Citrus Sinensis ID: 005011
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 719 | 2.2.26 [Sep-21-2011] | |||||||
| O23463 | 923 | Calmodulin-binding transc | yes | no | 0.977 | 0.761 | 0.578 | 0.0 | |
| Q9LSP8 | 838 | Calmodulin-binding transc | no | no | 0.899 | 0.772 | 0.535 | 0.0 | |
| Q8GSA7 | 1032 | Calmodulin-binding transc | no | no | 0.767 | 0.534 | 0.327 | 4e-81 | |
| Q9FY74 | 1007 | Calmodulin-binding transc | no | no | 0.789 | 0.564 | 0.317 | 4e-75 | |
| Q6NPP4 | 1050 | Calmodulin-binding transc | no | no | 0.774 | 0.530 | 0.320 | 1e-74 | |
| Q9FYG2 | 1016 | Calmodulin-binding transc | no | no | 0.727 | 0.514 | 0.356 | 1e-70 | |
| O94983 | 1202 | Calmodulin-binding transc | yes | no | 0.414 | 0.247 | 0.253 | 2e-10 | |
| Q9Y6Y1 | 1673 | Calmodulin-binding transc | no | no | 0.158 | 0.068 | 0.3 | 7e-10 | |
| Q80Y50 | 1208 | Calmodulin-binding transc | yes | no | 0.385 | 0.229 | 0.261 | 7e-10 | |
| A2A891 | 1682 | Calmodulin-binding transc | no | no | 0.158 | 0.067 | 0.3 | 7e-10 |
| >sp|O23463|CMTA5_ARATH Calmodulin-binding transcription activator 5 OS=Arabidopsis thaliana GN=CMTA5 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 833 bits (2153), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 420/726 (57%), Positives = 539/726 (74%), Gaps = 23/726 (3%)
Query: 1 MRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAE 60
+RLHE+NTL+WD+L+V D ++ + P + +F +Q TA +G+ G+ ++ +
Sbjct: 202 IRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRGSVKQGNHLAGYNGSVD 261
Query: 61 VSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILAG 120
+ S L P+ ++NN+ G ++ QR +F T D L
Sbjct: 262 IPS---FPGLEDPVYQNNNSCGAGEFSSQHSHCGVDPNL--QRRDFSATVTDQPGDALLN 316
Query: 121 DGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG----------HHQFTVPEHLFSIT 170
+G SQDSFG+W+N ++DSPGSVDDP LE + G H +PE +F+IT
Sbjct: 317 NGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPTVFHSHSDIPEQVFNIT 376
Query: 171 DVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHS 230
DVSPAWA+S EKTKILVTGFFH HL +SN+ C+CGE+RVPAEF+Q GVYRCFLPP S
Sbjct: 377 DVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPAEFLQMGVYRCFLPPQS 436
Query: 231 PGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDK-SKWEEFQVQMRLAHLLFSSF 289
PG+ LY+S+DG+KPISQ+ +FE+RS Q +D+ KWEEF+ Q+RLAHLLF+S
Sbjct: 437 PGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWEEFEFQVRLAHLLFTSS 496
Query: 290 KGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKS 349
+++L+SK+ P +L EAKK AS+++ + NSWAYL KS+ +A+D FELTLK+
Sbjct: 497 NKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEVPFDQARDHLFELTLKN 556
Query: 350 KLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTAL 409
+LKEWLLE+V+E T EYD G GVIHLCA+LGYTW+ILLFSW+ +SLDFRDK GWTAL
Sbjct: 557 RLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSWANISLDFRDKQGWTAL 616
Query: 410 HWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 469
HWAAYYGREKMV LLSAGA+PNLVTDPT + GG AAD+A +KG+DGLAAFL+E+ LV
Sbjct: 617 HWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQKGYDGLAAFLAEKCLV 676
Query: 470 AQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAARIQAAFRE 528
AQF DM AGNISG+L+T + + + N E+E LKDTL+AYRTAAEAAARIQ AFRE
Sbjct: 677 AQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAYRTAAEAAARIQGAFRE 736
Query: 529 HSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKEF 588
H LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAAARIQ+RF++WK+R+EF
Sbjct: 737 HELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAAARIQYRFQTWKMRREF 796
Query: 589 LNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAV 648
LNMR++AI+IQAAFRGFQVR+QY KI WSVGVLEKAILRWRLKRKGFRGLQV +
Sbjct: 797 LNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKRKGFRGLQVSQ------ 850
Query: 649 SDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLEYE 708
D +A EDFY+ S+KQAEER+ERSVV+VQ+MFRSKKAQ++YRRMKLAH++A+LEY+
Sbjct: 851 PDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRMKLAHEEAQLEYD 910
Query: 709 GLLDPD 714
G+ + D
Sbjct: 911 GMQELD 916
|
Regulates transcriptional activity in response to calcium signals. Binds to the consensus sequence 5'-[ACG]CGCG[GTC]-3'. Activates the expression of the V-PPase proton pump in pollen. Arabidopsis thaliana (taxid: 3702) |
| >sp|Q9LSP8|CMTA6_ARATH Calmodulin-binding transcription activator 6 OS=Arabidopsis thaliana GN=CMTA6 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q8GSA7|CMTA3_ARATH Calmodulin-binding transcription activator 3 OS=Arabidopsis thaliana GN=CMTA3 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FY74|CMTA1_ARATH Calmodulin-binding transcription activator 1 OS=Arabidopsis thaliana GN=CMTA1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q6NPP4|CMTA2_ARATH Calmodulin-binding transcription activator 2 OS=Arabidopsis thaliana GN=CMTA2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FYG2|CMTA4_ARATH Calmodulin-binding transcription activator 4 OS=Arabidopsis thaliana GN=CMTA4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O94983|CMTA2_HUMAN Calmodulin-binding transcription activator 2 OS=Homo sapiens GN=CAMTA2 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9Y6Y1|CMTA1_HUMAN Calmodulin-binding transcription activator 1 OS=Homo sapiens GN=CAMTA1 PE=1 SV=4 | Back alignment and function description |
|---|
| >sp|Q80Y50|CMTA2_MOUSE Calmodulin-binding transcription activator 2 OS=Mus musculus GN=Camta2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|A2A891|CMTA1_MOUSE Calmodulin-binding transcription activator 1 OS=Mus musculus GN=Camta1 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 719 | ||||||
| 255556328 | 918 | calmodulin-binding transcription activat | 0.986 | 0.772 | 0.641 | 0.0 | |
| 224108659 | 915 | predicted protein [Populus trichocarpa] | 0.972 | 0.763 | 0.660 | 0.0 | |
| 356519932 | 920 | PREDICTED: calmodulin-binding transcript | 0.986 | 0.770 | 0.626 | 0.0 | |
| 359477127 | 927 | PREDICTED: calmodulin-binding transcript | 0.984 | 0.763 | 0.631 | 0.0 | |
| 357478931 | 920 | Calmodulin-binding transcription activat | 0.984 | 0.769 | 0.618 | 0.0 | |
| 356564630 | 921 | PREDICTED: calmodulin-binding transcript | 0.983 | 0.767 | 0.625 | 0.0 | |
| 224101589 | 845 | predicted protein [Populus trichocarpa] | 0.869 | 0.739 | 0.687 | 0.0 | |
| 147834981 | 907 | hypothetical protein VITISV_010763 [Viti | 0.956 | 0.758 | 0.605 | 0.0 | |
| 356558139 | 911 | PREDICTED: calmodulin-binding transcript | 0.942 | 0.744 | 0.630 | 0.0 | |
| 449466741 | 712 | PREDICTED: calmodulin-binding transcript | 0.959 | 0.969 | 0.599 | 0.0 |
| >gi|255556328|ref|XP_002519198.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] gi|223541513|gb|EEF43062.1| calmodulin-binding transcription activator (camta), plants, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 948 bits (2450), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 473/737 (64%), Positives = 578/737 (78%), Gaps = 28/737 (3%)
Query: 1 MRLHELNTLEWDDLVVTNDSNDSTEPRGD-------KFSHFDQQNHTAIKGAASNGSFFP 53
+RLHE+NTLEWD+LV + +N +T GD K F QQN A+ G+ +NG +
Sbjct: 188 LRLHEINTLEWDELVTNDPNNSATAKEGDGLSIICYKIMGFAQQNQIAVNGSMNNGRYLS 247
Query: 54 SHDSYAEVSSGGCLTSLSQPIDRSNNTQFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGD 113
++ AE+S L +L++P+ RSN++ F+ D Y + G Q + + Q+ + TGD
Sbjct: 248 PYNLSAEISP---LDNLTKPVVRSNDSHFSIPDNEYIQSTGVQVNSNVQQKGSNFLGTGD 304
Query: 114 SLDILAGDGLQSQDSFGKWMNYIMTDSPGSVDDPVLE------------PSISSGHHQFT 161
+LD+L DGLQSQDSFG+W++YI+ DSPGSVD+ VLE P+I Q +
Sbjct: 305 TLDMLVNDGLQSQDSFGRWIDYIIADSPGSVDNAVLESSFSSGLDSSTSPAID--QLQSS 362
Query: 162 VPEHLFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGV 221
VPE +F ITD+SPAWAFS E TKILV G+FH+ L L+KSNMFCVCG+ + VQ GV
Sbjct: 363 VPEQIFVITDISPAWAFSTETTKILVVGYFHEQYLQLAKSNMFCVCGDAYALVDIVQTGV 422
Query: 222 YRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKSKWEEFQVQMRL 281
YRC + PH PG+ L++SLDGHKPISQ++NFEYR+P LH PV SSEDK+ WEEF++QMRL
Sbjct: 423 YRCLVSPHFPGIVNLFLSLDGHKPISQLINFEYRAP-LHDPVVSSEDKTNWEEFKLQMRL 481
Query: 282 AHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDS 341
AHLLFS+ K L I +SKV +LKEAKKF K++ I SWAYL K + D R S +AKDS
Sbjct: 482 AHLLFSTSKSLGIQTSKVSSITLKEAKKFDHKTSNIHRSWAYLIKLIEDNRLSFSQAKDS 541
Query: 342 FFELTLKSKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFR 401
FELTLKS LKEWLLERVVEG KTTEYD GQGVIHLC++LGYTWA+ LFSWSGLSLDFR
Sbjct: 542 LFELTLKSMLKEWLLERVVEGCKTTEYDAQGQGVIHLCSILGYTWAVYLFSWSGLSLDFR 601
Query: 402 DKYGWTALHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAA 461
DK+GWTALHWAAYYGREKMV LLSAGAKPNLVTDPT +NP G AAD+AS KG+DGLAA
Sbjct: 602 DKHGWTALHWAAYYGREKMVAVLLSAGAKPNLVTDPTKENPDGCMAADLASMKGYDGLAA 661
Query: 462 FLSEQALVAQFNDMTLAGNISGSL-QTGSTITVDTQNLTEDEVYLKDTLSAYRTAAEAAA 520
+LSE+ALVA F DM++AGN SG+L QT +T V+++NL+E+E+YLKDTL+AYRTAA+AAA
Sbjct: 662 YLSEKALVAHFKDMSIAGNASGTLQQTSATDIVNSENLSEEELYLKDTLAAYRTAADAAA 721
Query: 521 RIQAAFREHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFR 580
RIQ+AFREHSLKV+T A++ ++PE+EA+ I+AA+KIQHA+RNFE RKKMAAA RIQ+RFR
Sbjct: 722 RIQSAFREHSLKVRTTAVQSANPEDEARTIVAAMKIQHAYRNFETRKKMAAAVRIQYRFR 781
Query: 581 SWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQV 640
+WK+RKEFLNMRRQ I+IQAAFRG+QVR+QY KI+WSVGVLEKAILRWRLKRKGFRGLQ+
Sbjct: 782 TWKMRKEFLNMRRQVIRIQAAFRGYQVRRQYRKIIWSVGVLEKAILRWRLKRKGFRGLQI 841
Query: 641 DRVEVEAVSDPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAH 700
D VEAV+D D EEDFY+ASRKQAEERVER+VVRVQ+MFRSKKAQ EYRRMKL H
Sbjct: 842 D--PVEAVADLKQGSDTEEDFYKASRKQAEERVERAVVRVQAMFRSKKAQAEYRRMKLTH 899
Query: 701 DQAKLEYEGLLDPDMEM 717
Q KLEYE LLD D+++
Sbjct: 900 YQVKLEYEELLDHDIDI 916
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224108659|ref|XP_002314926.1| predicted protein [Populus trichocarpa] gi|222863966|gb|EEF01097.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356519932|ref|XP_003528622.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359477127|ref|XP_002272118.2| PREDICTED: calmodulin-binding transcription activator 5-like [Vitis vinifera] gi|296083270|emb|CBI22906.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357478931|ref|XP_003609751.1| Calmodulin-binding transcription activator [Medicago truncatula] gi|355510806|gb|AES91948.1| Calmodulin-binding transcription activator [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|356564630|ref|XP_003550554.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224101589|ref|XP_002312343.1| predicted protein [Populus trichocarpa] gi|222852163|gb|EEE89710.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147834981|emb|CAN70197.1| hypothetical protein VITISV_010763 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356558139|ref|XP_003547365.1| PREDICTED: calmodulin-binding transcription activator 5-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449466741|ref|XP_004151084.1| PREDICTED: calmodulin-binding transcription activator 5-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 719 | ||||||
| TAIR|locus:2130125 | 923 | AT4G16150 [Arabidopsis thalian | 0.980 | 0.763 | 0.544 | 2.8e-208 | |
| TAIR|locus:2060405 | 1032 | SR1 "signal responsive 1" [Ara | 0.756 | 0.527 | 0.321 | 4.8e-72 | |
| TAIR|locus:2019534 | 1016 | AT1G67310 [Arabidopsis thalian | 0.731 | 0.517 | 0.329 | 1.1e-67 | |
| TAIR|locus:2173368 | 1050 | AT5G64220 [Arabidopsis thalian | 0.895 | 0.613 | 0.284 | 3.5e-61 | |
| UNIPROTKB|J9NZ90 | 1214 | CAMTA2 "Uncharacterized protei | 0.157 | 0.093 | 0.330 | 1.7e-13 | |
| UNIPROTKB|F1RFY4 | 1201 | CAMTA2 "Uncharacterized protei | 0.157 | 0.094 | 0.330 | 2e-13 | |
| UNIPROTKB|E1BH04 | 1196 | Bt.24734 "Uncharacterized prot | 0.223 | 0.134 | 0.304 | 2.9e-13 | |
| UNIPROTKB|F1PDC5 | 1596 | CAMTA1 "Uncharacterized protei | 0.158 | 0.071 | 0.3 | 3.8e-13 | |
| UNIPROTKB|Q9Y6Y1 | 1673 | CAMTA1 "Calmodulin-binding tra | 0.158 | 0.068 | 0.3 | 4.5e-13 | |
| UNIPROTKB|O94983 | 1202 | CAMTA2 "Calmodulin-binding tra | 0.198 | 0.118 | 0.302 | 1.6e-12 |
| TAIR|locus:2130125 AT4G16150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2014 (714.0 bits), Expect = 2.8e-208, P = 2.8e-208
Identities = 398/731 (54%), Positives = 517/731 (70%)
Query: 1 MRLHELNTLEWDDLVVTNDSNDSTEPRGDKFSHFDQQNHTAIKGAASNGSFFPSHDSYAE 60
+RLHE+NTL+WD+L+V D ++ + P + +F +Q TA +G+ G+ ++ +
Sbjct: 202 IRLHEINTLDWDELLVPADISNQSHPTEEDMLYFTEQLQTAPRGSVKQGNHLAGYNGSVD 261
Query: 61 VSSGGCLTSLSQPIDRSNNT-QFNNLDGVYSELMGTQSSVSSQRNEFGEVCTGDSLDILA 119
+ S L P+ ++NN+ +S G ++ QR +F T D L
Sbjct: 262 IPS---FPGLEDPVYQNNNSCGAGEFSSQHSHC-GVDPNL--QRRDFSATVTDQPGDALL 315
Query: 120 GDGLQSQDSFGKWMNYIMTDSPGSVDDPVLEPSISSG----------HHQFTVPEHLFSI 169
+G SQDSFG+W+N ++DSPGSVDDP LE + G H +PE +F+I
Sbjct: 316 NNGYGSQDSFGRWVNNFISDSPGSVDDPSLEAVYTPGQDSSTPPTVFHSHSDIPEQVFNI 375
Query: 170 TDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPH 229
TDVSPAWA+S EKTKILVTGFFH HL +SN+ C+CGE+RVPAEF+Q GVYRCFLPP
Sbjct: 376 TDVSPAWAYSTEKTKILVTGFFHDSFQHLGRSNLICICGELRVPAEFLQMGVYRCFLPPQ 435
Query: 230 SPGLFLLYMSLDGHKPISQVLNFEYRSPQLHAPVASSEDKS-KWEEFQVQMRLAHLLFSS 288
SPG+ LY+S+DG+KPISQ+ +FE+RS Q +D+ KWEEF+ Q+RLAHLLF+S
Sbjct: 436 SPGVVNLYLSVDGNKPISQLFSFEHRSVQFIEKAIPQDDQLYKWEEFEFQVRLAHLLFTS 495
Query: 289 FKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLK 348
+++L+SK+ P +L EAKK AS+++ + NSWAYL KS+ +A+D FELTLK
Sbjct: 496 SNKISVLTSKISPENLLEAKKLASRTSHLLNSWAYLMKSIQANEVPFDQARDHLFELTLK 555
Query: 349 SKLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTA 408
++LKEWLLE+V+E T EYD G GVIHLCA+LGYTW+ILLFSW+ +SLDFRDK GWTA
Sbjct: 556 NRLKEWLLEKVIENRNTKEYDSKGLGVIHLCAVLGYTWSILLFSWANISLDFRDKQGWTA 615
Query: 409 LHWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQAL 468
LHWAAYYGREKMV LLSAGA+PNLVTDPT + GG AAD+A +KG+DGLAAFL+E+ L
Sbjct: 616 LHWAAYYGREKMVAALLSAGARPNLVTDPTKEFLGGCTAADLAQQKGYDGLAAFLAEKCL 675
Query: 469 VAQFNDMTLAGNISGSLQT-GSTITVDTQNLTEDEVYLKDTLSXXXXXXXXXXXXXXXXX 527
VAQF DM AGNISG+L+T + + + N E+E LKDTL+
Sbjct: 676 VAQFKDMQTAGNISGNLETIKAEKSSNPGNANEEEQSLKDTLAAYRTAAEAAARIQGAFR 735
Query: 528 EHSLKVQTKAIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKMAAAARIQHRFRSWKVRKE 587
EH LKV++ A+RF+S EEEA+NIIAA+KIQHAFRNFEVR+K+AAAARIQ+RF++WK+R+E
Sbjct: 736 EHELKVRSSAVRFASKEEEAKNIIAAMKIQHAFRNFEVRRKIAAAARIQYRFQTWKMRRE 795
Query: 588 FLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEA 647
FLNMR++AI+IQAAFRGFQVR+QY KI WSVGVLEKAILRWRLKRKGFRGLQV +
Sbjct: 796 FLNMRKKAIRIQAAFRGFQVRRQYQKITWSVGVLEKAILRWRLKRKGFRGLQVSQ----- 850
Query: 648 VSDPNHEGDAEEDFYRASRKQAXXXXXXXXXXXQSMFRSKKAQEEYRRMKLAHDQAKLEY 707
D +A EDFY+ S+KQA Q+MFRSKKAQ++YRRMKLAH++A+LEY
Sbjct: 851 -PDEKEGSEAVEDFYKTSQKQAEERLERSVVKVQAMFRSKKAQQDYRRMKLAHEEAQLEY 909
Query: 708 EGLLDPDMEMA 718
+G+ + D +MA
Sbjct: 910 DGMQELD-QMA 919
|
|
| TAIR|locus:2060405 SR1 "signal responsive 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019534 AT1G67310 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2173368 AT5G64220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NZ90 CAMTA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFY4 CAMTA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BH04 Bt.24734 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDC5 CAMTA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6Y1 CAMTA1 "Calmodulin-binding transcription activator 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O94983 CAMTA2 "Calmodulin-binding transcription activator 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| O23463 | CMTA5_ARATH | No assigned EC number | 0.5785 | 0.9777 | 0.7616 | yes | no |
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
 |
 |
 |
 |
 |
 |
 |
 |
 |
 | gw1.VIII.774.1 | hypothetical protein (829 aa) | ||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 719 | |||
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 6e-14 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 2e-08 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 6e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 9e-08 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 5e-07 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 2e-06 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-06 | |
| pfam01833 | 84 | pfam01833, TIG, IPT/TIG domain | 7e-06 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 2e-05 | |
| smart00248 | 30 | smart00248, ANK, ankyrin repeats | 3e-05 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 7e-05 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 8e-05 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 9e-05 | |
| smart00015 | 23 | smart00015, IQ, Calmodulin-binding motif | 1e-04 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 2e-04 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 4e-04 | |
| pfam00612 | 21 | pfam00612, IQ, IQ calmodulin-binding motif | 6e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 0.001 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.002 |
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
Score = 68.6 bits (168), Expect = 6e-14
Identities = 34/112 (30%), Positives = 48/112 (42%), Gaps = 11/112 (9%)
Query: 353 EWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAI-LLFSWSGLSLDFRDKYGWTALHW 411
+ LLE G+ D G+ +HL A G+ + LL G ++ RDK G T LH
Sbjct: 24 KLLLEN---GADVNAKDNDGRTPLHLAAKNGHLEIVKLLLE-KGADVNARDKDGNTPLHL 79
Query: 412 AAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFL 463
AA G +V LL GA N ++ G +A+K G + L
Sbjct: 80 AARNGNLDVVKLLLKHGADVNA------RDKDGRTPLHLAAKNGHLEVVKLL 125
|
The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126 |
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|216730 pfam01833, TIG, IPT/TIG domain | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|197603 smart00248, ANK, ankyrin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|197470 smart00015, IQ, Calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|201341 pfam00612, IQ, IQ calmodulin-binding motif | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 719 | |||
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 100.0 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.94 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.92 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.91 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.91 | |
| KOG4412 | 226 | consensus 26S proteasome regulatory complex, subun | 99.91 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.9 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.9 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.89 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.89 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.88 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.87 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.87 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.87 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.86 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.86 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.86 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.86 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.85 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.85 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.84 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.83 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.83 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.83 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.83 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.83 | |
| KOG0509 | 600 | consensus Ankyrin repeat and DHHC-type Zn-finger d | 99.83 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 99.82 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.81 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.81 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.81 | |
| KOG4177 | 1143 | consensus Ankyrin [Cell wall/membrane/envelope bio | 99.8 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.8 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.79 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.79 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.79 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.76 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.75 | |
| KOG0508 | 615 | consensus Ankyrin repeat protein [General function | 99.75 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.74 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.74 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.74 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.71 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.7 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.69 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.69 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.69 | |
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.68 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.68 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.66 | |
| KOG0502 | 296 | consensus Integral membrane ankyrin-repeat protein | 99.65 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.64 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.63 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.63 | |
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.6 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 99.59 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.58 | |
| KOG0505 | 527 | consensus Myosin phosphatase, regulatory subunit [ | 99.58 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.57 | |
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.57 | |
| KOG0514 | 452 | consensus Ankyrin repeat protein [General function | 99.55 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.54 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.53 | |
| KOG0507 | 854 | consensus CASK-interacting adaptor protein (caskin | 99.5 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.47 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.47 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.45 | |
| KOG0512 | 228 | consensus Fetal globin-inducing factor (contains a | 99.45 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.45 | |
| KOG4214 | 117 | consensus Myotrophin and similar proteins [Transcr | 99.41 | |
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.39 | |
| KOG0520 | 975 | consensus Uncharacterized conserved protein, conta | 99.39 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 99.37 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.37 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.34 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.33 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.33 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.3 | |
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.3 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.28 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.26 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.22 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 99.19 | |
| KOG4369 | 2131 | consensus RTK signaling protein MASK/UNC-44 [Signa | 99.17 | |
| KOG0515 | 752 | consensus p53-interacting protein 53BP/ASPP, conta | 99.14 | |
| cd01175 | 85 | IPT_COE IPT domain of the COE family (Col/Olf-1/EB | 99.08 | |
| KOG1710 | 396 | consensus MYND Zn-finger and ankyrin repeat protei | 98.88 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.81 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.8 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 98.67 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.66 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.6 | |
| KOG0818 | 669 | consensus GTPase-activating proteins of the GIT fa | 98.57 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.54 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.43 | |
| PF01833 | 85 | TIG: IPT/TIG domain; InterPro: IPR002909 This fami | 98.41 | |
| cd01179 | 85 | IPT_plexin_repeat2 Second repeat of the IPT domain | 98.41 | |
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.4 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.39 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.38 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.38 | |
| KOG0705 | 749 | consensus GTPase-activating protein Centaurin gamm | 98.35 | |
| KOG0522 | 560 | consensus Ankyrin repeat protein [General function | 98.35 | |
| KOG0506 | 622 | consensus Glutaminase (contains ankyrin repeat) [A | 98.32 | |
| cd00102 | 89 | IPT Immunoglobulin-like fold, Plexins, Transcripti | 98.22 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 98.17 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 98.15 | |
| KOG0783 | 1267 | consensus Uncharacterized conserved protein, conta | 98.11 | |
| KOG0160 | 862 | consensus Myosin class V heavy chain [Cytoskeleton | 98.1 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 98.01 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.01 | |
| KOG2384 | 223 | consensus Major histocompatibility complex protein | 97.94 | |
| cd00603 | 90 | IPT_PCSR IPT domain of Plexins and Cell Surface Re | 97.87 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.84 | |
| cd01180 | 94 | IPT_plexin_repeat1 First repeat of the IPT domain | 97.8 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.61 | |
| KOG0511 | 516 | consensus Ankyrin repeat protein [General function | 97.61 | |
| smart00429 | 90 | IPT ig-like, plexins, transcription factors. | 97.49 | |
| KOG0164 | 1001 | consensus Myosin class I heavy chain [Cytoskeleton | 97.45 | |
| cd01181 | 99 | IPT_plexin_repeat3 Third repeat of the IPT domain | 97.32 | |
| KOG0782 | 1004 | consensus Predicted diacylglycerol kinase [Signal | 97.31 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 97.12 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 97.04 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 97.04 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 96.97 | |
| PF00612 | 21 | IQ: IQ calmodulin-binding motif; InterPro: IPR0000 | 96.87 | |
| cd02849 | 81 | CGTase_C_term Cgtase (cyclodextrin glycosyltransfe | 96.65 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.54 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 96.2 | |
| PTZ00014 | 821 | myosin-A; Provisional | 95.95 | |
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.83 | |
| KOG2128 | 1401 | consensus Ras GTPase-activating protein family - I | 95.76 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.68 | |
| cd00604 | 81 | IPT_CGTD IPT domain (domain D) of cyclodextrin gly | 95.57 | |
| smart00015 | 26 | IQ Short calmodulin-binding motif containing conse | 95.44 | |
| PTZ00014 | 821 | myosin-A; Provisional | 94.78 | |
| KOG2505 | 591 | consensus Ankyrin repeat protein [General function | 94.7 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 94.31 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 88.66 | |
| KOG3836 | 605 | consensus HLH transcription factor EBF/Olf-1 and r | 85.58 | |
| KOG3610 | 1025 | consensus Plexins (functional semaphorin receptors | 81.22 |
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-74 Score=653.78 Aligned_cols=580 Identities=43% Similarity=0.674 Sum_probs=472.6
Q ss_pred cc-ccccCCCCCCCchhhhHHhhhCCCCCCCCCC--------C----CCCCCCCCCCCCCCCCCceeeEEecCCCccCCC
Q 005011 115 LD-ILAGDGLQSQDSFGKWMNYIMTDSPGSVDDP--------V----LEPSISSGHHQFTVPEHLFSITDVSPAWAFSNE 181 (719)
Q Consensus 115 ~~-~~~~~~~~~~~sf~~~~~~~~~~~~~~~~~~--------~----~~~~~~~~~~~~~~~~~l~~I~d~sP~w~~~~g 181 (719)
.+ .+.++||++.|||++||+.+...++.. +++ . ..+++ .+++| +++|+|+|+||||+|+|.+|
T Consensus 344 ~~~~~~~~~l~sgdsf~~~~~t~~e~~d~~-q~~s~~~~~~p~~~~~~~~~s--~~~~S-~p~qlf~I~DfSP~Wsy~~g 419 (975)
T KOG0520|consen 344 ADAALSELGLKSGDSFSRWASTFGEISDLG-QDPSGEAVWTPENDPMGPPGS--FLSPS-SPEQLFTITDFSPEWSYLDG 419 (975)
T ss_pred hccccccccccccccccchhhhhcccccCC-CCCccccccccCCCcCCCccc--ccCCC-CCcceeeeeccCcccccCCC
Confidence 44 466899999999999998665433222 111 0 11111 45555 44999999999999999999
Q ss_pred CeEEEEEccCcCccccCCCcceEEEcCCchhhHHHhhccceeeecCCCCCCcceEEEEeC-CCCccchhhccccCCcccC
Q 005011 182 KTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLD-GHKPISQVLNFEYRSPQLH 260 (719)
Q Consensus 182 g~kVlI~G~~~~~~~~~~~~~~ac~fG~~ev~~~li~~Gvl~c~~p~~~~G~v~l~v~~~-g~~~ls~~~~f~y~~~~~~ 260 (719)
|+||||+|++. +.+..+|.||||+.+||++||++|||||+||||+||.|+|||+|+ .+..|+++.+|+|......
T Consensus 420 gvKVlV~G~~~----~~~~~~ysc~Fg~~~VPAeliq~GVLrC~~P~h~~G~V~l~V~c~~~~~~~se~ref~~~~~~~~ 495 (975)
T KOG0520|consen 420 GVKVLVTGFPQ----DETRSNYSCMFGEQRVPAELIQEGVLRCYAPPHEPGVVNLQVTCRISGLACSEVREFAYLVQPSQ 495 (975)
T ss_pred CcEEEEecCcc----ccCCCceEEEeCCccccHHHhhcceeeeecCccCCCeEEEEEEecccceeeeeehheeecccCcc
Confidence 99999999733 345788999999999999999999999999999999999999999 7789999999999876533
Q ss_pred CCCCCCCC-CCCccHHHHHHHHHHHhhcCCCCcccccCCCCCCChHHHhh--hhhhhhcccCcHHH-HHHHhcCCCCCcc
Q 005011 261 APVASSED-KSKWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKK--FASKSTCISNSWAY-LFKSVGDKRTSLP 336 (719)
Q Consensus 261 ~~~~~~~d-~~g~t~l~l~~rl~~lL~~~~~~l~i~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~-li~~l~~~~~~~~ 336 (719)
..+. .+ ++....+.+..|+..++.. ..++......+.+..+... +..++....+.|.+ ++...........
T Consensus 496 ~~d~--~s~~d~~~~~sl~~rl~~~~~r---~~~~~~s~~~~~n~~~~~~~~l~skv~~l~~~~~~r~~~~~~~~~~~~~ 570 (975)
T KOG0520|consen 496 QIDK--LSWEDFLFQMSLLHRLETMLNR---KQSILSSKPSTENTSDAESGNLASKVVHLLNEWAYRLLKSISENLSSSV 570 (975)
T ss_pred cccc--cccccchhhhHHHHHHHHHHHH---hHhHhhccCCccccccccchhHHHHHHHHHHHHHHHHHhhHhhhccccC
Confidence 2221 12 2222334445555554431 1344555555665556555 77788888888888 8888888887777
Q ss_pred cccchHHHHHHhcChHHHHHHHHHc--CCCCCcccCCCCcHHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHHHH
Q 005011 337 EAKDSFFELTLKSKLKEWLLERVVE--GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAY 414 (719)
Q Consensus 337 ~~~~~l~~aa~~~~~~e~lv~~Ll~--ga~in~~d~~G~T~LH~Aa~~g~~~~v~~Ll~~Gadin~~d~~G~TpLh~Aa~ 414 (719)
+.++.++...+...+..||++.+++ |......|.+|...+|++|..|+.+++.+.+..|..++.+|..||||||||+.
T Consensus 571 ~~r~~lllhL~a~~lyawLie~~~e~~~~~~~eld~d~qgV~hfca~lg~ewA~ll~~~~~~ai~i~D~~G~tpL~wAa~ 650 (975)
T KOG0520|consen 571 NFRDMLLLHLLAELLYAWLIEKVIEWAGSGDLELDRDGQGVIHFCAALGYEWAFLPISADGVAIDIRDRNGWTPLHWAAF 650 (975)
T ss_pred CCcchHHHHHHHHHhHHHHHHHHhcccccCchhhcccCCChhhHhhhcCCceeEEEEeecccccccccCCCCcccchHhh
Confidence 7888777777777778999999999 66667799999999999999999999999999999999999999999999999
Q ss_pred cCcHHHHHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCcccccccc-ccccccccchhhhh
Q 005011 415 YGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALVAQFNDMTLAG-NISGSLQTGSTITV 493 (719)
Q Consensus 415 ~G~~~iv~~Ll~~Ga~~~~~td~~~~d~~G~TpL~lA~~~g~~~iv~~Ll~~Ga~~~~~~~~l~~-~~~~~~~~~~~~~~ 493 (719)
+|++.++..|++.|++.+++|||+..+..|.|+.++|..+||.++..+|.+.....++.++++++ ++.......++...
T Consensus 651 ~G~e~l~a~l~~lga~~~~~tdps~~~p~g~ta~~la~s~g~~gia~~lse~~L~~~~~~~~~~~~~~s~~~~~~~~~~t 730 (975)
T KOG0520|consen 651 RGREKLVASLIELGADPGAVTDPSPETPGGKTAADLARANGHKGIAGYLSEKALSAHLSNLELADPNLSADSEEDKAEKT 730 (975)
T ss_pred cCHHHHHHHHHHhccccccccCCCCCCCCCCchhhhhhcccccchHHHHhhhHHHHHHhhccccccccCCCchhhhhhhc
Confidence 99999999999999999999999999999999999999999999999999998888899999888 54444444433333
Q ss_pred -hcCC--CcchhhhhhhhhhHHhhhhHHHHHHHHHHHHHHHHHHHH-HHhhCChHHHHHHHHHHHHHHHhhhhHHHHHHH
Q 005011 494 -DTQN--LTEDEVYLKDTLSAYRTAAEAAARIQAAFREHSLKVQTK-AIRFSSPEEEAQNIIAALKIQHAFRNFEVRKKM 569 (719)
Q Consensus 494 -~~~~--~~~~~~~lk~~L~~~r~~~~aa~~IQ~~~R~~~~R~r~~-~~r~~~~~~~~~~~~Aa~~iQ~~~R~~~~rk~~ 569 (719)
.+.. ...+..+|+|+|.++|+++++|.+||++||...+++... .+.....+.........++++..++.+..|...
T Consensus 731 ~~e~s~~~~~~~~sl~Dtl~avrdAa~aa~r~q~vfr~~~~~~~~a~~i~~~~~~~i~~~~~~~m~~~~a~~~~~~r~~~ 810 (975)
T KOG0520|consen 731 SSEGSPNPDEDSDSLKDTLAAVRDAAQAAARIQAVFRAQSFQKKQAREIMDATKEQISEELAVSMKASSAFSMCDDRSDP 810 (975)
T ss_pred cCCCCCCCCccccccccccccccchHHHHHhhhhhhhhhhhhhhhHHHHHhhcchhhhhhhhhhhhcccchhcCccccch
Confidence 2222 223444599999999999999999999999999985553 344334445557777789999999877777777
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhhHHhhhccC
Q 005011 570 AAAARIQHRFRSWKVRKEFLNMRRQAIKIQAAFRGFQVRKQYGKILWSVGVLEKAILRWRLKRKGFRGLQVDRVEVEAVS 649 (719)
Q Consensus 570 ~aai~IQs~~Rg~~~Rk~~~~~r~aai~IQa~~Rg~~~R~~y~~~~~a~~~iQ~~~R~~r~~r~~~r~~r~~~~~~~~~~ 649 (719)
.++..||.+||||+.|+.|..+|+.+++||+++||++.|+.|+++.|++.++.+++.+||++++++|+|+.++... ...
T Consensus 811 ~aa~~iq~~f~~yk~r~~~l~tr~p~v~iqa~~rg~q~r~dy~ki~wSv~~lek~~lrwR~k~~g~Rgfk~~~~~e-~~~ 889 (975)
T KOG0520|consen 811 AAASRIQKKFRGYKQRKEFLSTRQPIVKIQAAVRGYQVRKDYRKITWSVGVLEKLILRWRRKGKGFRGFKGRALFE-EQE 889 (975)
T ss_pred hHHHHhhhhhhhHHhhhhhcccCCccccchhhhhchhHhhhhheechhhhHHHHHHHHHHHhhhhhcccccccchh-ccc
Confidence 8999999999999999999999999999999999999999999999999999999999999999999999877531 000
Q ss_pred CCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHh
Q 005011 650 DPNHEGDAEEDFYRASRKQAEERVERSVVRVQSMFRSKKAQEEYRRMKLAHDQAKLEYE 708 (719)
Q Consensus 650 ~~~~~~~~~~~~~k~~r~q~e~~~~~a~~~IQs~~R~~~aR~~~~rl~~~~~~~~~e~~ 708 (719)
...-..++.++|||..|++.|+++.+|+++||+|+|.+++|.+|||++....+.+..+.
T Consensus 890 ~a~t~~e~~yd~yKq~~~~~~~r~~~A~~~VQsm~rs~~a~qqyrR~~~~~~~~~~~~~ 948 (975)
T KOG0520|consen 890 TAATVIEDCYDFYKQLRKQTEERLTRAVVRVQSMFRSPKAQQQYRRLLLVYEQYQESYK 948 (975)
T ss_pred cccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhhhh
Confidence 00112389999999999999999999999999999999999999999999999888663
|
|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4214 consensus Myotrophin and similar proteins [Transcription] | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd01175 IPT_COE IPT domain of the COE family (Col/Olf-1/EBF) of non-basic, helix-loop-helix (HLH)-containing transcription factors | Back alignment and domain information |
|---|
| >KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >PF01833 TIG: IPT/TIG domain; InterPro: IPR002909 This family consists of a domain that has an immunoglobulin like fold | Back alignment and domain information |
|---|
| >cd01179 IPT_plexin_repeat2 Second repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0522 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00102 IPT Immunoglobulin-like fold, Plexins, Transcription factors (IPT) | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] | Back alignment and domain information |
|---|
| >KOG0160 consensus Myosin class V heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] | Back alignment and domain information |
|---|
| >cd00603 IPT_PCSR IPT domain of Plexins and Cell Surface Receptors (PCSR) and related proteins | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01180 IPT_plexin_repeat1 First repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0511 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >smart00429 IPT ig-like, plexins, transcription factors | Back alignment and domain information |
|---|
| >KOG0164 consensus Myosin class I heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01181 IPT_plexin_repeat3 Third repeat of the IPT domain of Plexins and Cell Surface Receptors (PCSR) | Back alignment and domain information |
|---|
| >KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00612 IQ: IQ calmodulin-binding motif; InterPro: IPR000048 The IQ motif is an extremely basic unit of about 23 amino acids, whose conserved core usually fits the consensus A-x(3)-I-Q-x(2)-F-R-x(4)-K-K | Back alignment and domain information |
|---|
| >cd02849 CGTase_C_term Cgtase (cyclodextrin glycosyltransferase) C-terminus domain | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2128 consensus Ras GTPase-activating protein family - IQGAP [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >cd00604 IPT_CGTD IPT domain (domain D) of cyclodextrin glycosyltransferase (CGTase) and similar enzymes | Back alignment and domain information |
|---|
| >smart00015 IQ Short calmodulin-binding motif containing conserved Ile and Gln residues | Back alignment and domain information |
|---|
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
| >KOG2505 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >KOG3836 consensus HLH transcription factor EBF/Olf-1 and related DNA binding proteins [Transcription] | Back alignment and domain information |
|---|
| >KOG3610 consensus Plexins (functional semaphorin receptors) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 719 | ||||
| 2cxk_A | 95 | Crystal Structure Of The Tig Domain Of Human Calmod | 5e-10 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 3e-05 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 7e-05 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 2e-04 | ||
| 2ix7_C | 58 | Structure Of Apo-Calmodulin Bound To Unconventional | 2e-04 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-04 | ||
| 2dfs_A | 1080 | 3-D Structure Of Myosin-V Inhibited State Length = | 2e-04 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 2e-04 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 2e-04 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 2e-04 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 3e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 3e-04 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-04 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 3e-04 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 4e-04 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 5e-04 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 6e-04 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 6e-04 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 9e-04 |
| >pdb|2CXK|A Chain A, Crystal Structure Of The Tig Domain Of Human Calmodulin- Binding Transcription Activator 1 (Camta1) Length = 95 | Back alignment and structure |
|
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2IX7|C Chain C, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 58 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 Length = 95 | Back alignment and structure |
|---|
Score = 116 bits (292), Expect = 2e-31
Identities = 30/92 (32%), Positives = 50/92 (54%), Gaps = 6/92 (6%)
Query: 166 LFSITDVSPAWAFSNEKTKILVTGFFHKDCLHLSKSNMFCVCGEVRVPAEFVQAGVYRCF 225
+TD SP W++ K+L+TG + + + +N C+ ++ VPA +Q GV RC+
Sbjct: 6 SGMVTDYSPEWSYPEGGVKVLITGPWQE-----ASNNYSCLFDQISVPASLIQPGVLRCY 60
Query: 226 LPPHSPGLFLLYMSLDGHKPISQVLNFEYRSP 257
P H GL L ++ + + IS + FEY+S
Sbjct: 61 CPAHDTGLVTLQVAFNN-QIISNSVVFEYKSG 91
|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} Length = 58 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A Length = 138 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 719 | |||
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.95 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.94 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.94 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.94 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.93 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.93 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.93 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.93 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.93 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.93 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.93 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.92 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.92 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.92 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.92 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 99.92 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.92 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.92 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 99.92 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.92 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.92 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.92 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 99.91 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.91 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 99.91 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 99.91 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 99.91 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.91 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.91 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.9 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.9 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.9 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.9 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.89 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.89 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 99.89 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.89 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.89 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.89 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.89 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 99.89 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.88 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.88 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.88 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.88 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 99.88 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.88 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.88 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.87 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.87 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.87 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.87 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.87 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.87 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.87 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.87 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 99.87 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.87 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.87 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.87 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.87 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.87 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.86 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.86 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.86 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.86 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.86 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.86 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.86 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.85 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.85 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.85 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 99.85 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.85 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.84 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.84 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.83 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.83 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.83 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.82 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.82 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.82 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.82 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.81 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.81 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.81 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.81 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.8 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.8 | |
| 2cxk_A | 95 | Camta1, calmodulin binding transcription activator | 99.8 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.8 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.8 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.8 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.79 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.79 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.78 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.78 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.78 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.77 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.76 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.75 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.74 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.73 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.73 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.72 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.72 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.72 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.7 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.67 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.65 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.64 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.59 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.57 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.57 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.55 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.52 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.52 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.91 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.73 | |
| 2ix7_C | 58 | Myosin-5A; contractIle protein/metal binding, acti | 98.48 | |
| 1n2d_C | 48 | IQ2 and IQ3 motifs from MYO2P, A class V myosin; p | 98.36 | |
| 3muj_A | 138 | Transcription factor COE3; immunoglobulin like fol | 98.07 | |
| 3mlp_A | 402 | Transcription factor COE1; transcription factor, p | 97.6 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 97.07 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.99 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.93 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 96.89 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 96.89 | |
| 1wdc_A | 64 | Scallop myosin; calcium binding protein, muscle pr | 96.81 | |
| 2bl0_A | 63 | Major plasmodial myosin heavy chain; muscle protei | 96.73 | |
| 1uad_C | 99 | RSEC5, exocyst complex component SEC5; small GTP-b | 96.63 | |
| 3tc9_A | 430 | Hypothetical hydrolase; 6-bladed beta-propeller, i | 96.3 | |
| 2uzx_B | 727 | Hepatocyte growth factor receptor; signaling prote | 95.96 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 95.86 | |
| 3kya_A | 496 | Putative phosphatase; structural genomics, joint c | 95.44 | |
| 2uzx_B | 727 | Hepatocyte growth factor receptor; signaling prote | 95.28 | |
| 3hrp_A | 409 | Uncharacterized protein; NP_812590.1, structural g | 95.12 | |
| 4hw6_A | 433 | Hypothetical protein, IPT/TIG domain protein; puta | 94.92 | |
| 2yrp_A | 114 | Nuclear factor of activated T-cells, cytoplasmic 4 | 93.28 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 93.14 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 93.0 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 92.86 | |
| 3gn4_A | 148 | Myosin-VI; unconventional myosin, motility, lever | 92.34 | |
| 2l53_B | 31 | CAM, voltage-gated sodium channel type V alpha iso | 90.68 | |
| 2kxw_B | 27 | Sodium channel protein type 2 subunit alpha; actio | 89.67 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 86.95 |
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.95 E-value=3.8e-28 Score=253.67 Aligned_cols=227 Identities=13% Similarity=0.063 Sum_probs=144.7
Q ss_pred ccCCCcceEEEcCCchhhHHHhhccceeeecCCCCCCcceEEEEeCCCCccchhhccccCCcc-----cCCCCCCCCCCC
Q 005011 196 LHLSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQ-----LHAPVASSEDKS 270 (719)
Q Consensus 196 ~~~~~~~~ac~fG~~ev~~~li~~Gvl~c~~p~~~~G~v~l~v~~~g~~~ls~~~~f~y~~~~-----~~~~~~~~~d~~ 270 (719)
...+.+++||..|++++++.|++.|... ........-.....+.+|++.++........ ..+++++..|.+
T Consensus 10 ~~~~~L~~A~~~G~~~~v~~LL~~~~~~----~~~~~~~~~~~~~~~~t~L~~a~~~~~~~~~v~~Ll~~Gadvn~~d~~ 85 (269)
T 4b93_B 10 REVEKLLRAVADGDLEMVRYLLEWTEED----LEDAEDTVSAADPEFCHPLCQCPKCAPAQKRLAKVPASGLGVNVTSQD 85 (269)
T ss_dssp HHHHHHHHHHHTTCHHHHHHHHTCC--------------------------------------------CCCCTTCCCTT
T ss_pred cchhHHHHHHHcCCHHHHHHHHHCCCcc----cccccccccccCccCCCHHHHHHHhCCHHHHHHHHHHCCCCCCCcCCC
Confidence 3446789999999999999999977321 0011110112334566788777655443322 135677778888
Q ss_pred CccHHHHHHHHHHHhhcCCCCcccccCCCCCCChHHHhhhhhhhhcccCcHHHHHHHhcCCCCCcccccchHHHHHHhcC
Q 005011 271 KWEEFQVQMRLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLKSK 350 (719)
Q Consensus 271 g~t~l~l~~rl~~lL~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~l~~~~~~~~~~~~~l~~aa~~~~ 350 (719)
|+||||++++... . +....|+..+.+.......+.++++.++..+.
T Consensus 86 G~TpLh~A~~~g~--------~--------------------------~~v~~Ll~~~a~~~~~~~~g~t~l~~a~~~~~ 131 (269)
T 4b93_B 86 GSSPLHVAALHGR--------A--------------------------DLIPLLLKHGANAGARNADQAVPLHLACQQGH 131 (269)
T ss_dssp SCCHHHHHHHTTC--------T--------------------------THHHHHHHTTCCTTCCCTTCCCHHHHHHHHTC
T ss_pred CCCHHHHHHHcCc--------H--------------------------HHHHHHHhcCCCcCccCCCCCCccccccccCh
Confidence 9999888764320 1 11234444445555555566777877777776
Q ss_pred hHHHHHHHHHc-CCCCCcccCCCCcHHHHHHHcCCHHHHHHHHHCCCCCccccCCCCcHHHHHHHcCcHHHHHHHHHCCC
Q 005011 351 LKEWLLERVVE-GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTALHWAAYYGREKMVVDLLSAGA 429 (719)
Q Consensus 351 ~~e~lv~~Ll~-ga~in~~d~~G~T~LH~Aa~~g~~~~v~~Ll~~Gadin~~d~~G~TpLh~Aa~~G~~~iv~~Ll~~Ga 429 (719)
.. ++++|++ |+++|.+|..|+||||+||..|+.++|++|+++|+++|.+|..|+||||+|+..|+.++|++|+++||
T Consensus 132 ~~--~~~~Ll~~g~~~n~~d~~g~TpL~~A~~~g~~~~v~~Ll~~gadvn~~~~~g~t~Lh~A~~~g~~~~v~~Ll~~Ga 209 (269)
T 4b93_B 132 FQ--VVKCLLDSNAKPNKKDLSGNTPLIYACSGGHHELVALLLQHGASINASNNKGNTALHEAVIEKHVFVVELLLLHGA 209 (269)
T ss_dssp HH--HHHHHHHTTCCSCCCCTTCCCHHHHHHHTTCGGGHHHHHHTTCCTTCBCTTSCBHHHHHHHTTCHHHHHHHHHTTC
T ss_pred HH--HHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHCCCCCCccccCCCcHHHHHHHcCCHHHHHHHHHCCC
Confidence 53 6777777 88898888889999999999999999999999999999988889999999999999999999999998
Q ss_pred CCCCCCCCCCCCCCCCCHHHHHHHcCC-HHHHHHHHHcCC
Q 005011 430 KPNLVTDPTSQNPGGLNAADIASKKGF-DGLAAFLSEQAL 468 (719)
Q Consensus 430 ~~~~~td~~~~d~~G~TpL~lA~~~g~-~~iv~~Ll~~Ga 468 (719)
+++. +|..|.||||+|+.+|+ .+++++|...++
T Consensus 210 d~~~------~d~~G~TpL~~A~~~~~i~~lL~~l~~~~~ 243 (269)
T 4b93_B 210 SVQV------LNKRQRTAVDCAEQNSKIMELLQVVPSCVA 243 (269)
T ss_dssp CSCC------CCTTSCCSGGGSCTTCHHHHHTTC------
T ss_pred CCCC------cCCCCCCHHHHHHhCCcHHHHHHHHHHhch
Confidence 8888 88889999999887775 234444444443
|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >2cxk_A Camta1, calmodulin binding transcription activator 1; structural genomics, TIG/IPT domain, NPPSFA; 1.85A {Homo sapiens} SCOP: b.1.18.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ix7_C Myosin-5A; contractIle protein/metal binding, actin-binding, UBL conjugation, Ca2+ regulation, myosin, calcium, IQ motif, acetylation; 2.5A {Mus musculus} | Back alignment and structure |
|---|
| >1n2d_C IQ2 and IQ3 motifs from MYO2P, A class V myosin; protein-peptide complex, myosin light chain, cell cycle; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3muj_A Transcription factor COE3; immunoglobulin like fold, helix-loop-helix, structural genom consortium, SGC, DNA binding protein; 1.92A {Homo sapiens} PDB: 3mqi_A | Back alignment and structure |
|---|
| >3mlp_A Transcription factor COE1; transcription factor, pseudo-IG-fold, TIG-domain, IPT-domain loop-helix; HET: DNA CIT; 2.80A {Mus musculus} PDB: 3n50_A | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >1wdc_A Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} PDB: 3jvt_A 3jtd_A 3pn7_A 3ts5_A 3tuy_A* 1scm_A | Back alignment and structure |
|---|
| >2bl0_A Major plasmodial myosin heavy chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >1uad_C RSEC5, exocyst complex component SEC5; small GTP-binding protein, immunogloblin-like fold, beta- sandwich, endocytosis/exocytosis complex; HET: GNP; 2.10A {Rattus norvegicus} SCOP: b.1.18.18 PDB: 1hk6_A | Back alignment and structure |
|---|
| >3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2uzx_B Hepatocyte growth factor receptor; signaling protein/receptor, leucine rich repeat, receptor ectodomain, signaling protein, ATP-binding; 2.8A {Homo sapiens} PDB: 2uzy_B 1shy_B 1ssl_A | Back alignment and structure |
|---|
| >3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2yrp_A Nuclear factor of activated T-cells, cytoplasmic 4; beta-sandwich, immunoglobulin-like fold, TIG domain, IPT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >3gn4_A Myosin-VI; unconventional myosin, motility, lever ARM, 3-helix bundle, actin-binding, ATP-binding, calmodulin-binding, coiled coil; 2.70A {Sus scrofa} | Back alignment and structure |
|---|
| >2l53_B CAM, voltage-gated sodium channel type V alpha isoform variant; calmodulin, IQ motif, complex, Ca-binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kxw_B Sodium channel protein type 2 subunit alpha; action potential, amino acid motifs, animals, autism, biomol brain chemistry; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 719 | ||||
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-12 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-09 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-07 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-05 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-04 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-04 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-11 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 3e-04 | |
| d2cxka1 | 82 | b.1.18.1 (A:872-953) Calmodulin binding transcript | 4e-10 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 4e-10 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 0.002 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-06 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 8e-05 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 5e-09 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 3e-07 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 0.002 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 8e-08 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 2e-06 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.002 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 0.003 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 2e-07 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 7e-07 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 1e-06 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 0.003 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-06 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 0.004 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 5e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 6e-06 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 9e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 0.002 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 9e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 9e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 0.003 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 3e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 0.002 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 4e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 5e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 9e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 8e-05 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 0.001 |
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Ankyrin-R species: Human (Homo sapiens) [TaxId: 9606]
Score = 66.2 bits (160), Expect = 4e-12
Identities = 24/128 (18%), Positives = 48/128 (37%), Gaps = 11/128 (8%)
Query: 350 KLKEWLLERVVEGSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFRDKYGWTAL 409
+ + L++ G G +H+ + G + ++ + K G++ L
Sbjct: 278 PVADVLIKH---GVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPL 334
Query: 410 HWAAYYGREKMVVDLLSAGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 469
H AA G +V LL GA PN + G IA + G+ + L + +
Sbjct: 335 HQAAQQGHTDIVTLLLKNGASPNE------VSSDGTTPLAIAKRLGYISVTDVL--KVVT 386
Query: 470 AQFNDMTL 477
+ + + +
Sbjct: 387 DETSFVLV 394
|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 719 | |||
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.92 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.9 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.9 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.88 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.87 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.85 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.85 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.84 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.84 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.84 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.83 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.83 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.82 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.8 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.8 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.8 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.78 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.77 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.77 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.76 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.76 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.76 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.73 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.73 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.7 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.69 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.68 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.67 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.67 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.66 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.64 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.6 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.57 | |
| d2cxka1 | 82 | Calmodulin binding transcription activator 1 {Huma | 99.43 | |
| d1qhoa1 | 81 | Five domain "maltogenic" alpha-amylase (glucan 1,4 | 98.06 | |
| d1uadc_ | 92 | Exocyst complex component Sec5, Ral-binding domain | 97.81 | |
| d1cxla1 | 87 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 97.64 | |
| d1p7hl1 | 103 | T-cell transcription factor NFAT1 (NFATC2) {Human | 97.55 | |
| d3bmva1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Th | 97.48 | |
| d1cyga1 | 83 | Cyclomaltodextrin glycanotransferase, domain D {Ba | 97.42 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 97.21 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 97.2 | |
| d3brda1 | 119 | DNA-binding protein LAG-1 (CSL) {Caenorhabditis el | 96.73 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 96.56 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 96.47 | |
| d1imhc1 | 101 | T-cell transcription factor NFAT5 (TONEBP) {Human | 91.66 | |
| d1gjia1 | 100 | p65 subunit of NF-kappa B (NFKB), dimerization dom | 86.99 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 80.45 |
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: beta-hairpin-alpha-hairpin repeat superfamily: Ankyrin repeat family: Ankyrin repeat domain: Transcription factor inhibitor I-kappa-B-beta, IKBB species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.92 E-value=1.7e-25 Score=226.96 Aligned_cols=230 Identities=12% Similarity=0.032 Sum_probs=161.3
Q ss_pred CCCcceEEEcCCchhhHHHhhccceeeecCCCCCCcceEEEEeCCCCccchhhccccCCcc----cCCCCCCCCCCCCcc
Q 005011 198 LSKSNMFCVCGEVRVPAEFVQAGVYRCFLPPHSPGLFLLYMSLDGHKPISQVLNFEYRSPQ----LHAPVASSEDKSKWE 273 (719)
Q Consensus 198 ~~~~~~ac~fG~~ev~~~li~~Gvl~c~~p~~~~G~v~l~v~~~g~~~ls~~~~f~y~~~~----~~~~~~~~~d~~g~t 273 (719)
.|++|+||..|+.+++..|++.|.- +..+. ..+..|.||||.|+..++.+.+ ..+++++..|.+|+|
T Consensus 10 ~t~Lh~A~~~~~~~~v~~Ll~~~a~--------~~~i~-~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~t 80 (255)
T d1oy3d_ 10 DTALHLAVIHQHEPFLDFLLGFSAG--------HEYLD-LQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHT 80 (255)
T ss_dssp CCHHHHHHHTTCHHHHHHHHHHHTT--------SGGGG-CCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCC
T ss_pred CCHHHHHHHcCCHHHHHHHHHcCCC--------ccccc-CcCCCCCCccchHHhhcccccccccccccccccccccccch
Confidence 4789999999999999999997732 11111 1235678999999998887766 246778888999999
Q ss_pred HHHHHH-----HHHHHhhcCCCCcccccCCCCCCChHHHhhhhhhhhcccCcHHHHHHHhcCCCCCcccccchHHHHHHh
Q 005011 274 EFQVQM-----RLAHLLFSSFKGLNILSSKVPPNSLKEAKKFASKSTCISNSWAYLFKSVGDKRTSLPEAKDSFFELTLK 348 (719)
Q Consensus 274 ~l~l~~-----rl~~lL~~~~~~l~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~l~~~~~~~~~~~~~l~~aa~~ 348 (719)
|||+++ .++++|............ +. ...... ..........+......
T Consensus 81 pL~~A~~~~~~~~~~~Ll~~~~~~~~~~~--------~~----------------~~~~~~--~~~~~~~~~~~~~~~~~ 134 (255)
T d1oy3d_ 81 ALHLACRVRAHTCACVLLQPRPSHPRDAS--------DT----------------YLTQSQ--DCTPDTSHAPAAVDSQP 134 (255)
T ss_dssp HHHHHTTTTCHHHHHHHSSSCCSSCCCC----------------------------------------------------
T ss_pred hhhhhhccCchHHHHHHHhhccchhcccc--------hh----------------hhhHHh--hhcccchHHHHHHHhhc
Confidence 999863 566666554432110000 00 000000 00000000000000011
Q ss_pred cChHHHHHHHHHc-CCCCCcccCCCCcHHHHHHHcCCHHHHHHHHHCCCCCccc-cCCCCcHHHHHHHcCcHHHHHHHHH
Q 005011 349 SKLKEWLLERVVE-GSKTTEYDVHGQGVIHLCAMLGYTWAILLFSWSGLSLDFR-DKYGWTALHWAAYYGREKMVVDLLS 426 (719)
Q Consensus 349 ~~~~e~lv~~Ll~-ga~in~~d~~G~T~LH~Aa~~g~~~~v~~Ll~~Gadin~~-d~~G~TpLh~Aa~~G~~~iv~~Ll~ 426 (719)
.. .......... +.+++.+|..|.||||+||..|+.+++++|++.|++++.. +..|.||||+|+..|+.+++++|++
T Consensus 135 ~~-~~~~~~~~~~~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~ 213 (255)
T d1oy3d_ 135 NP-ENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLK 213 (255)
T ss_dssp ----------CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHH
T ss_pred ch-hHHHHHHhhhcCcccccccccCcccccccccccccccccchhcccccccccccccccccccccccccHHHHHHHHHH
Confidence 11 1112222223 7788999999999999999999999999999999998865 5689999999999999999999999
Q ss_pred CCCCCCCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCC
Q 005011 427 AGAKPNLVTDPTSQNPGGLNAADIASKKGFDGLAAFLSEQALV 469 (719)
Q Consensus 427 ~Ga~~~~~td~~~~d~~G~TpL~lA~~~g~~~iv~~Ll~~Ga~ 469 (719)
+|++++. +|..|.||||+|+.+|+.+++++|+++||+
T Consensus 214 ~gadin~------~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~ 250 (255)
T d1oy3d_ 214 AGADPTA------RMYGGRTPLGSALLRPNPILARLLRAHGAP 250 (255)
T ss_dssp TTCCTTC------CCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred CCCCCCC------CCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence 9999998 899999999999999999999999999996
|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d2cxka1 b.1.18.1 (A:872-953) Calmodulin binding transcription activator 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qhoa1 b.1.18.2 (A:496-576) Five domain "maltogenic" alpha-amylase (glucan 1,4-alpha-maltohydrolase), domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1uadc_ b.1.18.18 (C:) Exocyst complex component Sec5, Ral-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1cxla1 b.1.18.2 (A:497-583) Cyclomaltodextrin glycanotransferase, domain D {Bacillus circulans, different strains [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1p7hl1 b.1.18.1 (L:576-678) T-cell transcription factor NFAT1 (NFATC2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bmva1 b.1.18.2 (A:496-578) Cyclomaltodextrin glycanotransferase, domain D {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1cyga1 b.1.18.2 (A:492-574) Cyclomaltodextrin glycanotransferase, domain D {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3brda1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1imhc1 b.1.18.1 (C:368-468) T-cell transcription factor NFAT5 (TONEBP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gjia1 b.1.18.1 (A:182-281) p65 subunit of NF-kappa B (NFKB), dimerization domain {Chicken (Gallus gallus), C-rel [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|