:   278 ASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKE 337
              S EE  G+  +CASDIYRLGVLLFELFCP S+ EEK+RTMSSLRHRVLPPQ+LL +PKE
Sbjct:   182 TSHEEDNGSLCNCASDIYRLGVLLFELFCPVSSREEKSRTMSSLRHRVLPPQILLNWPKE 241

Query:   338 ASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIXXXXXXXXXXXXXXXXXXV 397
             ASFCLWLLHPEPS RP M ELLQSEF+NEPR+++EEREAA+                  +
Sbjct:   242 ASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEEQELLLEFLFLI 301

Query:   398 QQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKG 433
             QQRKQE+A KLQD +S + SDI++V K+Q +L++KG
Sbjct:   302 QQRKQEAADKLQDTISLLSSDIDQVVKRQLVLQQKG 337
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004871 "signal transducer activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0005834 "heterotrimeric G-protein complex" evidence=ISS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0080008 "Cul4-RING ubiquitin ligase complex" evidence=ISS
GO:0042802 "identical protein binding" evidence=IPI
GO:0006281 "DNA repair" evidence=RCA
GO:0010100 "negative regulation of photomorphogenesis" evidence=RCA
GO:0048608 "reproductive structure development" evidence=RCA
TAIR|locus:2136133 SPA2 "SPA1-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2039139 SPA1 "SUPPRESSOR OF PHYA-105 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2059359 COP1 "CONSTITUTIVE PHOTOMORPHOGENIC 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288453 DDB_G0288453 "E3 ubiquitin-protein ligase RFWD2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y339 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304773 Rfwd2 "ring finger and WD repeat domain 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-134 rfwd2 "ring finger and WD repeat domain 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NHY2 RFWD2 "E3 ubiquitin-protein ligase RFWD2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHX1 RFWD2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LJR3SPA3_ARATHNo assigned EC number0.57050.84020.7159yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_XI3877
hypothetical protein (851 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
PLN00181 793 PLN00181, PLN00181, protein SPA1-RELATED; Provisio 0.0
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 9e-11
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 3e-09
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-09
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 6e-07
cd05114256 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro 2e-06
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-06
PRK13184 932 PRK13184, pknD, serine/threonine-protein kinase; R 1e-04
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 4e-04
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 0.002
cd05041251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 0.003
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 0.003
>gnl|CDD|177776 PLN00181, PLN00181, protein SPA1-RELATED; Provisional Back     alignment and domain information 
 Score =  687 bits (1773), Expect = 0.0
 Identities = 364/681 (53%), Positives = 435/681 (63%), Gaps = 128/681 (18%)

Query: 15  MEGSSDSAWQDSDSSRAL-NISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTH 73
           M+GSS+S      +SR L N SGVS+                 ++  +   H D V    
Sbjct: 1   MKGSSES------NSRGLNNTSGVSEFC---------------TDGSKSLSHIDYVRSLL 39

Query: 74  GDHLR-NQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVE 132
           G H   N  GL          D  V A+E  DVSLRQWLD P RSVD +EC H+FRQIVE
Sbjct: 40  GSHKEGNLDGLD--------DDSIVRALECEDVSLRQWLDNPDRSVDAFECFHVFRQIVE 91

Query: 133 IVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSS 192
           IV AAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD  E+         +++ S
Sbjct: 92  IVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSD--EDATTKS----REIGS 145

Query: 193 PLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRV 252
                        RRE+                                     IL  R 
Sbjct: 146 S------------RREE-------------------------------------ILSERR 156

Query: 253 NVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGE 312
             +  E KKQPFPMKQIL ME +WY SPEE  G+  +CASD+YRLGVLLFELFCP S+ E
Sbjct: 157 IEKLEEVKKQPFPMKQILAMEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVSSRE 216

Query: 313 EKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSME 372
           EK+RTMSSLRHRVLPPQ+LL +PKEASFCLWLLHPEPS RP M ELLQSEF+NEPR+++E
Sbjct: 217 EKSRTMSSLRHRVLPPQILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLE 276

Query: 373 EREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKK 432
           EREAA+ELR++I+E+ELLLEFL L+QQRKQE+A KLQD +S + SDI++V K+Q +L++K
Sbjct: 277 EREAAMELRDRIEEQELLLEFLFLIQQRKQEAADKLQDTISLLSSDIDQVVKRQLVLQQK 336

Query: 433 GGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRP-ELQLHHLEECDDNLDDNQ 491
           G                         +D  + + SRKR R     L   EE DDN     
Sbjct: 337 G-------------------------SDVRSFLASRKRIRQGAETLAAEEENDDN----- 366

Query: 492 KHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSG---RPLVRHSQLSS-DGRT 547
              L    E +L +SSRLM+N KKLES YF TR R +K +    +PL R+    S +GR+
Sbjct: 367 SSKLDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLARYYSALSENGRS 426

Query: 548 SKPLVNERSSINNLGSKEGY--SEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLN 605
           S     E+SS++N      +  ++ R+ GWI+PFLEGLCKYLSFSKLRVKADL QGDLLN
Sbjct: 427 S-----EKSSMSNPAKPPDFYINDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLN 481

Query: 606 SSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWN 665
           SSNLVC++ FDRDGE FA AGVNKKIK+FEC++II + RDIHYPVVE+ASRSKLS ICWN
Sbjct: 482 SSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKDGRDIHYPVVELASRSKLSGICWN 541

Query: 666 SYIKSQIASSNFEGVVQVGQV 686
           SYIKSQ+ASSNFEGVVQV  V
Sbjct: 542 SYIKSQVASSNFEGVVQVWDV 562

Length = 793
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 720
PLN00181 793 protein SPA1-RELATED; Provisional 100.0
KOG0615475 consensus Serine/threonine protein kinase Chk2 and 100.0
KOG0581364 consensus Mitogen-activated protein kinase kinase 100.0
KOG0575592 consensus Polo-like serine/threonine protein kinas 100.0
KOG0593396 consensus Predicted protein kinase KKIAMRE [Genera 100.0
KOG0591375 consensus NIMA (never in mitosis)-related G2-speci 100.0
KOG0588 786 consensus Serine/threonine protein kinase [Cell cy 100.0
KOG0598357 consensus Ribosomal protein S6 kinase and related 100.0
KOG0661538 consensus MAPK related serine/threonine protein ki 100.0
KOG0592604 consensus 3-phosphoinositide-dependent protein kin 100.0
KOG0198313 consensus MEKK and related serine/threonine protei 100.0
KOG0583370 consensus Serine/threonine protein kinase [Signal 100.0
KOG0660359 consensus Mitogen-activated protein kinase [Signal 100.0
KOG0600560 consensus Cdc2-related protein kinase [Cell cycle 100.0
KOG0578550 consensus p21-activated serine/threonine protein k 100.0
KOG0605550 consensus NDR and related serine/threonine kinases 100.0
KOG0033355 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0616355 consensus cAMP-dependent protein kinase catalytic 100.0
KOG0611668 consensus Predicted serine/threonine protein kinas 100.0
KOG0595429 consensus Serine/threonine-protein kinase involved 100.0
KOG0663419 consensus Protein kinase PITSLRE and related kinas 100.0
KOG0610459 consensus Putative serine/threonine protein kinase 100.0
KOG0659318 consensus Cdk activating kinase (CAK)/RNA polymera 100.0
KOG0192362 consensus Tyrosine kinase specific for activated ( 100.0
KOG0585576 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG1035 1351 consensus eIF-2alpha kinase GCN2 [Translation, rib 100.0
KOG0599411 consensus Phosphorylase kinase gamma subunit [Carb 100.0
KOG0594323 consensus Protein kinase PCTAIRE and related kinas 100.0
KOG0577 948 consensus Serine/threonine protein kinase [Signal 100.0
KOG0582516 consensus Ste20-like serine/threonine protein kina 100.0
KOG0597 808 consensus Serine-threonine protein kinase FUSED [G 100.0
KOG0032382 consensus Ca2+/calmodulin-dependent protein kinase 100.0
KOG0589426 consensus Serine/threonine protein kinase [General 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
KOG0694694 consensus Serine/threonine protein kinase [Signal 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
KOG0658364 consensus Glycogen synthase kinase-3 [Carbohydrate 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
KOG0604400 consensus MAP kinase-activated protein kinase 2 [S 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
KOG4721 904 consensus Serine/threonine protein kinase, contain 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
KOG0579 1187 consensus Ste20-like serine/threonine protein kina 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
KOG0580281 consensus Serine/threonine protein kinase [Cell cy 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.98
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.98
KOG0596677 consensus Dual specificity; serine/threonine and t 99.98
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.98
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.98
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.98
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.98
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.98
PTZ00267478 NIMA-related protein kinase; Provisional 99.98
PHA03212391 serine/threonine kinase US3; Provisional 99.98
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.98
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.98
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 99.98
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.98
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.98
PTZ00283496 serine/threonine protein kinase; Provisional 99.98
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.98
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.98
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.98
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.97
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.97
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.97
PTZ00036440 glycogen synthase kinase; Provisional 99.97
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.97
PHA03209357 serine/threonine kinase US3; Provisional 99.97
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.97
KOG0197468 consensus Tyrosine kinases [Signal transduction me 99.97
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.97
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.97
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.97
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.97
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.97
PHA02988283 hypothetical protein; Provisional 99.97
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.97
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.97
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.97
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.97
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.97
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.97
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.97
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.97
KOG0201467 consensus Serine/threonine protein kinase [Signal 99.97
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.97
KOG4717 864 consensus Serine/threonine protein kinase [Signal 99.97
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.97
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.97
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.97
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.97
KOG42791226 consensus Serine/threonine protein kinase [Signal 99.97
KOG0667586 consensus Dual-specificity tyrosine-phosphorylatio 99.97
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.97
KOG0584632 consensus Serine/threonine protein kinase [General 99.97
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 99.97
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.97
PHA03207392 serine/threonine kinase US3; Provisional 99.97
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.97
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.97
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.97
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.97
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.97
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.97
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.97
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.97
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.97
PTZ00284467 protein kinase; Provisional 99.97
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.97
PHA03211461 serine/threonine kinase US3; Provisional 99.97
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.97
KOG0666438 consensus Cyclin C-dependent kinase CDK8 [Transcri 99.97
KOG46451509 consensus MAPKKK (MAP kinase kinase kinase) SSK2 a 99.97
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.97
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.97
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.97
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.97
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.97
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.97
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.97
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.97
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.97
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.97
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.97
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.97
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 99.97
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.97
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.97
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
KOG0612 1317 consensus Rho-associated, coiled-coil containing p 99.97
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.97
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.97
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.96
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.96
PHA03210501 serine/threonine kinase US3; Provisional 99.96
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.96
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.96
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.96
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.96
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.96
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.96
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 99.96
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.96
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 99.96
KOG0986591 consensus G protein-coupled receptor kinase [Signa 99.96
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.96
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 99.96
KOG0607463 consensus MAP kinase-interacting kinase and relate 99.96
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 99.96
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.96
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.96
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.96
KOG1989738 consensus ARK protein kinase family [Signal transd 99.96
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.96
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.96
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.96
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.96
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.96
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.96
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.96
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.96
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.96
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.96
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.96
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.96
KOG0662292 consensus Cyclin-dependent kinase CDK5 [Intracellu 99.96
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.96
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.96
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.96
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.96
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.96
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.96
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.96
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.96
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.96
KOG0586596 consensus Serine/threonine protein kinase [General 99.96
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.96
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.96
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.96
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.96
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.96
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.96
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.96
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.96
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.96
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.96
KOG0669376 consensus Cyclin T-dependent kinase CDK9 [Cell cyc 99.96
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.96
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.96
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.96
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.96
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.96
KOG0665369 consensus Jun-N-terminal kinase (JNK) [Signal tran 99.96
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.96
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.96
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.96
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.96
KOG2345302 consensus Serine/threonine protein kinase/TGF-beta 99.96
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.96
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.96
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.96
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.96
KOG4236888 consensus Serine/threonine protein kinase PKC mu/P 99.96
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.96
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.96
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.96
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.96
KOG1187361 consensus Serine/threonine protein kinase [Signal 99.96
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.96
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.96
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.96
KOG0983391 consensus Mitogen-activated protein kinase (MAPK) 99.96
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.96
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.96
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.96
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.96
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.96
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.96
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.96
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 99.96
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.96
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.96
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.96
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.96
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.96
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.96
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.96
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.96
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.96
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.96
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.96
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.96
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.96
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.96
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.96
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.96
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.96
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.96
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.96
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.96
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.96
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.96
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.96
KOG0690516 consensus Serine/threonine protein kinase [Signal 99.96
KOG0574502 consensus STE20-like serine/threonine kinase MST [ 99.96
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.96
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.96
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.96
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.96
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 99.96
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.96
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.96
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.96
KOG06081034 consensus Warts/lats-like serine threonine kinases 99.96
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.96
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.96
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.96
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.96
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.96
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.96
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.96
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.96
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.95
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.95
PTZ00024335 cyclin-dependent protein kinase; Provisional 99.95
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.95
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.95
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.95
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.95
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.95
PLN00009294 cyclin-dependent kinase A; Provisional 99.95
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.95
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.95
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.95
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.95
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.95
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.95
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.95
KOG0671415 consensus LAMMER dual specificity kinases [Signal 99.95
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.95
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.95
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.95
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.95
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.95
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.95
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.95
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.95
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.95
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.95
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.95
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.95
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.95
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.95
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.95
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.95
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.95
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.95
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.95
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.95
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.95
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.95
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.95
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.95
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.95
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.95
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.95
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.95
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.95
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.95
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.95
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.95
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.95
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.95
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.95
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.95
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.95
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.95
KOG0194474 consensus Protein tyrosine kinase [Signal transduc 99.95
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.95
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.95
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.95
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.95
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.95
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.95
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.95
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.95
KOG1026774 consensus Nerve growth factor receptor TRKA and re 99.95
KOG10951025 consensus Protein tyrosine kinase [Signal transduc 99.95
KOG1027903 consensus Serine/threonine protein kinase and endo 99.95
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.95
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.95
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.95
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.95
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.95
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.95
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.95
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.95
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.95
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.95
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.95
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.95
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.95
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.95
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.95
KOG0696683 consensus Serine/threonine protein kinase [Signal 99.95
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.95
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.94
KOG1006361 consensus Mitogen-activated protein kinase (MAPK) 99.94
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.94
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.94
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.94
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.94
PHA02882294 putative serine/threonine kinase; Provisional 99.94
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.94
KOG0193678 consensus Serine/threonine protein kinase RAF [Sig 99.94
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.94
KOG0695593 consensus Serine/threonine protein kinase [Signal 99.94
KOG0668338 consensus Casein kinase II, alpha subunit [Signal 99.94
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.93
KOG0587 953 consensus Traf2- and Nck-interacting kinase and re 99.93
KOG4250732 consensus TANK binding protein kinase TBK1 [Signal 99.93
KOG4257974 consensus Focal adhesion tyrosine kinase FAK, cont 99.93
KOG4278 1157 consensus Protein tyrosine kinase [Signal transduc 99.93
KOG1290590 consensus Serine/threonine protein kinase [Signal 99.92
KOG1151775 consensus Tousled-like protein kinase [Signal tran 99.92
KOG0664449 consensus Nemo-like MAPK-related serine/threonine 99.92
KOG0196996 consensus Tyrosine kinase, EPH (ephrin) receptor f 99.92
KOG0670752 consensus U4/U6-associated splicing factor PRP4 [R 99.92
KOG1094807 consensus Discoidin domain receptor DDR1 [Signal t 99.92
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.91
PLN03224507 probable serine/threonine protein kinase; Provisio 99.91
KOG2052513 consensus Activin A type IB receptor, serine/threo 99.91
KOG0199 1039 consensus ACK and related non-receptor tyrosine ki 99.91
KOG1152772 consensus Signal transduction serine/threonine kin 99.91
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.9
KOG3653534 consensus Transforming growth factor beta/activin 99.9
KOG1167418 consensus Serine/threonine protein kinase of the C 99.89
KOG0576 829 consensus Mitogen-activated protein kinase kinase 99.89
KOG0984282 consensus Mitogen-activated protein kinase (MAPK) 99.89
KOG0200609 consensus Fibroblast/platelet-derived growth facto 99.88
KOG1033516 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati 99.88
KOG10251177 consensus Epidermal growth factor receptor EGFR an 99.87
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.87
KOG1024563 consensus Receptor-like protein tyrosine kinase RY 99.85
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.83
KOG1345378 consensus Serine/threonine kinase [Signal transduc 99.81
KOG4158598 consensus BRPK/PTEN-induced protein kinase [Signal 99.8
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.79
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.72
KOG0603612 consensus Ribosomal protein S6 kinase [Signal tran 99.71
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 99.68
KOG0606 1205 consensus Microtubule-associated serine/threonine 99.64
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 99.63
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.6
KOG0275 508 consensus Conserved WD40 repeat-containing protein 99.6
KOG0271 480 consensus Notchless-like WD40 repeat-containing pr 99.6
PRK09188365 serine/threonine protein kinase; Provisional 99.58
KOG0272459 consensus U4/U6 small nuclear ribonucleoprotein Pr 99.56
KOG1164322 consensus Casein kinase (serine/threonine/tyrosine 99.56
KOG0279315 consensus G protein beta subunit-like protein [Sig 99.56
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.54
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.54
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.54
PTZ00421 493 coronin; Provisional 99.54
KOG0266 456 consensus WD40 repeat-containing protein [General 99.53
PRK10345210 hypothetical protein; Provisional 99.53
KOG1023484 consensus Natriuretic peptide receptor, guanylate 99.51
KOG0263707 consensus Transcription initiation factor TFIID, s 99.51
PTZ00420 568 coronin; Provisional 99.49
KOG0318 603 consensus WD40 repeat stress protein/actin interac 99.47
KOG0266456 consensus WD40 repeat-containing protein [General 99.47
KOG0590601 consensus Checkpoint kinase and related serine/thr 99.46
KOG0263 707 consensus Transcription initiation factor TFIID, s 99.46
KOG1165449 consensus Casein kinase (serine/threonine/tyrosine 99.46
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.45
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.45
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.44
KOG0279 315 consensus G protein beta subunit-like protein [Sig 99.44
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.42
KOG0316 307 consensus Conserved WD40 repeat-containing protein 99.4
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.4
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.39
PRK12274218 serine/threonine protein kinase; Provisional 99.39
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.39
KOG1163341 consensus Casein kinase (serine/threonine/tyrosine 99.38
KOG0295406 consensus WD40 repeat-containing protein [Function 99.38
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.36
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 99.36
KOG0282 503 consensus mRNA splicing factor [Function unknown] 99.34
KOG0265 338 consensus U5 snRNP-specific protein-like factor an 99.33
PTZ00420 568 coronin; Provisional 99.3
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.29
KOG0645312 consensus WD40 repeat protein [General function pr 99.29
KOG0285 460 consensus Pleiotropic regulator 1 [RNA processing 99.29
KOG0647 347 consensus mRNA export protein (contains WD40 repea 99.27
PTZ00421 493 coronin; Provisional 99.27
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.26
KOG0286343 consensus G-protein beta subunit [General function 99.25
KOG0601524 consensus Cyclin-dependent kinase WEE1 [Cell cycle 99.25
KOG0303 472 consensus Actin-binding protein Coronin, contains 99.24
KOG0286343 consensus G-protein beta subunit [General function 99.23
KOG0283 712 consensus WD40 repeat-containing protein [Function 99.23
KOG0275 508 consensus Conserved WD40 repeat-containing protein 99.23
KOG1166974 consensus Mitotic checkpoint serine/threonine prot 99.21
KOG0302440 consensus Ribosome Assembly protein [General funct 99.21
KOG1407 313 consensus WD40 repeat protein [Function unknown] 99.21
KOG1266458 consensus Protein kinase [Signal transduction mech 99.21
KOG0316307 consensus Conserved WD40 repeat-containing protein 99.21
KOG0293 519 consensus WD40 repeat-containing protein [Function 99.2
KOG0313423 consensus Microtubule binding protein YTM1 (contai 99.2
KOG0295406 consensus WD40 repeat-containing protein [Function 99.2
KOG06061205 consensus Microtubule-associated serine/threonine 99.19
PRK14879211 serine/threonine protein kinase; Provisional 99.19
KOG0645 312 consensus WD40 repeat protein [General function pr 99.18
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.17
KOG0319 775 consensus WD40-repeat-containing subunit of the 18 99.17
KOG0277311 consensus Peroxisomal targeting signal type 2 rece 99.17
KOG0292 1202 consensus Vesicle coat complex COPI, alpha subunit 99.17
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.16
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.16
KOG0273524 consensus Beta-transducin family (WD-40 repeat) pr 99.16
smart00090237 RIO RIO-like kinase. 99.15
KOG0284 464 consensus Polyadenylation factor I complex, subuni 99.15
KOG0310 487 consensus Conserved WD40 repeat-containing protein 99.15
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.14
PLN00181 793 protein SPA1-RELATED; Provisional 99.13
KOG0315311 consensus G-protein beta subunit-like protein (con 99.12
KOG0291 893 consensus WD40-repeat-containing subunit of the 18 99.12
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.11
KOG0315 311 consensus G-protein beta subunit-like protein (con 99.1
KOG0278 334 consensus Serine/threonine kinase receptor-associa 99.1
KOG0973 942 consensus Histone transcription regulator HIRA, WD 99.09
KOG1407313 consensus WD40 repeat protein [Function unknown] 99.09
KOG0640 430 consensus mRNA cleavage stimulating factor complex 99.09
KOG0264422 consensus Nucleosome remodeling factor, subunit CA 99.08
KOG0772 641 consensus Uncharacterized conserved protein, conta 99.08
KOG1273 405 consensus WD40 repeat protein [General function pr 99.07
KOG0305484 consensus Anaphase promoting complex, Cdc20, Cdh1, 99.06
KOG0643 327 consensus Translation initiation factor 3, subunit 99.05
KOG0276 794 consensus Vesicle coat complex COPI, beta' subunit 99.05
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.5e-70  Score=654.47  Aligned_cols=580  Identities=60%  Similarity=0.930  Sum_probs=434.3

Q ss_pred             cCCCcccccccccCCccc-ccccccCCCCCCcccccccccCCCCccchhhchhhhhhcccCCC-CCceeccccee----e
Q 004989           15 MEGSSDSAWQDSDSSRAL-NISGVSDRNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDH-LRNQGGLSGVC----E   88 (720)
Q Consensus        15 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~r~~~e~~~L~~l~H-pnIV~l~~~~~----~   88 (720)
                      |||++++      ++|++ |+++++.++++.                          .+.+.| +||+++++ .+    .
T Consensus         1 ~~~~~~~------~~~~~~~~~~~~~~~~~~--------------------------~~~~~~~~~~~~~~~-~~~~~~~   47 (793)
T PLN00181          1 MKGSSES------NSRGLNNTSGVSEFCTDG--------------------------SKSLSHIDYVRSLLG-SHKEGNL   47 (793)
T ss_pred             CCCcccC------CCcCccCcccccccCCCc--------------------------cchhhHHHHHHHhhc-ccCCccc
Confidence            7888875      78999 899998888777                          234556 68888888 34    2


Q ss_pred             cCCCCCcEEEEEecCCCCHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHCCceeccCCCCcEEEccCCceEEeecCcc
Q 004989           89 NEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASC  168 (720)
Q Consensus        89 ~~~~~~~~~lv~E~~ggsL~~~L~~~~~~l~~~~~~~i~~QIl~aL~yLHs~gIvHrDLKP~NILl~~~~~vkliDfg~a  168 (720)
                      +......++.+|||.+++|.+||......+++.+++.|++||+.||+|||++|||||||||+||||+..|.+|++|||.+
T Consensus        48 ~~~~~~~~~~~~e~~~~~L~~~l~~~~~~~~~~~~~~i~~qi~~al~~lH~~gIvHrDlKP~NiLl~~~~~~k~~d~~~~  127 (793)
T PLN00181         48 DGLDDDSIVRALECEDVSLRQWLDNPDRSVDAFECFHVFRQIVEIVNAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASC  127 (793)
T ss_pred             cccccchhhhhhccCCccHHHHHhcccccccHHHHHHHHHHHHHHHHHHHhCCeeeccCCchhEEEcccCcEEEeecccc
Confidence            22233357888999888999999766667999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCcccccccccccccCCCCCCchhhhhhhhcccccccccccCCCCCCcccccccCCCcccccccccccccccccc
Q 004989          169 SDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKIL  248 (720)
Q Consensus       169 ~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~Dfgla~~~~~~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~  248 (720)
                      .+.+.+.                          ...++++|||+++.........                       . 
T Consensus       128 ~~~~~~~--------------------------~~~~ki~DfG~a~~~~~~~~~~-----------------------~-  157 (793)
T PLN00181        128 SDSGSDE--------------------------DATTKSREIGSSRREEILSERR-----------------------I-  157 (793)
T ss_pred             Ccccccc--------------------------cCcccccccccccccccccccc-----------------------h-
Confidence            7654321                          1135679999987432110000                       0 


Q ss_pred             ccccchhhhhcccCCCCccccccccCCcccCcccccCCCCCccccchhhhchhhhccccCCCCchHHHHHHHhhcCCCCc
Q 004989          249 DNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPP  328 (720)
Q Consensus       249 d~g~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~~~~~s~~sDIwSLGvll~eLltpf~~~~~~~~~~~~l~~~~~p~  328 (720)
                           ..........++......+||++|||||++.+..|+.++|||||||+||||++|+.+.......+..+....+|+
T Consensus       158 -----~~~~~~~~~~~~~~~~~~~gt~~Y~APE~~~~~~~~~~sDVwSlGviL~ELl~~~~~~~~~~~~~~~~~~~~~~~  232 (793)
T PLN00181        158 -----EKLEEVKKQPFPMKQILAMEMSWYTSPEEDNGSSSNCASDVYRLGVLLFELFCPVSSREEKSRTMSSLRHRVLPP  232 (793)
T ss_pred             -----hhhhccccCCCcccccccCCCcceEChhhhccCCCCchhhhhhHHHHHHHHhhCCCchhhHHHHHHHHHHhhcCh
Confidence                 000011122233333446899999999999999999999999999999999998877665555566666666676


Q ss_pred             cccccCchHHHHHHHcCCCCCCCCCChHHHHcCcccCCCccchHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Q 004989          329 QLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKL  408 (720)
Q Consensus       329 ~~~~~~p~~~~Li~~~L~~dP~~Rpta~eiL~hp~~~~~~~~l~e~~~~~~~~e~~~~~e~L~~fL~~l~~qK~e~~~~l  408 (720)
                      .....++...+++.+||+++|.+||++.|+|+||||......+.+++......+..++.+.+.+|+...+++++++..++
T Consensus       233 ~~~~~~~~~~~~~~~~L~~~P~~Rps~~eil~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  312 (793)
T PLN00181        233 QILLNWPKEASFCLWLLHPEPSCRPSMSELLQSEFINEPRENLEEREAAMELRDRIEEQELLLEFLFLIQQRKQEAADKL  312 (793)
T ss_pred             hhhhcCHHHHHHHHHhCCCChhhCcChHHHhhchhhhhhhHHhhhhhhhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            66667788889999999999999999999999999998766555555555555555666777888888889999999999


Q ss_pred             HHHHHhhhcchHHHHHHHHHHHhcCCCCcccccccccCCCCCCCCccccCCCCCcccCcccccccccccccccccccccc
Q 004989          409 QDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLD  488 (720)
Q Consensus       409 q~el~~Le~Di~evE~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  488 (720)
                      +.+++.|+.||+++++|+......+...                         ......++++..+......+.....  
T Consensus       313 ~~~~~~l~~~i~~~~~r~~~~~~~~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~~~~~--  365 (793)
T PLN00181        313 QDTISLLSSDIDQVVKRQLVLQQKGSDV-------------------------RSFLASRKRIRQGAETLAAEEENDD--  365 (793)
T ss_pred             HHHHHHHHHHHHHHHhhhhhhccccccc-------------------------ccccccchhhhccccchhhcccccc--
Confidence            9999999999999998775543322111                         1112223333333322211111110  


Q ss_pred             ccccCCCCCCccchhhhhhHHHHhHhHHHHHHHhhccCCCCC---CCCCccccccCCC-CCCCCCcccccccccccCCCc
Q 004989          489 DNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKP---SGRPLVRHSQLSS-DGRTSKPLVNERSSINNLGSK  564 (720)
Q Consensus       489 ~~~~~~~~~~~~~~~~~~~r~~~~~~~l~~~y~~~r~~~~~~---~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~  564 (720)
                        ..+....+..+.+++++|||.||++||+|||++|++....   ..++..+.++... +++++     +.++.++.+..
T Consensus       366 --~~~~~~~~~~s~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~  438 (793)
T PLN00181        366 --NSSKLDDTLESTLLESSRLMRNLKKLESVYFATRYRQIKAAAAAEKPLARYYSALSENGRSS-----EKSSMSNPAKP  438 (793)
T ss_pred             --ccccccccccccchhhhHHHHHHHHHHHHHhhhhhccccccccccccccccccccccccccc-----ccccccccccc
Confidence              0001223446677889999999999999999999865332   3444444444443 33332     33444444333


Q ss_pred             cC-c-cCCCCCccccchhhhhhhhccccceEEeeeeccCCCCCCCCCeEEEEECCCCCEEEEeeCCCcEEEeeCCccccc
Q 004989          565 EG-Y-SEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINE  642 (720)
Q Consensus       565 ~~-~-~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~V~sv~f~~dg~~lat~~~d~~i~iwd~~~~~~~  642 (720)
                      +. | ....+++|+++|+++|+++++++++++.+.++.|++.+|.+.|++|+|+|||++|||||.|++|+|||+......
T Consensus       439 ~~~~~~~~~~~~~~~~~~~gl~~~~~~~~~~~~~~~~~~~~~~~~~~V~~i~fs~dg~~latgg~D~~I~iwd~~~~~~~  518 (793)
T PLN00181        439 PDFYINDSRQGGWIDPFLEGLCKYLSFSKLRVKADLKQGDLLNSSNLVCAIGFDRDGEFFATAGVNKKIKIFECESIIKD  518 (793)
T ss_pred             ccccccccccccchhhhhhhhhhhhcccceEEEEeeccccccCCCCcEEEEEECCCCCEEEEEeCCCEEEEEECCccccc
Confidence            22 2 122366789999999999999999999999999999999999999999999999999999999999998765444


Q ss_pred             ccccccceEEecCCCCEEEEEEecCCCCEEEEEeCCCcEEEEECCCCcEEEE-------EEEEeecC-CceEEEecCccc
Q 004989          643 NRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVGQVLHLIYFSA-------LYCIVLNK-LLIIFRYGMFQE  714 (720)
Q Consensus       643 ~~~~~~~~~~~~~~~~i~~l~w~~~~~~~laS~s~D~~v~lWD~~tg~~~~~-------v~~v~~~~-~~~~~~~~~~~~  714 (720)
                      ..+.|+|+..+.++++|.+++|+|+++++|||+++||+|+|||+.+++.+.+       |++++|++ .+..+++|+.|.
T Consensus       519 ~~~~~~~~~~~~~~~~v~~l~~~~~~~~~las~~~Dg~v~lWd~~~~~~~~~~~~H~~~V~~l~~~p~~~~~L~Sgs~Dg  598 (793)
T PLN00181        519 GRDIHYPVVELASRSKLSGICWNSYIKSQVASSNFEGVVQVWDVARSQLVTEMKEHEKRVWSIDYSSADPTLLASGSDDG  598 (793)
T ss_pred             ccccccceEEecccCceeeEEeccCCCCEEEEEeCCCeEEEEECCCCeEEEEecCCCCCEEEEEEcCCCCCEEEEEcCCC
Confidence            4567788888888889999999998888999999999999999999988775       89999996 678999999986


Q ss_pred             eE
Q 004989          715 VK  716 (720)
Q Consensus       715 ~~  716 (720)
                      ..
T Consensus       599 ~v  600 (793)
T PLN00181        599 SV  600 (793)
T ss_pred             EE
Confidence            43

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] Back     alignment and domain information
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] Back     alignment and domain information
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] Back     alignment and domain information
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] Back     alignment and domain information
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] Back     alignment and domain information
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] Back     alignment and domain information
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] Back     alignment and domain information
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] Back     alignment and domain information
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only] Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] Back     alignment and domain information
>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] Back     alignment and domain information
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0271 consensus Notchless-like WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0272 consensus U4/U6 small nuclear ribonucleoprotein Prp4 (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0318 consensus WD40 repeat stress protein/actin interacting protein [Cytoskeleton] Back     alignment and domain information
>KOG0266 consensus WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0263 consensus Transcription initiation factor TFIID, subunit TAF5 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>KOG0279 consensus G protein beta subunit-like protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0282 consensus mRNA splicing factor [Function unknown] Back     alignment and domain information
>KOG0265 consensus U5 snRNP-specific protein-like factor and related proteins [RNA processing and modification] Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0285 consensus Pleiotropic regulator 1 [RNA processing and modification] Back     alignment and domain information
>KOG0647 consensus mRNA export protein (contains WD40 repeats) [RNA processing and modification] Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0303 consensus Actin-binding protein Coronin, contains WD40 repeats [Cytoskeleton] Back     alignment and domain information
>KOG0286 consensus G-protein beta subunit [General function prediction only] Back     alignment and domain information
>KOG0283 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0275 consensus Conserved WD40 repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0302 consensus Ribosome Assembly protein [General function prediction only] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG1266 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0316 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0293 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0313 consensus Microtubule binding protein YTM1 (contains WD40 repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0295 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0645 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0319 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>KOG0277 consensus Peroxisomal targeting signal type 2 receptor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0273 consensus Beta-transducin family (WD-40 repeat) protein [Chromatin structure and dynamics] Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>KOG0284 consensus Polyadenylation factor I complex, subunit PFS2 [RNA processing and modification] Back     alignment and domain information
>KOG0310 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0291 consensus WD40-repeat-containing subunit of the 18S rRNA processing complex [RNA processing and modification] Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG0315 consensus G-protein beta subunit-like protein (contains WD40 repeats) [General function prediction only] Back     alignment and domain information
>KOG0278 consensus Serine/threonine kinase receptor-associated protein [Lipid transport and metabolism] Back     alignment and domain information
>KOG0973 consensus Histone transcription regulator HIRA, WD repeat superfamily [Cell cycle control, cell division, chromosome partitioning; Transcription] Back     alignment and domain information
>KOG1407 consensus WD40 repeat protein [Function unknown] Back     alignment and domain information
>KOG0640 consensus mRNA cleavage stimulating factor complex; subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0264 consensus Nucleosome remodeling factor, subunit CAF1/NURF55/MSI1 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown] Back     alignment and domain information
>KOG1273 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG0305 consensus Anaphase promoting complex, Cdc20, Cdh1, and Ama1 subunits [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0643 consensus Translation initiation factor 3, subunit i (eIF-3i)/TGF-beta receptor-interacting protein (TRIP-1) [Translation, ribosomal structure and biogenesis; Signal transduction mechanisms] Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
4g31_A299 Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 8e-13
3qd2_B332 Crsytal Structure Of Mouse Perk Kinase Domain Lengt 3e-11
1zy4_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 2e-04
1zyc_A303 Crystal Structure Of Eif2alpha Protein Kinase Gcn2: 2e-04
>pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 Back     alignment and structure 
Iteration: 1

 Score = 72.4 bits (176), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 97/264 (36%), Gaps = 92/264 (34%)
Query: 106 SLRQWL------DKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPS--CFVMSSF 157
           +L+ W+      ++ +RSV    CLHIF QI E V   HS+G++  +++PS   F M   
Sbjct: 101 NLKDWMNGRCTIEERERSV----CLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDV 156
Query: 158 NHVSFIEXXXXXXXXXXXHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPT 217
             V                                                D  LVTA  
Sbjct: 157 VKVG-----------------------------------------------DFGLVTAMD 169
Query: 218 NDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWY 277
            D  E + +    AY  H   V                                  T  Y
Sbjct: 170 QDEEEQTVLTPMPAYARHTGQVG---------------------------------TKLY 196
Query: 278 ASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKE 337
            SPE++ G   S   DI+ LG++LFEL  PFST  E+ RT++ +R+   PP    K+P E
Sbjct: 197 MSPEQIHGNSYSHKVDIFSLGLILFELLYPFSTQMERVRTLTDVRNLKFPPLFTQKYPCE 256
Query: 338 ASFCLWLLHPEPSGRPKMGELLQS 361
                 +L P P  RP+   ++++
Sbjct: 257 YVMVQDMLSPSPMERPEAINIIEN 280
>pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 Back     alignment and structure
>pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 Back     alignment and structure
>pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query720
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 3e-23
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 7e-20
2a19_B284 Interferon-induced, double-stranded RNA-activated 1e-15
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 6e-14
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 3e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 8e-10
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 3e-09
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 9e-09
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-08
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 2e-07
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 5e-07
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 8e-07
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-06
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-06
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 3e-06
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 3e-06
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 3e-06
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 4e-06
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 6e-06
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-05
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-05
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 2e-05
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 6e-05
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 9e-05
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-04
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 2e-04
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 3e-04
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 6e-04
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 7e-04
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
 Score =  100 bits (250), Expect = 3e-23
 Identities = 29/88 (32%), Positives = 49/88 (55%)

Query: 277 YASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPK 336
           Y SPE++ G   S   DI+ LG++LFEL   FST  E+ R ++ +R+   P     K+P+
Sbjct: 242 YMSPEQIHGNNYSHKVDIFSLGLILFELLYSFSTQMERVRIITDVRNLKFPLLFTQKYPQ 301

Query: 337 EASFCLWLLHPEPSGRPKMGELLQSEFL 364
           E      +L P P+ RP+  +++++   
Sbjct: 302 EHMMVQDMLSPSPTERPEATDIIENAIF 329
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.98
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.98
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.98
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.98
3bhy_A283 Death-associated protein kinase 3; death associate 99.98
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.98
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.98
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.98
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.98
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.98
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.98
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.98
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.98
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.98
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.98
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.98
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.98
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.98
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.98
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.98
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.98
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.98
3soc_A322 Activin receptor type-2A; structural genomics cons 99.98
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.98
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.97
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.97
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.97
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.97
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.97
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.97
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.97
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.97
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.97
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.97
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.97
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.97
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.97
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.97
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.97
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.97
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.97
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.97
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.97
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.97
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.97
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.97
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.97
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.97
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.97
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.97
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.97
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.97
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.97
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.97
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.97
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.97
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.97
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.97
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.97
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.97
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.97
3q4u_A301 Activin receptor type-1; structural genomics conso 99.97
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.97
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.97
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.97
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.97
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.97
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.97
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.97
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.97
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.97
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.97
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.97
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.97
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.97
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.97
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.97
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.97
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.97
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.97
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.97
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.97
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.97
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.97
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.97
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.97
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.97
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.97
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.97
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.97
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.97
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.97
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.97
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.97
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.97
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.97
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.97
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.97
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.97
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.97
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.97
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.97
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.97
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.97
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.97
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.96
3qa8_A676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.96
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.96
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.96
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.96
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.96
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.96
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.96
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.96
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.96
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.96
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.96
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.96
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.95
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.95
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.95
3uqc_A286 Probable conserved transmembrane protein; structur 99.94
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.92
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.73
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 99.58
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.58
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.57
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 99.55
2pm7_B 297 Protein transport protein SEC13, protein transport 99.54
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.54
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 99.53
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 99.52
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.52
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.52
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.52
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 99.52
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.51
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.51
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 99.5
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 99.49
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.49
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.48
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.48
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.48
3ow8_A321 WD repeat-containing protein 61; structural genomi 99.48
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.48
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 99.48
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 99.48
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.47
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.47
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 99.46
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 99.45
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.45
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.44
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.44
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.44
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 99.44
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.43
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 99.43
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 99.43
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.43
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.42
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 99.41
4g56_B357 MGC81050 protein; protein arginine methyltransfera 99.4
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.4
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.4
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 99.4
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 99.39
2pm7_B297 Protein transport protein SEC13, protein transport 99.39
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.38
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.38
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.37
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.37
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.37
2ymu_A577 WD-40 repeat protein; unknown function, two domain 99.34
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.34
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.33
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.33
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.33
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.32
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.32
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.32
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 99.31
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.3
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 99.29
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.29
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.29
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.28
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.28
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 99.27
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.27
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.27
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.27
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.27
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.25
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.25
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.25
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.24
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.24
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 99.24
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.22
3jro_A 753 Fusion protein of protein transport protein SEC13 99.22
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.22
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 99.22
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.22
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.21
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.21
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 99.21
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.21
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 99.21
3jrp_A 379 Fusion protein of protein transport protein SEC13 99.21
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 99.2
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.2
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.2
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.2
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.2
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.2
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.18
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.18
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.18
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.17
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.17
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.17
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 99.17
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 99.16
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.16
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.16
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.16
4aez_A 401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.15
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 99.14
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.13
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.13
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.12
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.12
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.12
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.11
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.1
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 99.1
3jro_A 753 Fusion protein of protein transport protein SEC13 99.09
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 99.08
2w18_A 356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.08
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 99.07
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.06
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 99.05
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.04
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.03
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.02
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 98.99
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 98.93
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 98.93
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 98.93
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.92
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.9
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.84
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 98.72
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 98.51
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.5
1k32_A 1045 Tricorn protease; protein degradation, substrate g 98.4
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.37
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.34
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 98.32
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 98.32
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.31
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.3
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 98.26
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.24
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 98.24
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 98.21
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 98.21
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.2
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 98.2
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 98.19
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.18
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.17
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 98.16
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 98.15
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 98.15
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.15
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 98.14
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 98.12
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.07
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 98.05
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 98.02
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.01
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 98.0
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.99
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.98
1k32_A 1045 Tricorn protease; protein degradation, substrate g 97.96
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.93
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.9
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.88
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.87
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 97.86
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.85
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.82
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 97.72
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.62
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 97.59
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.55
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.53
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.52
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 97.51
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.47
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 97.42
1q7f_A 286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.38
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.35
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.31
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.3
3pe7_A 388 Oligogalacturonate lyase; seven-bladed beta-propel 97.28
3e5z_A 296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 97.25
3c5m_A 396 Oligogalacturonate lyase; blade-shaped beta-propel 97.25
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.21
3r70_A320 Aminoglycoside phosphotransferase; structural geno 97.18
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 97.1
2yle_A229 Protein spire homolog 1; actin-binding protein, ac 97.06
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 97.04
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 97.04
2oiz_A 361 Aromatic amine dehydrogenase, large subunit; oxido 96.93
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 96.83
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 96.75
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.63
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.61
2gop_A 347 Trilobed protease; beta propeller, open velcro, hy 96.44
2dg1_A 333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.41
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.26
3sjl_D 386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 96.23
3no2_A 276 Uncharacterized protein; six-bladed beta-propeller 96.15
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 96.14
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 96.04
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 96.0
1pjx_A 314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.95
3ats_A357 Putative uncharacterized protein; hypothetical pro 95.9
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 95.87
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 95.73
2qe8_A 343 Uncharacterized protein; structural genomics, join 95.66
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 95.56
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 95.53
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 95.46
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 95.35
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 95.28
2mad_H 373 Methylamine dehydrogenase (heavy subunit); oxidore 95.27
2z2n_A 299 Virginiamycin B lyase; seven-bladed beta-propeller 95.23
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 95.16
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 95.09
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 95.06
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 94.91
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 94.62
2ghs_A 326 AGR_C_1268P; regucalcin, structural genomics, join 94.57
3dr2_A 305 Exported gluconolactonase; gluconolactonase SMP-30 94.45
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.39
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 94.13
3c75_H 426 MADH, methylamine dehydrogenase heavy chain; coppe 94.1
2q83_A346 YTAA protein; 2635576, structural genomics, joint 94.09
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 94.04
2qe8_A343 Uncharacterized protein; structural genomics, join 94.01
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 93.62
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 93.21
2qc5_A 300 Streptogramin B lactonase; beta propeller, lyase; 92.79
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 92.71
3hrp_A 409 Uncharacterized protein; NP_812590.1, structural g 92.66
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 92.52
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 92.45
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 92.38
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 92.32
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 92.21
1mda_H 368 Methylamine dehydrogenase (heavy subunit); electro 91.97
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 91.67
2p4o_A 306 Hypothetical protein; putative lactonase, structur 91.36
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 91.31
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 90.89
1fwx_A 595 Nitrous oxide reductase; beta-propeller domain, cu 89.69
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=1.2e-45  Score=388.94  Aligned_cols=211  Identities=14%  Similarity=0.149  Sum_probs=173.0

Q ss_pred             hchhhhhhcccCCCCCceecccceeecCCCCCcEEEEEec-CCCCHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
Q 004989           63 RKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEW-GDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQG  141 (720)
Q Consensus        63 r~~~e~~~L~~l~HpnIV~l~~~~~~~~~~~~~~~lv~E~-~ggsL~~~L~~~~~~l~~~~~~~i~~QIl~aL~yLHs~g  141 (720)
                      +..+|+.+|++++|||||++++++.........+|+|||| .||+|.++|.+.+ .+++.+++.|++||+.||+|||++|
T Consensus        71 ~~~~E~~il~~l~HpnIV~~~~~~~~~~~~~~~~~lvmEy~~gg~L~~~l~~~~-~l~~~~~~~~~~qi~~aL~ylH~~~  149 (290)
T 3fpq_A           71 RFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFK-VMKIKVLRSWCRQILKGLQFLHTRT  149 (290)
T ss_dssp             HHHHHHHHHHTCCCTTBCCEEEEEEEEETTEEEEEEEEECCCSCBHHHHHHHHS-SCCHHHHHHHHHHHHHHHHHHHTSS
T ss_pred             HHHHHHHHHHhCCCCCCCcEEEEEeeccCCCcEEEEEEeCCCCCCHHHHHHhcC-CCCHHHHHHHHHHHHHHHHHHHHCC
Confidence            4558899999999999999999433322333468999999 8999999996543 4999999999999999999999998


Q ss_pred             --ceeccCCCCcEEEc-cCCceEEeecCcccCCCCCCcccccccccccccCCCCCCchhhhhhhhcccccccccccCCCC
Q 004989          142 --IVVHNVRPSCFVMS-SFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTN  218 (720)
Q Consensus       142 --IvHrDLKP~NILl~-~~~~vkliDfg~a~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~Dfgla~~~~~  218 (720)
                        ||||||||+||||+ .+|.+||+|||+|+.....                                            
T Consensus       150 ~~IiHRDlKp~NILl~~~~g~vKl~DFGla~~~~~~--------------------------------------------  185 (290)
T 3fpq_A          150 PPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRAS--------------------------------------------  185 (290)
T ss_dssp             SCCCCCCCCGGGEEESSTTSCEEECCTTGGGGCCTT--------------------------------------------
T ss_pred             CCEEecccChhheeEECCCCCEEEEeCcCCEeCCCC--------------------------------------------
Confidence              99999999999998 4789999888887321000                                            


Q ss_pred             CCcccccccCCCccccccccccccccccccccccchhhhhcccCCCCccccccccCCcccCcccccCCCCCccccchhhh
Q 004989          219 DLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLG  298 (720)
Q Consensus       219 ~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~~~~~s~~sDIwSLG  298 (720)
                                                                      .....+||+.|||||++.+ .|+.++||||||
T Consensus       186 ------------------------------------------------~~~~~~GTp~YmAPE~~~~-~y~~~~DiwSlG  216 (290)
T 3fpq_A          186 ------------------------------------------------FAKAVIGTPEFMAPEMYEE-KYDESVDVYAFG  216 (290)
T ss_dssp             ------------------------------------------------SBEESCSSCCCCCGGGGGT-CCCTHHHHHHHH
T ss_pred             ------------------------------------------------ccCCcccCccccCHHHcCC-CCCcHHHHHHHH
Confidence                                                            0012579999999999976 499999999999


Q ss_pred             chhhhccc---cCCCCchHHHHHHHhhcCCCCccccccCc-hHHHHHHHcCCCCCCCCCChHHHHcCcccCCC
Q 004989          299 VLLFELFC---PFSTGEEKTRTMSSLRHRVLPPQLLLKFP-KEASFCLWLLHPEPSGRPKMGELLQSEFLNEP  367 (720)
Q Consensus       299 vll~eLlt---pf~~~~~~~~~~~~l~~~~~p~~~~~~~p-~~~~Li~~~L~~dP~~Rpta~eiL~hp~~~~~  367 (720)
                      |+||||+|   ||.........+..+.....|+.+....+ ...+||.+||++||++|||+.|+|+||||++.
T Consensus       217 vilyelltg~~Pf~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~li~~~L~~dP~~R~s~~e~l~Hp~~~~~  289 (290)
T 3fpq_A          217 MCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEE  289 (290)
T ss_dssp             HHHHHHHHSSCTTTTCSSHHHHHHHHTTTCCCGGGGGCCCHHHHHHHHHHSCSSGGGSCCHHHHHTSGGGC--
T ss_pred             HHHHHHHHCCCCCCCCCcHHHHHHHHHcCCCCCCCCccCCHHHHHHHHHHccCChhHCcCHHHHhcCccccCC
Confidence            99999999   78766666677777777777776665554 45599999999999999999999999999863
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2yle_A Protein spire homolog 1; actin-binding protein, actin polymerization; 1.80A {Homo sapiens} PDB: 2ylf_A 3r7g_A 3rbw_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 720
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-12
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-12
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 8e-12
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-11
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-11
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 4e-11
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 5e-11
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 6e-11
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 0.004
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 9e-11
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 2e-10
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-10
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 5e-10
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 8e-10
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 9e-10
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 1e-09
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 1e-09
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 2e-09
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 2e-09
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 3e-09
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 0.002
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 4e-09
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 5e-09
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-09
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-09
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 9e-09
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-08
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 1e-08
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-08
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-08
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-08
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 5e-08
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 8e-08
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 9e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 1e-07
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-07
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-07
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 4e-07
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 4e-07
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-07
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 9e-07
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-06
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 7e-04
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 4e-06
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 5e-06
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 6e-06
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 7e-06
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 7e-06
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 7e-06
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 1e-05
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-05
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-05
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 2e-05
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 3e-05
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 4e-05
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-05
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 7e-05
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 1e-04
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 2e-04
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-04
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-04
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 0.001
d1erja_ 388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.003
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Serine/threonine-protein kinase Nek2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.2 bits (161), Expect = 2e-12
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 4/97 (4%)

Query: 271 LMETNWYASPEELAGAPVSCASDIYRLGVLLFELFC--PFSTGEEKTRTMSSLRHRVLPP 328
            + T +Y SPE++     +  SDI+ LG LL+EL    P  T   +      +R      
Sbjct: 174 FVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRR 233

Query: 329 QLLLKFPKEA-SFCLWLLHPEPSGRPKMGELLQSEFL 364
            +  ++  E       +L+ +   RP + E+L++  +
Sbjct: 234 -IPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLI 269
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query720
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.98
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.97
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.62
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.49
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.49
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.44
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.43
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 99.42
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.41
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.4
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 99.39
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.38
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.38
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.38
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.37
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 99.37
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.34
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.28
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.27
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.26
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.25
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.2
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.19
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.18
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.12
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.09
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.08
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.06
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.02
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 98.88
d1pgua2 287 Actin interacting protein 1 {Baker's yeast (Saccha 98.86
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.84
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.76
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.73
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 98.69
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.63
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.58
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.52
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 98.41
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 98.33
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 98.29
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 98.28
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 98.27
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 98.23
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 98.06
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 98.0
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.94
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 97.92
d2madh_ 373 Methylamine dehydrogenase, H-chain {Gram negative 97.64
d1mdah_ 368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.43
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 97.24
d2bgra1 470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 97.19
d2bbkh_ 355 Methylamine dehydrogenase, H-chain {Paracoccus den 97.07
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 96.99
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 95.77
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 95.4
d1jofa_ 365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 94.51
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 93.67
d2p4oa1 302 Hypothetical protein All0351 homologue {Nostoc pun 93.2
d1qnia2 441 Nitrous oxide reductase, N-terminal domain {Pseudo 92.55
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 91.78
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 91.72
d1k32a2 281 Tricorn protease N-terminal domain {Archaeon Therm 91.72
d2hqsa1 269 TolB, C-terminal domain {Escherichia coli [TaxId: 91.22
d1rwia_ 260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.46
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 88.9
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 87.84
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 87.77
d1xfda1 465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 87.65
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 87.36
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 86.26
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 85.27
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 83.11
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 82.28
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 81.35
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 80.48
d2dg1a1 319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 80.05
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Protein kinase wnk1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.7e-43  Score=367.17  Aligned_cols=209  Identities=14%  Similarity=0.145  Sum_probs=173.1

Q ss_pred             hchhhhhhcccCCCCCceecccceeecCCCCCcEEEEEec-CCCCHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHCC
Q 004989           63 RKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEW-GDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQG  141 (720)
Q Consensus        63 r~~~e~~~L~~l~HpnIV~l~~~~~~~~~~~~~~~lv~E~-~ggsL~~~L~~~~~~l~~~~~~~i~~QIl~aL~yLHs~g  141 (720)
                      +..+|..+|++++|||||++++.+.........+|+|||| .|++|.+++.+.. .+++.+++.|+.||+.||+|||++|
T Consensus        54 ~~~~E~~il~~l~HpnIv~~~~~~~~~~~~~~~~~ivmE~~~~g~L~~~l~~~~-~~~~~~~~~~~~qi~~gl~yLH~~~  132 (270)
T d1t4ha_          54 RFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLVTELMTSGTLKTYLKRFK-VMKIKVLRSWCRQILKGLQFLHTRT  132 (270)
T ss_dssp             HHHHHHHHHTTCCCTTBCCEEEEEEEESSSCEEEEEEEECCCSCBHHHHHHHHS-SCCHHHHHHHHHHHHHHHHHHHTSS
T ss_pred             HHHHHHHHHHhCCCCCeeeEEEEEeeccccCCEEEEEEeCCCCCcHHHHHhccc-cccHHHHHHHHHHHHHHHHHHHHCC
Confidence            4558889999999999999999443333334468999999 8999999995543 4999999999999999999999999


Q ss_pred             --ceeccCCCCcEEEc-cCCceEEeecCcccCCCCCCcccccccccccccCCCCCCchhhhhhhhcccccccccccCCCC
Q 004989          142 --IVVHNVRPSCFVMS-SFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTN  218 (720)
Q Consensus       142 --IvHrDLKP~NILl~-~~~~vkliDfg~a~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~Dfgla~~~~~  218 (720)
                        ||||||||+|||++ .++.+||+|||+++.....                                            
T Consensus       133 ~~IiHrDiKp~NILl~~~~~~~Kl~DFGla~~~~~~--------------------------------------------  168 (270)
T d1t4ha_         133 PPIIHRDLKCDNIFITGPTGSVKIGDLGLATLKRAS--------------------------------------------  168 (270)
T ss_dssp             SCCCCSCCCGGGEEESSTTSCEEECCTTGGGGCCTT--------------------------------------------
T ss_pred             CCEEeCCcChhhceeeCCCCCEEEeecCcceeccCC--------------------------------------------
Confidence              99999999999997 5789999988887321000                                            


Q ss_pred             CCcccccccCCCccccccccccccccccccccccchhhhhcccCCCCccccccccCCcccCcccccCCCCCccccchhhh
Q 004989          219 DLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLG  298 (720)
Q Consensus       219 ~~~~~~~~q~~~~~~~~~~~~~~~~~~~~~d~g~~~~~~~~~~~~~~~~~~~~~GT~~Y~APE~l~~~~~s~~sDIwSLG  298 (720)
                                                                      .....+||+.|||||++.+. |+.++||||||
T Consensus       169 ------------------------------------------------~~~~~~GT~~Y~aPE~~~~~-~~~~~DIwSlG  199 (270)
T d1t4ha_         169 ------------------------------------------------FAKAVIGTPEFMAPEMYEEK-YDESVDVYAFG  199 (270)
T ss_dssp             ------------------------------------------------SBEESCSSCCCCCGGGGGTC-CCTHHHHHHHH
T ss_pred             ------------------------------------------------ccCCcccCccccCHHHhCCC-CCCcCchhhHH
Confidence                                                            00114799999999999764 99999999999


Q ss_pred             chhhhccc---cCCCCchHHHHHHHhhcCCCCccccccCc-hHHHHHHHcCCCCCCCCCChHHHHcCcccC
Q 004989          299 VLLFELFC---PFSTGEEKTRTMSSLRHRVLPPQLLLKFP-KEASFCLWLLHPEPSGRPKMGELLQSEFLN  365 (720)
Q Consensus       299 vll~eLlt---pf~~~~~~~~~~~~l~~~~~p~~~~~~~p-~~~~Li~~~L~~dP~~Rpta~eiL~hp~~~  365 (720)
                      |++|||++   ||.........+..+..+..|+.+....+ ...+||.+||.+||++|||+.|+|+||||+
T Consensus       200 vilyel~~g~~Pf~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~li~~~l~~dp~~R~s~~ell~Hp~fk  270 (270)
T d1t4ha_         200 MCMLEMATSEYPYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ  270 (270)
T ss_dssp             HHHHHHHHSSCTTTTCSSHHHHHHHHTTTCCCGGGGGCCCHHHHHHHHHHSCSSGGGSCCHHHHHTSGGGC
T ss_pred             HHHHHHHHCCCCCCCcccHHHHHHHHHcCCCCcccCccCCHHHHHHHHHHccCCHhHCcCHHHHhCCcccC
Confidence            99999999   88776666677777777777776665554 455999999999999999999999999995
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure