Citrus Sinensis ID: 005013

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------72
MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
ccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccEEccccccccHHHHHHHHccccccEEccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccHHccccccccHHHHHHHHcHHHHHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEEEEEEcccEEEEEEEcccccHHEEccccEEEEcccccccccc
cccEEEEEcccccccccEEEEEccccccccccccccccccccHHHHccccccccEEEEEcccccccccEEEEcccccccccHccccccccccccccEcccEEEEEcccccccccccccccccccccccHHHHHHccccccccccccccccccccEEEEcccccEEEEEccccccHHHHHHHccccccEEcccccccccccccccccccHHcHHHHHHHccHHHHccccccccccHccccccccccccccccEEcccccccccEEEEEEEcccccccccccccEEEccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccEEEEcccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccEEEccccccEEEccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccEEEEEEEEccccEEEEEEccccEEEEEEccEEEEEEccccccccc
mcrlcfvgenegcERARrmlsckscgkkyhrnCLKNWAqnrdlfhwsswkcpscriceicrrtgdpnkfmfcrrcdaayhcycqhpphknvssgpylcpkhtkchscgsnvpgnglsVRWFLGYtccdacgrlfvkgnycpvclkvyrdsestpmvccdvcqrwvhcqcdgisdekYLQFQVdgnlqyrcptcrgecyqvRDLEDAVRELWRRKDMADKDLIASLRAaaglptedeifsispysddeengpvvlknefGRSLKLSLkgvvdkspkkvKEHGKKWlnkkyprkkgyqmplnskpepdqsfegyhdvhsygnsfgddtqspknegldipssvagivshtegvcsisqpgilkhkyvdevmvsdddkisrvkfktskphdldsgeddgkhvsksktiKAKKLVINLGArkinvtnsprsdasscqreqdlttsngiedpslqrmnskfvldrhdgssklgdgdrvdhssqsrglkiagrggnvikfgrvrqevsdsntkvsrgssadehepehmhvlsgkrnidRSRAAVSRVGEVAALrgdrkqlesrpnasresnddtsvlqslpkdskpplrlkfrkpnlenqnsqvsqpeeEKSLIkgqrskrkrpspftektlfnededaaQSNQDSLMSEIMDANWILKKLGKDAIGKRVEvhqqsdnswhkgvvTDTVEGTSTLSITLDDSRVKTLElgkqgvrfvpqkqkrsms
mcrlcfvgenegcerarrmlsckscGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLraaaglptedEIFSispysddeenGPVVLKNEFGRSLKLslkgvvdkspkkvkehgkkwlnkkyprkkgyqmplnSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEgvcsisqpgilkhkyvDEVMvsdddkisrvkfktskphdldsgeddgkhvsksktikakklvinlgarkinvtnsprsdasscqreqdlttsngiedpslqrMNSKFVLDRHDGssklgdgdrvdhssqsrglkiagrggnvikfgrvrqevsdsntkvsrgssadehepehmhvlsgkrnidrsRAAVSRVgevaalrgdrkqlesrpnasresnddtsvlqslpkdskpplrlkfrkpnlenqnsqvsqpeeekslikgqrskrkrpspftektlfnededaAQSNQDSLMSEIMDANWILKKLGKDAIGKRVevhqqsdnswhkgvvTDTVEgtstlsitlddsrvktlelgkqgvrfvpqkqkrsms
MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
**RLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFS****************************************************************************************************VAGIVSHTEGVCSISQPGILKHKYVDEVMV**************************************KLVINLGA**************************************************************************VIKF******************************************************************************************************************************************************IMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTL*******************
MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGS*VPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCR****************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************EIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVR***********
MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGV***********GKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFK********************KTIKAKKLVINLGARKINVT****************TTSNGIEDPSLQRMNSKFVLDRHDGSSKL*************GLKIAGRGGNVIKFGRVRQ************************VLSGKRNIDRSRAAVSRVGEVAALRG**********************QSLPKDSKPPLRLKFRKPNLE****************************FTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFV*********
*CRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGE**********VR**WRRK***DKD*IASLRAAA******************ENGPVVLKNEFGRSLKLSLKGVVDKSPK******KKWL**************************************************************************KHKYVDEVMVSDDDKISRVKFKTS**********************AKKLVINLGA***************************************************************RGLKIA*RGGN*IKF*RV*********************************************************************************KPPLRLKFRKPN**************************************************LMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQ*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSISPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISRVKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHSSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLESRPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGKQGVRFVPQKQKRSMS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query719 2.2.26 [Sep-21-2011]
O08550 2713 Histone-lysine N-methyltr yes no 0.243 0.064 0.333 1e-24
Q9UMN6 2715 Histone-lysine N-methyltr yes no 0.243 0.064 0.333 1e-24
Q8NEZ4 4911 Histone-lysine N-methyltr no no 0.248 0.036 0.308 1e-23
Q8BRH4 4903 Histone-lysine N-methyltr no no 0.248 0.036 0.308 3e-23
Q03164 3969 Histone-lysine N-methyltr no no 0.257 0.046 0.314 7e-22
Q6PDK2 5588 Histone-lysine N-methyltr no no 0.253 0.032 0.293 1e-21
O14686 5537 Histone-lysine N-methyltr no no 0.253 0.032 0.288 2e-21
P55200 3966 Histone-lysine N-methyltr no no 0.257 0.046 0.305 1e-20
Q24742 3828 Histone-lysine N-methyltr N/A no 0.276 0.051 0.266 1e-17
P20659 3726 Histone-lysine N-methyltr no no 0.297 0.057 0.253 5e-16
>sp|O08550|MLL4_MOUSE Histone-lysine N-methyltransferase MLL4 OS=Mus musculus GN=Wbp7 PE=1 SV=3 Back     alignment and function desciption
 Score =  115 bits (288), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 94/183 (51%), Gaps = 8/183 (4%)

Query: 19   MLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMF-CRRCDA 77
            ++ C+ C   +H  CL+  A+     H  +W C  C+ C +C R G  +K +  C RC  
Sbjct: 1221 LVFCQVCCDPFHPFCLEE-AERPSPQHRDTWCCRRCKFCHVCGRKGRGSKHLLECERCRH 1279

Query: 78   AYHCYCQHPPHKNVSSG---PYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLF 134
            AYH  C  P +   ++     ++C    +C SCG+  PG    V W   Y+ C  C  L+
Sbjct: 1280 AYHPACLGPSYPTRATRRRRHWICSACVRCKSCGAT-PGKNWDVEWSGDYSLCPRCTELY 1338

Query: 135  VKGNYCPVCLKVYRDSE-STPMVCCDVCQRWVHCQCDGISDEKY-LQFQVDGNLQYRCPT 192
             KGNYCP+C + Y D++  + M+ C  C  WVH +C+G+SDE Y +   +  ++ Y C  
Sbjct: 1339 EKGNYCPICTRCYEDNDYESKMMQCAQCDHWVHAKCEGLSDEDYEILSGLPDSVLYTCGP 1398

Query: 193  CRG 195
            C G
Sbjct: 1399 CAG 1401
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 4EC: 3
>sp|Q9UMN6|MLL4_HUMAN Histone-lysine N-methyltransferase MLL4 OS=Homo sapiens GN=WBP7 PE=1 SV=1 Back     alignment and function description
>sp|Q8NEZ4|MLL3_HUMAN Histone-lysine N-methyltransferase MLL3 OS=Homo sapiens GN=MLL3 PE=1 SV=3 Back     alignment and function description
>sp|Q8BRH4|MLL3_MOUSE Histone-lysine N-methyltransferase MLL3 OS=Mus musculus GN=Mll3 PE=2 SV=2 Back     alignment and function description
>sp|Q03164|MLL1_HUMAN Histone-lysine N-methyltransferase MLL OS=Homo sapiens GN=MLL PE=1 SV=5 Back     alignment and function description
>sp|Q6PDK2|MLL2_MOUSE Histone-lysine N-methyltransferase MLL2 OS=Mus musculus GN=Mll2 PE=1 SV=2 Back     alignment and function description
>sp|O14686|MLL2_HUMAN Histone-lysine N-methyltransferase MLL2 OS=Homo sapiens GN=MLL2 PE=1 SV=2 Back     alignment and function description
>sp|P55200|MLL1_MOUSE Histone-lysine N-methyltransferase MLL OS=Mus musculus GN=Mll PE=1 SV=3 Back     alignment and function description
>sp|Q24742|TRX_DROVI Histone-lysine N-methyltransferase trithorax OS=Drosophila virilis GN=trx PE=3 SV=1 Back     alignment and function description
>sp|P20659|TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster GN=trx PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query719
449436315 847 PREDICTED: uncharacterized protein LOC10 0.949 0.806 0.653 0.0
224106097 845 predicted protein [Populus trichocarpa] 0.948 0.807 0.644 0.0
356544287 845 PREDICTED: uncharacterized protein LOC10 0.966 0.822 0.614 0.0
356529861 820 PREDICTED: uncharacterized protein LOC10 0.929 0.814 0.606 0.0
297833588778 protein binding protein [Arabidopsis lyr 0.872 0.805 0.580 0.0
297736278679 unnamed protein product [Vitis vinifera] 0.707 0.749 0.742 0.0
145338256779 PHD finger-containing protein [Arabidops 0.872 0.804 0.571 0.0
6648214764 unknown protein [Arabidopsis thaliana] 0.851 0.801 0.554 0.0
413916644819 RING/FYVE/PHD-type zinc finger family pr 0.919 0.807 0.462 1e-169
115488844688 Os12g0527800 [Oryza sativa Japonica Grou 0.909 0.950 0.456 1e-166
>gi|449436315|ref|XP_004135938.1| PREDICTED: uncharacterized protein LOC101208296 [Cucumis sativus] gi|449488832|ref|XP_004158186.1| PREDICTED: uncharacterized protein LOC101230410 [Cucumis sativus] Back     alignment and taxonomy information
 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 480/735 (65%), Positives = 559/735 (76%), Gaps = 52/735 (7%)

Query: 1   MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEIC 60
           MCR+CF GENE  ERAR+MLSCK+CGKKYHR+CLK+WAQ+RDLFHWSSW CPSCR CE+C
Sbjct: 149 MCRICFFGENESSERARKMLSCKTCGKKYHRSCLKSWAQHRDLFHWSSWTCPSCRACEVC 208

Query: 61  RRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRW 120
           RRTGDPNKFMFC+RCD AYHCYCQHPPHKNVSSGPYLCPKHT+CHSCGSNVPGNG SVRW
Sbjct: 209 RRTGDPNKFMFCKRCDGAYHCYCQHPPHKNVSSGPYLCPKHTRCHSCGSNVPGNGQSVRW 268

Query: 121 FLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQF 180
           FLGYT CDACGRLFVKGNYCPVCLKVYRDSESTPMVCCD+CQRWVHC CD ISDEKYLQF
Sbjct: 269 FLGYTFCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDICQRWVHCHCDSISDEKYLQF 328

Query: 181 QVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSI 240
           Q+DGNLQY+C  CRGECYQV++LEDAV+E+WRR+D AD+DLI +LRAAAGLPT+DEIFSI
Sbjct: 329 QIDGNLQYKCTACRGECYQVKNLEDAVQEIWRRRDEADRDLIVNLRAAAGLPTQDEIFSI 388

Query: 241 SPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLN 300
           SPYSDDEENGP V+KNEFGRSLKLSLKG  DK PKK K++GKK  NKKY ++KG   PL 
Sbjct: 389 SPYSDDEENGPAVVKNEFGRSLKLSLKGFADKVPKKSKDYGKKSSNKKYAKEKG--TPLA 446

Query: 301 SKPEPDQSFEGYHDVHSYGNSFGDDTQSP-----KNEGLDIPSSVAGIVSHTEGVCSISQ 355
           ++ E DQ+FE  +DV   G   G++          NEGLD  S VAG +SH EG CS++Q
Sbjct: 447 NQSELDQNFEVRNDVQQSGFGEGNEKNGGLLPQNNNEGLDT-SPVAGSLSHNEGTCSVNQ 505

Query: 356 PGILKHKYVDEVMVSDDDKISR-VKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLG 414
           PG+LKHK+VDEVMVSD++K S+ V+ K SK   LD+GED GK+ SKSKT K KKLVINLG
Sbjct: 506 PGVLKHKFVDEVMVSDEEKTSKVVQIKASKAQGLDTGEDSGKYASKSKTAKGKKLVINLG 565

Query: 415 ARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDH 474
           ARKINV  SP+SDASSCQR QDL  SN                           G++V++
Sbjct: 566 ARKINVATSPKSDASSCQRGQDLAVSN---------------------------GEKVNN 598

Query: 475 SSQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHE---PEHMHVLSGKRNID 531
           SSQS GLK      +V  FG+VR   SD+NT   RG++A   E   P+   V S KRN++
Sbjct: 599 SSQSTGLKAGETENSVPSFGKVRFGSSDTNTTFGRGNTASGSEVGPPDGTRVFSRKRNME 658

Query: 532 RSRAAVSRVGEVAALRGDR----KQLESRPNASRESNDD---TSVLQSLPKDSKPPLRLK 584
            S  AV  +G V+ ++ ++    KQLES  +   + +DD   T + QSLP+DSKP L+ K
Sbjct: 659 GSTPAVGSLGGVSTVKEEKVPSGKQLESGSHICNDGHDDNGQTPLPQSLPRDSKPLLKFK 718

Query: 585 FRKPNLENQNSQVSQPEEEKSLIKGQRSKRKRPSPFTEKTLFNEDEDAAQSNQDSLMSEI 644
           F+KP L+N   Q+S  EEEKSL+KGQRSKRKRPSP  EK  FNE ED  +S+QD+L+   
Sbjct: 719 FKKPPLDN---QISCHEEEKSLVKGQRSKRKRPSPLMEKVPFNEVEDLTRSHQDNLLD-- 773

Query: 645 MDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTVEGTSTLSITLDDSRVKTLELGK 704
            DANWILKKLGKDAIGKRVEV   SD SW KGVV D ++GTSTLS+ LDD R KTLELGK
Sbjct: 774 -DANWILKKLGKDAIGKRVEVQHPSDKSWQKGVVRDMIDGTSTLSVALDDGREKTLELGK 832

Query: 705 QGVRFVPQKQKRSMS 719
           QG+R VP KQKRS S
Sbjct: 833 QGIRLVPLKQKRSKS 847

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224106097|ref|XP_002314042.1| predicted protein [Populus trichocarpa] gi|222850450|gb|EEE87997.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356544287|ref|XP_003540585.1| PREDICTED: uncharacterized protein LOC100815407 [Glycine max] Back     alignment and taxonomy information
>gi|356529861|ref|XP_003533505.1| PREDICTED: uncharacterized protein LOC100809429 [Glycine max] Back     alignment and taxonomy information
>gi|297833588|ref|XP_002884676.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297330516|gb|EFH60935.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|297736278|emb|CBI24916.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|145338256|ref|NP_187459.2| PHD finger-containing protein [Arabidopsis thaliana] gi|110739634|dbj|BAF01725.1| hypothetical protein [Arabidopsis thaliana] gi|110741394|dbj|BAF02246.1| hypothetical protein [Arabidopsis thaliana] gi|332641110|gb|AEE74631.1| PHD finger-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|6648214|gb|AAF21212.1|AC013483_36 unknown protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|413916644|gb|AFW56576.1| RING/FYVE/PHD-type zinc finger family protein [Zea mays] Back     alignment and taxonomy information
>gi|115488844|ref|NP_001066909.1| Os12g0527800 [Oryza sativa Japonica Group] gi|77556508|gb|ABA99304.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group] gi|113649416|dbj|BAF29928.1| Os12g0527800 [Oryza sativa Japonica Group] gi|215717023|dbj|BAG95386.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query719
TAIR|locus:2077457779 AT3G08020 [Arabidopsis thalian 0.774 0.715 0.568 7.7e-174
TAIR|locus:2083715696 AT3G52100 [Arabidopsis thalian 0.315 0.326 0.807 9.9e-131
UNIPROTKB|H7BYJ6366 MLL "MLL cleavage product C180 0.251 0.494 0.331 6.4e-29
UNIPROTKB|E1BKN0 2711 LOC785776 "Uncharacterized pro 0.260 0.068 0.323 8.8e-26
MGI|MGI:109565 2713 Wbp7 "WW domain binding protei 0.260 0.068 0.318 1.5e-25
UNIPROTKB|Q9UMN6 2715 WBP7 "Histone-lysine N-methylt 0.260 0.068 0.318 1.9e-25
UNIPROTKB|Q03164 3969 MLL "Histone-lysine N-methyltr 0.257 0.046 0.324 3.8e-25
UNIPROTKB|J9NZ02 2194 RBM42 "Uncharacterized protein 0.260 0.085 0.313 3.9e-25
RGD|1308331 2705 Mll4 "myeloid/lymphoid or mixe 0.260 0.069 0.318 3.9e-25
UNIPROTKB|F1NET5 3958 MLL "Uncharacterized protein" 0.257 0.046 0.324 4.7e-25
TAIR|locus:2077457 AT3G08020 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1689 (599.6 bits), Expect = 7.7e-174, P = 7.7e-174
 Identities = 337/593 (56%), Positives = 423/593 (71%)

Query:     1 MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEIC 60
             MCR+CF+GE EG +RARRMLSCK CGKKYH+NCLK+WAQ+RDLFHWSSW CPSCR+CE+C
Sbjct:   147 MCRMCFLGEGEGSDRARRMLSCKDCGKKYHKNCLKSWAQHRDLFHWSSWSCPSCRVCEVC 206

Query:    61 RRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRW 120
             RRTGDPNKFMFC+RCDAAYHCYCQHPPHKNVSSGPYLCPKHT+CHSC S VPGNGLSVRW
Sbjct:   207 RRTGDPNKFMFCKRCDAAYHCYCQHPPHKNVSSGPYLCPKHTRCHSCDSTVPGNGLSVRW 266

Query:   121 FLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDVCQRWVHCQCDGISDEKYLQF 180
             FL YTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCD+CQRWVHC CDGISD+KY+QF
Sbjct:   267 FLSYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDICQRWVHCHCDGISDDKYMQF 326

Query:   181 QVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSI 240
             QVDG LQY+C TCRGECYQV+DL+DAV+ELW++KD+ DK+LIASLRAAAGLPTE+EIFSI
Sbjct:   327 QVDGKLQYKCATCRGECYQVKDLQDAVQELWKKKDVVDKELIASLRAAAGLPTEEEIFSI 386

Query:   241 SPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLN 300
              P+SDDEENGPV      GRSLK S+KG+V+KSPKK KE+GK   +KK+  KKG     +
Sbjct:   387 FPFSDDEENGPVS-----GRSLKFSIKGLVEKSPKKSKEYGKHSSSKKHASKKGS----H 437

Query:   301 SKPEPDQSFEGYHDVHSYGNSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILK 360
             +K EP+   E   +    G    D+     NE  D+ SSVAGI       CS  +P I+K
Sbjct:   438 TKLEPEVHQEIGSERRRLGGVRIDNVGFQINEQSDVNSSVAGI-------CSTHEPKIVK 490

Query:   361 HKYVDEVMVSDDDKISR-VKFKTSKPHDLDSGEDDGKHVSKSKTIKAKKLVINLGARKIN 419
             HK VD+VMV+D++K SR V+ K SKPHD DS ED  ++  + K++KAKKLVINLGARKIN
Sbjct:   491 HKRVDDVMVTDEEKPSRIVRIKCSKPHDSDS-EDTLRNAGEEKSVKAKKLVINLGARKIN 549

Query:   420 VTNSPRSDA-SSCQREQDLTTSNGIE-DPSLQ----RMNSKFVLDRHDGS-SKLGDGDRV 472
             V+ S +S+  S   R++D +T  G + D + +    +++ +F   + +GS +  G   + 
Sbjct:   550 VSGSSKSNVVSHLSRDKDQSTLGGDKVDQTGEVRTLKISGRFGKTQSEGSKATFGSVTQF 609

Query:   473 DHSSQSRGLKIAGRGG---NVIKFGR--VRQEVSDSNTKVSRGSSADEHEPEHMHVLSGK 527
               +S S G  +  +      + K  R  ++ ++   N+     S   + E E +    G+
Sbjct:   610 PAASTSEGNHVDDKTSISPALQKEARPLLKFKLRKPNSGDQTSSVTTQSEDEKLSSAKGQ 669

Query:   528 RNIDRSRAAVSRVGEVAALRGDRKQL-ESRPNASR--ESNDDTSVLQSLPKDS 577
             R+    R   S + ++A+L+ D +    S  + SR  E  D   +L+ L KDS
Sbjct:   670 RS---KRKRPSSLVDMASLKEDGEATTHSHQDNSRNDEMMDANWILKKLGKDS 719
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2083715 AT3G52100 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|H7BYJ6 MLL "MLL cleavage product C180" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKN0 LOC785776 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:109565 Wbp7 "WW domain binding protein 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UMN6 WBP7 "Histone-lysine N-methyltransferase MLL4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q03164 MLL "Histone-lysine N-methyltransferase MLL" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ02 RBM42 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1308331 Mll4 "myeloid/lymphoid or mixed-lineage leukemia 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NET5 MLL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028770001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (778 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
pfam0062851 pfam00628, PHD, PHD-finger 1e-06
smart0024947 smart00249, PHD, PHD zinc finger 5e-06
pfam0062851 pfam00628, PHD, PHD-finger 7e-05
smart0024947 smart00249, PHD, PHD zinc finger 7e-05
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information 
 Score = 45.2 bits (107), Expect = 1e-06
 Identities = 14/54 (25%), Positives = 23/54 (42%), Gaps = 5/54 (9%)

Query: 56  ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPP--HKNVSSGPYLCPKHTKCHSC 107
            C +C +  D  + + C  CD  +H  C  PP   + +  G + CP   +C   
Sbjct: 1   YCAVCGKVDDDGELLLCDGCDRWFHLACLGPPLEPEEIPEGEWYCP---ECKPK 51

PHD folds into an interleaved type of Zn-finger chelating 2 Zn ions in a similar manner to that of the RING and FYVE domains. Several PHD fingers have been identified as binding modules of methylated histone H3. Length = 51
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 719
KOG4443694 consensus Putative transcription factor HALR/MLL3, 100.0
KOG1244336 consensus Predicted transcription factor Requiem/N 99.65
KOG1512381 consensus PHD Zn-finger protein [General function 99.5
KOG0954893 consensus PHD finger protein [General function pre 99.22
KOG0825 1134 consensus PHD Zn-finger protein [General function 98.61
KOG0383696 consensus Predicted helicase [General function pre 98.55
KOG4299613 consensus PHD Zn-finger protein [General function 98.53
KOG0956 900 consensus PHD finger protein AF10 [General functio 98.45
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.37
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 98.31
KOG4299613 consensus PHD Zn-finger protein [General function 98.3
PF0946555 LBR_tudor: Lamin-B receptor of TUDOR domain; Inter 98.29
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.23
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.21
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 98.12
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.1
KOG4323464 consensus Polycomb-like PHD Zn-finger protein [Gen 98.07
KOG1512381 consensus PHD Zn-finger protein [General function 98.03
KOG1244336 consensus Predicted transcription factor Requiem/N 97.98
KOG4443694 consensus Putative transcription factor HALR/MLL3, 97.89
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.85
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.83
COG5141669 PHD zinc finger-containing protein [General functi 97.71
KOG0383696 consensus Predicted helicase [General function pre 97.63
KOG1973274 consensus Chromatin remodeling protein, contains P 97.47
KOG1973274 consensus Chromatin remodeling protein, contains P 97.2
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.13
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.07
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.06
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 97.04
smart0033357 TUDOR Tudor domain. Domain of unknown function pre 97.01
KOG0954893 consensus PHD finger protein [General function pre 96.93
smart0074361 Agenet Tudor-like domain present in plant sequence 96.91
KOG0957707 consensus PHD finger protein [General function pre 96.64
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 96.6
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.6
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 96.56
KOG1701468 consensus Focal adhesion adaptor protein Paxillin 96.42
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 96.41
KOG0957707 consensus PHD finger protein [General function pre 96.36
cd0450848 TUDOR Tudor domains are found in many eukaryotic o 96.19
KOG2752345 consensus Uncharacterized conserved protein, conta 96.04
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 95.95
COG5141669 PHD zinc finger-containing protein [General functi 95.92
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 93.84
PF09038122 53-BP1_Tudor: Tumour suppressor p53-binding protei 93.59
KOG1952950 consensus Transcription factor NF-X1, contains NFX 93.41
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 93.33
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 92.65
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 92.23
KOG12451404 consensus Chromatin remodeling complex WSTF-ISWI, 91.9
KOG1632345 consensus Uncharacterized PHD Zn-finger protein [G 91.89
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 91.75
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 88.68
KOG0804493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 88.64
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 86.97
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 85.28
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 84.24
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 84.02
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 83.63
PF0564168 Agenet: Agenet domain; InterPro: IPR008395 This do 82.82
PF06003 264 SMN: Survival motor neuron protein (SMN); InterPro 80.88
PF15057124 DUF4537: Domain of unknown function (DUF4537) 80.76
PF13901202 DUF4206: Domain of unknown function (DUF4206) 80.67
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 80.47
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-73  Score=628.96  Aligned_cols=593  Identities=40%  Similarity=0.681  Sum_probs=501.9

Q ss_pred             CCccCcCCccCCcccCCceEEeCcCCCcchhhhcCCCcccccccCCCCCCCCCCccccccccCCCCCceeecCCCCCccc
Q 005013            1 MCRLCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYH   80 (719)
Q Consensus         1 ~C~iC~~Ce~~Gse~~eeLL~Cd~CgksYH~~CL~p~~e~~~~~~~~~W~Cp~Cr~C~VC~~sgd~~kLL~CdrC~raYH   80 (719)
                      +|.+|.+|+..|.+.++.|+.|..|+..||.+|+..|.....+.  ..|+||.|++|..|+..+++.++++|+.|+..||
T Consensus        17 ~~~mc~l~~s~G~~~ag~m~ac~~c~~~yH~~cvt~~~~~~~l~--~gWrC~~crvCe~c~~~gD~~kf~~Ck~cDvsyh   94 (694)
T KOG4443|consen   17 VCLMCPLCGSSGKGRAGRLLACSDCGQKYHPYCVTSWAQHAVLS--GGWRCPSCRVCEACGTTGDPKKFLLCKRCDVSYH   94 (694)
T ss_pred             hhhhhhhhccccccccCcchhhhhhcccCCcchhhHHHhHHHhc--CCcccCCceeeeeccccCCccccccccccccccc
Confidence            58899999999999999999999999999999999998866543  5599999999999999999999999999999999


Q ss_pred             ccccCCCCcCCCCCCcccCCCCccCCCCCCCCCCCCccccccCccccCCCccccccccccccccccccCCCCCCceeccC
Q 005013           81 CYCQHPPHKNVSSGPYLCPKHTKCHSCGSNVPGNGLSVRWFLGYTCCDACGRLFVKGNYCPVCLKVYRDSESTPMVCCDV  160 (719)
Q Consensus        81 ~~CL~PpL~~Ip~g~W~CP~C~~C~sCg~r~pgki~s~RW~~~~slC~aC~~lfvK~nyC~VC~K~Y~dsdgg~MIqCD~  160 (719)
                      .+|+.|++..++.+.|+|+.|..|..|+...++  +..+|..++..|.+|..    ..|||+|.+.|++.+..+|++|+.
T Consensus        95 ~yc~~P~~~~v~sg~~~ckk~~~c~qc~~~lpg--~s~~~~~~~~~~~~c~s----~~~cPvc~~~Y~~~e~~~~~~c~~  168 (694)
T KOG4443|consen   95 CYCQKPPNDKVPSGPWLCKKCTRCRQCDSTLPG--LSLDLQEGYLQCAPCAS----LSYCPVCLIVYQDSESLPMVCCSI  168 (694)
T ss_pred             ccccCCccccccCcccccHHHHhhhhccccccc--cchhhhccCcccccccc----cccCchHHHhhhhccchhhHHHHH
Confidence            999999999999999999999999999998887  67788889999999986    689999999999999999999999


Q ss_pred             CCCeeccCCCCCChHHHhhhccCCCCceeCCCCCCCCCCCCchHHHHHHhhcccccccHHHHHHHHHHcCCCCccccccC
Q 005013          161 CQRWVHCQCDGISDEKYLQFQVDGNLQYRCPTCRGECYQVRDLEDAVRELWRRKDMADKDLIASLRAAAGLPTEDEIFSI  240 (719)
Q Consensus       161 C~~wFH~eCL~lsdEkye~~~id~d~~Y~CptCr~~~~qIk~~kda~~r~Wrare~~~r~lI~slR~~~GLp~~eei~s~  240 (719)
                      |.+|.|..|+++.++.|.++.++  ..|.|.+||.+.++++++.+++.+.|++.......++..+++..-|..       
T Consensus       169 c~rwsh~~c~~~sdd~~~q~~vD--~~~~CS~CR~es~qvKdi~~~vqe~~~~k~~~~~~~~~tls~~a~lq~-------  239 (694)
T KOG4443|consen  169 CQRWSHGGCDGISDDKYMQAQVD--LQYKCSTCRGESYQVKDISDALQETWKAKDKPDKILIATLSAQAALQM-------  239 (694)
T ss_pred             hcccccCCCCccchHHHHHHhhh--hhcccceeehhhhhhhhHHHHHHhhcchhhccccceeehhhhhhhhhh-------
Confidence            99999999999999999998875  799999999999999999999999999998888889988887765533       


Q ss_pred             CCCCCCCCCCcchhhhhhccccccccCCCCCCCCCchhhhhccccCccCCCccCCCCCCCCCCCCCCCCCCcccccccC-
Q 005013          241 SPYSDDEENGPVVLKNEFGRSLKLSLKGVVDKSPKKVKEHGKKWLNKKYPRKKGYQMPLNSKPEPDQSFEGYHDVHSYG-  319 (719)
Q Consensus       241 ~P~sdDe~~~p~~~~~~~~~~~~~s~k~~~~k~~~~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-  319 (719)
                              +.++.     .++.+++.++..++++.++....+..+.+.+...+|..+     .+     ..+.|+.+|+ 
T Consensus       240 --------~~~~~-----~~s~~~k~~~~~~~~~~~s~a~gq~s~~~~~~~~~g~~~-----dp-----~~~~e~~sE~~  296 (694)
T KOG4443|consen  240 --------HHAVI-----GDSSADKAGSSANSGSATSGASGQLSLTTANTPTLGVSL-----DP-----VKLQEVGSERK  296 (694)
T ss_pred             --------ccccc-----cccccccccCcccCCcccccccccCCcccccccccCccc-----ch-----hhhhhccchhh
Confidence                    23333     566788889999999999999999999888888888777     22     4566777777 


Q ss_pred             ---CCCCCCCCCCCCCCCCCCCCcccccccCCCccccCCCCcccccccceeeccCCCccce-eEeecCCCCCCCCCCccc
Q 005013          320 ---NSFGDDTQSPKNEGLDIPSSVAGIVSHTEGVCSISQPGILKHKYVDEVMVSDDDKISR-VKFKTSKPHDLDSGEDDG  395 (719)
Q Consensus       320 ---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~  395 (719)
                         ..+..+...+       .++...+.+..|++++-.-+-.+.+..+.+.||+.+|...| ++||++||+++++ ++..
T Consensus       297 a~~~v~~e~vv~d-------~t~~~~~~~~~e~~~~p~~r~~~~~~m~~~~~vt~~e~~~r~~r~~Stk~~~~~~-~~~~  368 (694)
T KOG4443|consen  297 AKLLVKQEAVVKD-------STETPTVNSRAEEIGTPEKRLNANATMTAINQVTSEEKPTRTARIKSTKPPDSDS-ENNL  368 (694)
T ss_pred             hhhccchhhhhhc-------cccCcccccchhhccCccccccccceeeeeeccccccccceeeecCCCCCCCcch-hhhh
Confidence               3455555555       34445556778999999999999999999999985554445 9999999999999 5888


Q ss_pred             cccccccccceeeEEEeeccccccccCCCCCCCcchhcccccccCCCCCChhhhhccccccccccCCCCcCCCCCccccc
Q 005013          396 KHVSKSKTIKAKKLVINLGARKINVTNSPRSDASSCQREQDLTTSNGIEDPSLQRMNSKFVLDRHDGSSKLGDGDRVDHS  475 (719)
Q Consensus       396 ~~~~~~~~~k~~~lv~~~g~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  475 (719)
                      .+++...++++++||||+|+|+||+.++.+.++.+---+-+     +    ++..++                |+++|-+
T Consensus       369 r~a~edn~ll~~~l~~n~st~kl~~~~~t~~~v~~~~~~a~-----l----~~~~l~----------------~~~~~s~  423 (694)
T KOG4443|consen  369 RSAAEDNALLAKKLVINSSSRKLNVISSTSAHVGSASSSAP-----L----SQRKLI----------------GVRAPSM  423 (694)
T ss_pred             hhccchhhHHhhhcccccCccccccccccccccccccccCh-----h----hHHHhc----------------cCcCcch
Confidence            88999999999999999999999999999999874322211     1    222222                5888888


Q ss_pred             cccccceecccCCceeeeecccccccccCcccCCCCCCCCCCccccccccccchhhhhhhhcccccceeEEecCcccccc
Q 005013          476 SQSRGLKIAGRGGNVIKFGRVRQEVSDSNTKVSRGSSADEHEPEHMHVLSGKRNIDRSRAAVSRVGEVAALRGDRKQLES  555 (719)
Q Consensus       476 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  555 (719)
                      ++.|++..+         |+.+.-.                                         .++.++.++.....
T Consensus       424 ~k~rsle~e---------gs~~~~~-----------------------------------------~v~~~~~a~~ssgs  453 (694)
T KOG4443|consen  424 GKVRSLEDE---------GSRGVIG-----------------------------------------PVTTATAAAGSSGS  453 (694)
T ss_pred             hhhhhhhhh---------cccCCCC-----------------------------------------CcCCcCcccccccC
Confidence            888888662         2222211                                         12222222222222


Q ss_pred             CCCccccCCCCcccccCCCCCCCCceeeeecCCCcccCCCCcCchHH--HhhhhhcccccCCCCCccccccccccc-hhh
Q 005013          556 RPNASRESNDDTSVLQSLPKDSKPPLRLKFRKPNLENQNSQVSQPEE--EKSLIKGQRSKRKRPSPFTEKTLFNED-EDA  632 (719)
Q Consensus       556 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~k~k~~~~~~~~~~~~~~~~--~~~~~~gqrskrkr~~~~~~~~~~~~~-~~~  632 (719)
                      +.+..  ...+.+.+.+..++.+|+|+++|++|+.+.|++..++..|  .+...+|+|+|+||+++..+++.++++ |..
T Consensus       454 s~~~~--~s~t~g~~~s~~~~~~~~l~~a~a~~~s~~~~s~~~v~~~~E~~~d~~~a~~~n~~~n~~~~~~~~~~~~q~l  531 (694)
T KOG4443|consen  454 SGDVK--TSTTPGTVASGQKSQRPLLKSAIAKPNSAVQISEPGVGSEAEQKSDGKGARSKNKRQNQAPPPPPPPEDQQQL  531 (694)
T ss_pred             CCCCC--CCCCCCcCCcchhhhhhhhhhhhhcCCcccccccccccccccccCCcccccccccccCCCCCCCCCcchhhhc
Confidence            22221  2233444668899999999999999999999988777665  459999999999999999999999999 999


Q ss_pred             hhhhhh-chhhhhhhhHHHHHHhCcccccceEEEEecCCCCeeeeeEEEee--cCceeEEEEecCCchhhhhcCcceeEe
Q 005013          633 AQSNQD-SLMSEIMDANWILKKLGKDAIGKRVEVHQQSDNSWHKGVVTDTV--EGTSTLSITLDDSRVKTLELGKQGVRF  709 (719)
Q Consensus       633 ~~~~~~-~~~~~~~d~~~il~~lg~~~i~krv~v~~~~d~~w~~g~v~~~~--~~~~~~~v~~ddg~~~~~~lgk~~i~~  709 (719)
                      ..+++| ++.||||||+|||++||++++|||++||-.++|+|-+|+|+.++  ..++.+.|++|+|.++++++|++.|||
T Consensus       532 ~~s~~d~~~~d~~~~a~~~~~~~g~~~~~~~t~vhs~~~ns~~~g~vt~~~s~~~~s~~~~~~~~~~v~~~~~~~~~v~f  611 (694)
T KOG4443|consen  532 QPSPHDVSRLDEMVDAEWILKKLGKDAKTKRTEVHSKSMNSWPKGNVTIVISTGQTSPLEVQLKPGAVKTVELGKQGVRF  611 (694)
T ss_pred             CCCHHHHHHHHhhhccccccccCCCCCCcceeccccCCCCCCCCccceeeeccCCcccceeecccccccccccccccccc
Confidence            999999 79999999999999999999999999999999999999999998  899999999999999999999999999


Q ss_pred             eeccccccC
Q 005013          710 VPQKQKRSM  718 (719)
Q Consensus       710 ~~~~~k~~~  718 (719)
                      +|++|||.+
T Consensus       612 ~pe~~k~~~  620 (694)
T KOG4443|consen  612 LPEKQKRVR  620 (694)
T ss_pred             Chhhhhccc
Confidence            999999876

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF09465 LBR_tudor: Lamin-B receptor of TUDOR domain; InterPro: IPR019023 The Lamin-B receptor is a chromatin and lamin binding protein in the inner nuclear membrane Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>smart00333 TUDOR Tudor domain Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>smart00743 Agenet Tudor-like domain present in plant sequences Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>KOG1701 consensus Focal adhesion adaptor protein Paxillin and related LIM proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd04508 TUDOR Tudor domains are found in many eukaryotic organisms and have been implicated in protein-protein interactions in which methylated protein substrates bind to these domains Back     alignment and domain information
>KOG2752 consensus Uncharacterized conserved protein, contains N-recognin-type Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>PF09038 53-BP1_Tudor: Tumour suppressor p53-binding protein-1 Tudor; InterPro: IPR015125 This domain consist of ten beta-strands and a carboxy-terminal alpha-helix Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1632 consensus Uncharacterized PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF05641 Agenet: Agenet domain; InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO [] Back     alignment and domain information
>PF06003 SMN: Survival motor neuron protein (SMN); InterPro: IPR010304 This family consists of several eukaryotic survival motor neuron (SMN) proteins Back     alignment and domain information
>PF15057 DUF4537: Domain of unknown function (DUF4537) Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
2ysm_A111 Solution Structure Of The First And Second Phd Doma 8e-08
2kwj_A114 Solution Structures Of The Double Phd Fingers Of Hu 3e-07
2e6r_A92 Solution Structure Of The Phd Domain In Smcy Protei 2e-05
2ln0_A110 Structure Of Moz Length = 110 4e-05
3v43_A112 Crystal Structure Of Moz Length = 112 4e-05
1f62_A51 Wstf-Phd Length = 51 4e-04
>pdb|2YSM|A Chain A, Solution Structure Of The First And Second Phd Domain From MyeloidLYMPHOID OR MIXED-Lineage Leukemia Protein 3 Homolog Length = 111 Back     alignment and structure 
Iteration: 1

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 3/77 (3%)
Query: 22 CKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHC 81
          C +CG+ YH  CL            + W+CP C++C+ C+++G+ +K + C  CD  YH 
Sbjct: 25 CTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHT 81
Query: 82 YCQHPPHKNVSSGPYLC 98
          +C  P  K+V +  + C
Sbjct: 82 FCLQPVMKSVPTNGWKC 98
>pdb|2KWJ|A Chain A, Solution Structures Of The Double Phd Fingers Of Human Transcriptional Protein Dpf3 Bound To A Histone Peptide Containing Acetylation At Lysine 14 Length = 114 Back     alignment and structure
>pdb|2E6R|A Chain A, Solution Structure Of The Phd Domain In Smcy Protein Length = 92 Back     alignment and structure
>pdb|2LN0|A Chain A, Structure Of Moz Length = 110 Back     alignment and structure
>pdb|3V43|A Chain A, Crystal Structure Of Moz Length = 112 Back     alignment and structure
>pdb|1F62|A Chain A, Wstf-Phd Length = 51 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query719
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 2e-27
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 1e-26
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 2e-11
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 8e-07
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 6e-24
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 2e-06
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 1e-19
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 1e-14
1we9_A64 PHD finger family protein; structural genomics, PH 4e-12
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 4e-11
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 2e-10
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 2e-09
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 2e-09
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 4e-09
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 2e-08
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 4e-08
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 6e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-07
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-07
1wem_A76 Death associated transcription factor 1; structura 1e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-07
2k16_A75 Transcription initiation factor TFIID subunit 3; p 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 3e-07
1wee_A72 PHD finger family protein; structural genomics, PH 6e-07
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 7e-07
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 7e-07
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 9e-07
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 9e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 9e-07
3o70_A68 PHD finger protein 13; PHF13, structural genomics 1e-06
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 7e-06
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 8e-06
2yt5_A66 Metal-response element-binding transcription facto 8e-06
2yt5_A66 Metal-response element-binding transcription facto 8e-04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 1e-05
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 1e-05
3nw0_A238 Non-structural maintenance of chromosomes element 7e-05
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 8e-05
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 8e-05
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 1e-04
3kv5_D488 JMJC domain-containing histone demethylation prote 1e-04
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 1e-04
1wew_A78 DNA-binding family protein; structural genomics, P 2e-04
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 3e-04
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 4e-04
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 6e-04
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Length = 114 Back     alignment and structure
 Score =  105 bits (264), Expect = 2e-27
 Identities = 29/110 (26%), Positives = 47/110 (42%), Gaps = 2/110 (1%)

Query: 2   CRLCFVGE--NEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEI 59
           C  C  G   N+   R   ++SC  CG+  H  CL+      +      W+C  C+ C +
Sbjct: 4   CDFCLGGSNMNKKSGRPEELVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCIL 63

Query: 60  CRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSCGS 109
           C  + + ++ +FC  CD  YH YC +PP      G + C    +     +
Sbjct: 64  CGTSENDDQLLFCDDCDRGYHMYCLNPPVAEPPEGSWSCHLCWELLKEKA 113
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Length = 112 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Length = 226 Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 51 Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Length = 70 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Length = 77 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Length = 66 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query719
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.82
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.81
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.81
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.51
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.38
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.35
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.28
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.26
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.22
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.18
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.04
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.97
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.97
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.94
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 98.86
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.85
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.78
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.74
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.74
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.73
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.71
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.7
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.7
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.6
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 98.56
2yt5_A66 Metal-response element-binding transcription facto 98.56
1we9_A64 PHD finger family protein; structural genomics, PH 98.53
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.52
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.5
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.5
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.49
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.48
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 98.47
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.45
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.42
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.42
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 98.38
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.38
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.37
2yt5_A66 Metal-response element-binding transcription facto 98.35
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.34
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.33
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.32
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.3
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.29
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.29
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 98.29
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 98.28
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.26
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.25
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.24
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.22
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.19
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.17
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.15
1wem_A76 Death associated transcription factor 1; structura 98.14
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.12
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.11
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.1
1weu_A91 Inhibitor of growth family, member 4; structural g 98.08
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.07
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.07
3o70_A68 PHD finger protein 13; PHF13, structural genomics 98.07
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.02
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.0
1wee_A72 PHD finger family protein; structural genomics, PH 97.99
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.97
1weu_A91 Inhibitor of growth family, member 4; structural g 97.95
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.94
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.94
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.9
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.9
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.86
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.83
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.81
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.8
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.79
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.78
3o70_A68 PHD finger protein 13; PHF13, structural genomics 97.76
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.75
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 97.73
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 97.7
1we9_A64 PHD finger family protein; structural genomics, PH 97.67
1wew_A78 DNA-binding family protein; structural genomics, P 97.63
1wee_A72 PHD finger family protein; structural genomics, PH 97.63
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 97.61
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 97.52
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.42
1wem_A76 Death associated transcription factor 1; structura 97.4
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.39
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.37
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 97.34
3kv5_D488 JMJC domain-containing histone demethylation prote 97.34
1wew_A78 DNA-binding family protein; structural genomics, P 97.28
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 97.27
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 97.26
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 97.18
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 97.16
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.1
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.1
2equ_A74 PHD finger protein 20-like 1; tudor domain, struct 97.09
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 96.98
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 96.95
2ldm_A81 Uncharacterized protein; PHF20, tudor domain, epig 95.99
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 96.73
2g3r_A123 Tumor suppressor P53-binding protein 1; tandem tud 96.72
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 96.62
3p8d_A67 Medulloblastoma antigen MU-MB-50.72; tudor domain, 96.57
3qii_A85 PHD finger protein 20; tudor domain, structural ge 96.53
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.41
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 96.32
1ssf_A156 Transformation related protein 53 binding protein 95.87
3kv5_D488 JMJC domain-containing histone demethylation prote 95.85
3kv4_A447 PHD finger protein 8; epigenetics, histone CODE, c 95.58
1wil_A89 KIAA1045 protein; ring finger domain, structural g 95.44
1mhn_A59 SurviVal motor neuron protein; SMN, SMA, spinal mu 95.44
4a4f_A64 SurviVal of motor neuron-related-splicing factor; 95.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 95.23
3s6w_A54 Tudor domain-containing protein 3; methylated argi 95.1
1g5v_A88 SurviVal motor neuron protein 1; mRNA processing, 94.85
3pnw_C77 Tudor domain-containing protein 3; FAB, structural 94.71
3pur_A528 Lysine-specific demethylase 7 homolog; oxidoreduct 94.6
2d9t_A78 Tudor domain-containing protein 3; structural geno 94.23
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 92.78
2eqj_A66 Metal-response element-binding transcription facto 92.72
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 92.61
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 92.38
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 91.62
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 90.41
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 90.3
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 89.83
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 89.79
2l8d_A66 Lamin-B receptor; DNA binding protein; NMR {Gallus 89.65
4hcz_A58 PHD finger protein 1; protein-peptide complex, tud 89.31
2dig_A68 Lamin-B receptor; tudor domain, integral nuclear e 88.88
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 88.62
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 88.51
2ecm_A55 Ring finger and CHY zinc finger domain- containing 88.49
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 88.36
2ect_A78 Ring finger protein 126; metal binding protein, st 88.33
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 88.05
2m0o_A79 PHD finger protein 1; tudor domain, H3K36ME3 bindi 88.0
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 87.65
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 87.62
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 87.18
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 87.17
2pv0_B386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 87.03
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 86.78
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 86.64
2e5p_A68 Protein PHF1, PHD finger protein 1; tudor domain, 85.32
2xk0_A69 Polycomb protein PCL; transcription, aromatic CAGE 85.24
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 84.59
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 83.56
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 81.96
2e5q_A63 PHD finger protein 19; tudor domain, isoform B, st 81.54
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 81.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 81.03
2wac_A 218 CG7008-PA; unknown function, tudor, beta-barrel, n 80.8
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 80.61
2lcd_A118 AT-rich interactive domain-containing protein 4A; 80.15
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
Probab=99.82  E-value=6.9e-21  Score=171.83  Aligned_cols=100  Identities=30%  Similarity=0.828  Sum_probs=86.7

Q ss_pred             cCcCCccCCcccCCceEEeCcCCCcchhhhcCCCcccccccCCCCCCCCCCccccccccCCCCCceeecCCCCCcccccc
Q 005013            4 LCFVGENEGCERARRMLSCKSCGKKYHRNCLKNWAQNRDLFHWSSWKCPSCRICEICRRTGDPNKFMFCRRCDAAYHCYC   83 (719)
Q Consensus         4 iC~~Ce~~Gse~~eeLL~Cd~CgksYH~~CL~p~~e~~~~~~~~~W~Cp~Cr~C~VC~~sgd~~kLL~CdrC~raYH~~C   83 (719)
                      +|.+|+.+|.  .++||.|+.|+++||+.||.+...+   ++.+.|+|++|.+|.+|+..+++..||.|+.|+++||.+|
T Consensus         9 ~C~~C~~~g~--~~~ll~C~~C~~~~H~~Cl~~~~~~---~~~~~W~C~~C~~C~~C~~~~~~~~ll~Cd~C~~~yH~~C   83 (111)
T 2ysm_A            9 NCAVCDSPGD--LLDQFFCTTCGQHYHGMCLDIAVTP---LKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFC   83 (111)
T ss_dssp             CBTTTCCCCC--TTTSEECSSSCCEECTTTTTCCCCT---TTSTTCCCTTTCCCTTTCCCSCCTTEEECSSSCCEEEGGG
T ss_pred             CCcCCCCCCC--CcCCeECCCCCCCcChHHhCCcccc---ccccCccCCcCCcccccCccCCCCCeeECCCCCcHHhHHh
Confidence            5666655552  3578999999999999999997643   3458999999999999999998889999999999999999


Q ss_pred             cCCCCcCCCCCCcccCCCCccCCCC
Q 005013           84 QHPPHKNVSSGPYLCPKHTKCHSCG  108 (719)
Q Consensus        84 L~PpL~~Ip~g~W~CP~C~~C~sCg  108 (719)
                      +.|++..+|.+.|+|+.|..|..++
T Consensus        84 l~ppl~~~P~g~W~C~~C~~c~~g~  108 (111)
T 2ysm_A           84 LQPVMKSVPTNGWKCKNCRICISGP  108 (111)
T ss_dssp             SSSCCSSCCSSCCCCHHHHCCSCSC
T ss_pred             cCCccccCCCCCcCCcCCcCcCCCC
Confidence            9999999999999999998877654
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2equ_A PHD finger protein 20-like 1; tudor domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2ldm_A Uncharacterized protein; PHF20, tudor domain, epigenetics, methylated P53, transcript factor, transcription-protein binding complex; HET: M2L; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2g3r_A Tumor suppressor P53-binding protein 1; tandem tudor domains, cell cycle-transcription complex; 1.25A {Homo sapiens} SCOP: b.34.9.1 b.34.9.1 PDB: 2ig0_A* 3lgf_A* 3lgl_A* 3lh0_A* 1xni_A Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3p8d_A Medulloblastoma antigen MU-MB-50.72; tudor domain, lysine-methylated P53 binding, histone binding binding; 2.00A {Homo sapiens} Back     alignment and structure
>3qii_A PHD finger protein 20; tudor domain, structural genomics, structural GE consortium, SGC, transcription regulator; 2.30A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>1ssf_A Transformation related protein 53 binding protein 1; tudor domains, tandem, SH3-like fold, beta barrel, alpha- helix, cell cycle; NMR {Mus musculus} SCOP: b.34.9.1 b.34.9.1 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1mhn_A SurviVal motor neuron protein; SMN, SMA, spinal muscular atrophy, RNA binding protein; 1.80A {Homo sapiens} SCOP: b.34.9.1 PDB: 4a4e_A* 4a4g_A* Back     alignment and structure
>4a4f_A SurviVal of motor neuron-related-splicing factor; RNA binding protein; HET: 2MR; NMR {Homo sapiens} PDB: 4a4h_A* Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3s6w_A Tudor domain-containing protein 3; methylated arginine recognize, ISO-propanol, transcri; 1.78A {Homo sapiens} PDB: 3pmt_A* Back     alignment and structure
>1g5v_A SurviVal motor neuron protein 1; mRNA processing, translation; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>3pnw_C Tudor domain-containing protein 3; FAB, structural genomics consortium, antibody, SGC, protein immune system complex; 2.05A {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2d9t_A Tudor domain-containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.34.9.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2eqj_A Metal-response element-binding transcription factor 2; structure genomics,tudor domain, zinc-regulated factor 1, ZIRF1; NMR {Mus musculus} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l8d_A Lamin-B receptor; DNA binding protein; NMR {Gallus gallus} Back     alignment and structure
>4hcz_A PHD finger protein 1; protein-peptide complex, tudor, histone binding, H3K36ME3, N nucleus, transcription; HET: M3L; 1.85A {Homo sapiens} Back     alignment and structure
>2dig_A Lamin-B receptor; tudor domain, integral nuclear envelope inner membrane protein, nuclear protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.9.1 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2m0o_A PHD finger protein 1; tudor domain, H3K36ME3 binding, peptide binding protein; HET: M3L; NMR {Homo sapiens} Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2e5p_A Protein PHF1, PHD finger protein 1; tudor domain, PHF1 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xk0_A Polycomb protein PCL; transcription, aromatic CAGE; NMR {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2e5q_A PHD finger protein 19; tudor domain, isoform B, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2wac_A CG7008-PA; unknown function, tudor, beta-barrel, nuclease domain, tudor P100, SND1, methylated arginine, SDMA, splicing; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lcd_A AT-rich interactive domain-containing protein 4A; tudor domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 719
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 5e-10
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 0.003
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 4e-09
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 6e-04
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 4e-08
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 8e-07
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 5e-07
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 8e-07
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 1e-04
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 5e-06
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-04
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 7e-06
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 1e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 3e-05
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 1e-04
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 1e-04
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 0.002
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 53.4 bits (128), Expect = 5e-10
 Identities = 16/51 (31%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 57  CEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKCHSC 107
           C++CR+ G+ +K + C  C+ A+H +C  P    V  G + CP    C   
Sbjct: 3   CKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCP---ACQPA 50
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query719
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.92
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.86
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.58
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.56
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.52
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 98.33
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.32
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.2
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 98.16
d1wema_76 Death associated transcription factor 1, Datf1 (DI 98.11
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.98
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 97.96
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.91
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.77
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.75
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.75
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.66
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 97.66
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.56
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.56
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.42
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 97.07
d2d9ta160 Tudor domain-containing protein 3, TDRD3 {Mouse (M 95.39
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 95.19
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 94.33
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 93.24
d1mhna_59 Survival motor neuron protein 1, smn {Human (Homo 93.0
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 92.79
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 89.94
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 88.29
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 87.4
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 86.01
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 85.53
d2diqa197 Tudor and KH domain-containing protein TDRKH {Huma 84.51
d2hqxa190 P100 co-activator, SND1 {Human (Homo sapiens) [Tax 83.43
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 83.07
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Williams-Beuren syndrome transcription factor, WSTF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.92  E-value=2.1e-10  Score=88.45  Aligned_cols=49  Identities=31%  Similarity=0.954  Sum_probs=44.3

Q ss_pred             cccccccCCCCCceeecCCCCCcccccccCCCCcCCCCCCcccCCCCcc
Q 005013           56 ICEICRRTGDPNKFMFCRRCDAAYHCYCQHPPHKNVSSGPYLCPKHTKC  104 (719)
Q Consensus        56 ~C~VC~~sgd~~kLL~CdrC~raYH~~CL~PpL~~Ip~g~W~CP~C~~C  104 (719)
                      .|.+|+..++++.||.|+.|+.+||..|++|++..+|.+.|+|+.|..|
T Consensus         2 ~C~vC~~~~~~~~~i~Cd~C~~~~H~~C~~p~~~~~p~~~W~C~~C~~~   50 (51)
T d1f62a_           2 RCKVCRKKGEDDKLILCDECNKAFHLFCLRPALYEVPDGEWQCPACQPA   50 (51)
T ss_dssp             CCTTTCCSSCCSCCEECTTTCCEECHHHHCTTCCSCCSSCCSCTTTSCC
T ss_pred             CCcCcCCCCCCCCEEEcCCCCCCCCCCCCCCCCCcCCCCCEECcCCcCc
Confidence            4777888888889999999999999999999999999999999998764
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2d9ta1 b.34.9.1 (A:8-67) Tudor domain-containing protein 3, TDRD3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1mhna_ b.34.9.1 (A:) Survival motor neuron protein 1, smn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diqa1 b.34.9.1 (A:8-104) Tudor and KH domain-containing protein TDRKH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hqxa1 b.34.9.1 (A:8-97) P100 co-activator, SND1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure