Citrus Sinensis ID: 005120
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 713 | ||||||
| 225434309 | 959 | PREDICTED: probable LRR receptor-like se | 0.976 | 0.725 | 0.733 | 0.0 | |
| 297745743 | 960 | unnamed protein product [Vitis vinifera] | 0.977 | 0.726 | 0.719 | 0.0 | |
| 334182352 | 953 | putative leucine-rich repeat transmembra | 0.956 | 0.715 | 0.712 | 0.0 | |
| 357460549 | 955 | hypothetical protein MTR_3g062590 [Medic | 0.983 | 0.734 | 0.678 | 0.0 | |
| 297848960 | 941 | predicted protein [Arabidopsis lyrata su | 0.966 | 0.732 | 0.705 | 0.0 | |
| 224589376 | 700 | leucine-rich repeat receptor-like protei | 0.931 | 0.948 | 0.711 | 0.0 | |
| 356569432 | 953 | PREDICTED: probable LRR receptor-like se | 0.977 | 0.731 | 0.670 | 0.0 | |
| 224124832 | 926 | predicted protein [Populus trichocarpa] | 0.946 | 0.728 | 0.691 | 0.0 | |
| 356537716 | 954 | PREDICTED: probable LRR receptor-like se | 0.977 | 0.730 | 0.661 | 0.0 | |
| 449439195 | 952 | PREDICTED: probable LRR receptor-like se | 0.963 | 0.721 | 0.678 | 0.0 |
| >gi|225434309|ref|XP_002276020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g06840-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 1041 bits (2691), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 516/703 (73%), Positives = 589/703 (83%), Gaps = 7/703 (0%)
Query: 11 LFLCLCWSSSKIVVAADDDSITDPIEVSALRSIKKSLVDDYSKLSNWNRGDPCTSNWTGV 70
L + LCWSSS I A ++TDP+EV+ALR+IK+SL D + L+NWNRGDPCTS WTGV
Sbjct: 21 LLVWLCWSSSFIGAKA---TVTDPVEVTALRAIKESLEDPMNNLTNWNRGDPCTSEWTGV 77
Query: 71 LCFNTTMDDGYLHLRELQLLNLNLSGNLSPEIGRLSYLTILDFMWNKISGSIPKEIGNIK 130
LCFNTTM+D YLH++ELQLLN++LSG LSPE+GRLSY+ ILDFMWN I+GSIPKEIGNI
Sbjct: 78 LCFNTTMNDSYLHVKELQLLNMHLSGTLSPELGRLSYMQILDFMWNNITGSIPKEIGNIT 137
Query: 131 SLELLLLNGNELTGSLPEELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSI 190
+LELLLLNGN+LTGSLPEELG LP LDRIQIDQN ISGS+P+SFANLNKT+HFHMNNNSI
Sbjct: 138 TLELLLLNGNKLTGSLPEELGNLPNLDRIQIDQNQISGSIPRSFANLNKTKHFHMNNNSI 197
Query: 191 SGQIPPELSRLPSLVHMLLDNNNLTGYLPPELSELPKLLILQLDNNNFEGTTIPASYSNM 250
SGQIP ELSRLP LVH LLDNNNL+GYLPPE SE+PKLLI+QLDNN+F G+ IPASYSNM
Sbjct: 198 SGQIPSELSRLPELVHFLLDNNNLSGYLPPEFSEMPKLLIVQLDNNHFNGS-IPASYSNM 256
Query: 251 SKLLKLSLRNCSLQGPMPDLSRIPNLGYLDLSSNQLNGSIPPGRLSLNITTIKLSNNKLT 310
SKLLKLSLRNCSLQG +P+LS+IP LGYLDLSSNQLNG+IPPGR S NITTI LSNN LT
Sbjct: 257 SKLLKLSLRNCSLQGEIPNLSKIPYLGYLDLSSNQLNGTIPPGRFSENITTIDLSNNNLT 316
Query: 311 GTIPSNFSGLPRLQRLFIANNSLSGSIPSSIWQSRTLNATETFILDFQNNNLTNISGSFN 370
GTIP+NFSGLP LQ+L + NNSLSG++ SSIWQ+RT N ET+++DFQNN+L+NISG+ +
Sbjct: 317 GTIPANFSGLPHLQKLSLENNSLSGTVSSSIWQNRTSNGNETYVVDFQNNDLSNISGTLD 376
Query: 371 IPPNVTVRLRGNPFCLNTNAEQFCGSHSDDDNEIDRSTNSTLDCRAQSCPTDYEYSPTSP 430
+P NVTVRL GNP C N + QFCGS S+++N+ NST+DC A CP YE SP S
Sbjct: 377 LPLNVTVRLYGNPLCTNESLVQFCGSQSEEENDTLNPVNSTVDCTAVRCPLYYEISPASL 436
Query: 431 IRCFCAAPLLVGYRLKSPGLSYFPAYKNLFEEYMTSGLKLNLYQLDIDSFRWEKGPRLKM 490
C CAAPLLVGYRLKSPG S F AY+N+FE Y+TSGL LNL QL IDS WEKGPRLKM
Sbjct: 437 EICLCAAPLLVGYRLKSPGFSNFLAYQNMFEYYLTSGLSLNLDQLKIDSVEWEKGPRLKM 496
Query: 491 YLKLFPVYDNSSGNSYVFNASEVGRIRSMFTGWNIPDSDIFGPYELINFTLQGPYRDVFP 550
Y KLFP + NS FN+SEV RIR MFTGWNIPDSD+FGPYELINFTL Y+DV
Sbjct: 497 YFKLFP---DDVNNSSEFNSSEVLRIRGMFTGWNIPDSDVFGPYELINFTLTDIYKDVIG 553
Query: 551 PSRNSGISKAALAGIILGAIAGAVTISAIVSLLIVRAHMKNYHAISRRRHSSKTSIKIDG 610
S +SGIS AL GIILG IA AVT+SAIV LLI++ +K YH ISRRR S++ SIKIDG
Sbjct: 554 SSSSSGISTGALVGIILGTIAVAVTLSAIVFLLILKNRLKKYHTISRRRKSTRISIKIDG 613
Query: 611 VRSFTYGEMALATNNFNSSTQIGQGGYGKVYKGILPDGTVVAVKRAQEGSLQGEKEFLTE 670
V+ FTYGEMALATNNFN S ++GQGGYGKVYKGIL DGTVVA+KRAQEGSLQG+KEF TE
Sbjct: 614 VKDFTYGEMALATNNFNDSAEVGQGGYGKVYKGILADGTVVAIKRAQEGSLQGQKEFFTE 673
Query: 671 IQFLSRLHHRNLVSLVGYCDEEGEQMLVYEFMSNGTLRDQLSV 713
I+ LSR+HHRNLVSL+GYCDEEGEQMLVYEFM NGTLRD LS
Sbjct: 674 IELLSRVHHRNLVSLIGYCDEEGEQMLVYEFMPNGTLRDHLSA 716
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297745743|emb|CBI15799.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|334182352|ref|NP_172169.2| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] gi|264664524|sp|C0LGD7.2|Y1684_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g06840; Flags: Precursor gi|332189923|gb|AEE28044.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|357460549|ref|XP_003600556.1| hypothetical protein MTR_3g062590 [Medicago truncatula] gi|355489604|gb|AES70807.1| hypothetical protein MTR_3g062590 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|297848960|ref|XP_002892361.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338203|gb|EFH68620.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|224589376|gb|ACN59222.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356569432|ref|XP_003552905.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g06840-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224124832|ref|XP_002319433.1| predicted protein [Populus trichocarpa] gi|222857809|gb|EEE95356.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356537716|ref|XP_003537371.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g06840-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449439195|ref|XP_004137372.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g06840-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 713 | ||||||
| TAIR|locus:2181017 | 951 | AT5G01950 [Arabidopsis thalian | 0.964 | 0.723 | 0.537 | 1e-194 | |
| TAIR|locus:2084016 | 937 | AT3G53590 [Arabidopsis thalian | 0.929 | 0.707 | 0.483 | 3.5e-162 | |
| TAIR|locus:2019863 | 971 | AT1G79620 [Arabidopsis thalian | 0.913 | 0.670 | 0.323 | 1.7e-75 | |
| TAIR|locus:2157042 | 953 | AT5G49760 [Arabidopsis thalian | 0.913 | 0.683 | 0.310 | 1.4e-71 | |
| TAIR|locus:2156992 | 946 | AT5G49770 [Arabidopsis thalian | 0.913 | 0.688 | 0.304 | 1.9e-67 | |
| TAIR|locus:2157002 | 857 | AT5G49780 [Arabidopsis thalian | 0.144 | 0.120 | 0.592 | 2.7e-56 | |
| TAIR|locus:2138268 | 1045 | AT4G08850 [Arabidopsis thalian | 0.361 | 0.246 | 0.373 | 6.6e-50 | |
| TAIR|locus:2120362 | 1249 | GSO1 "GASSHO1" [Arabidopsis th | 0.429 | 0.244 | 0.313 | 2.5e-45 | |
| TAIR|locus:2009630 | 953 | AT1G53420 [Arabidopsis thalian | 0.179 | 0.134 | 0.449 | 3.3e-43 | |
| TAIR|locus:2203718 | 1035 | AT1G53440 [Arabidopsis thalian | 0.338 | 0.232 | 0.305 | 4.4e-43 |
| TAIR|locus:2181017 AT5G01950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1886 (669.0 bits), Expect = 1.0e-194, P = 1.0e-194
Identities = 374/696 (53%), Positives = 461/696 (66%)
Query: 23 VVAADDDSITDPIEVSALRSIKKSLVDDYSKLSNWNRGDPCTSNWTGVLCFNTTMDDGYX 82
V+ D T P EV+ALRS+K+SL+D L NWNRGDPC SNWTGV+CFN D Y
Sbjct: 19 VLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNWTGVICFNEIGTDDYL 78
Query: 83 XXXXXXXXXXXXXXXXSPEIGRLSYLTILDFMWNKISGSIPKEIGNIKXXXXXXXXXXXX 142
SPE+ +L++L ILDFMWN ISGSIP EIG I
Sbjct: 79 HVRELLLMNMNLSGTLSPELQKLAHLEILDFMWNNISGSIPNEIGQISSLVLLLLNGNKL 138
Query: 143 XXXXPEELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSISGQIPPELSRLP 202
P ELGYL L+R QID+N I+G +PKSF+NL K +H H NNNS++GQIP ELS L
Sbjct: 139 SGTLPSELGYLSNLNRFQIDENNITGPIPKSFSNLKKVKHLHFNNNSLTGQIPVELSNLT 198
Query: 203 SLVHMLLDNNNLTGYXXXXXXXXXXXXXXXXDNNNFEGTTIPASYSNMSKLLKLSLRNCS 262
++ H+LLDNN L+G DNNNF G+ IPASY N S +LKLSLRNCS
Sbjct: 199 NIFHVLLDNNKLSGNLPPQLSALPNLQILQLDNNNFSGSDIPASYGNFSNILKLSLRNCS 258
Query: 263 LQGPMPDLSRIPNLGYLDLSSNQLNGSIPPGRLSLNITTIKLSNNKLTGTIPSNFSGLPR 322
L+G +PD S+I +L YLDLS N+L G IP S ++TTI LSNN L G+IP +FS LP
Sbjct: 259 LKGALPDFSKIRHLKYLDLSWNELTGPIPSSNFSKDVTTINLSNNILNGSIPQSFSDLPL 318
Query: 323 LQRLFIANNSLSGSIPSSIWQSRTLNATETFILDFQNNNLTNISGSFNIPPNVTVRLRGN 382
LQ L + NN LSGS+P S+W++ + +LD +NN+L+ + G P NVT+RL GN
Sbjct: 319 LQMLLLKNNMLSGSVPDSLWKNISFPKKARLLLDLRNNSLSRVQGDLTPPQNVTLRLDGN 378
Query: 383 PFCLN---TNAEQFCGSHSDDDNEI-DRSTNSTLDCRAQSCPTD--YEYSPTSPIRCFCA 436
C N +NA FC S + + + STNS LDC +CPT YEYSP SP+RCFCA
Sbjct: 379 LICTNGSISNANLFCESKGKEWISLPNNSTNSALDCPPLACPTPDFYEYSPASPLRCFCA 438
Query: 437 APLLVGYRLKSPGLSYFPAYKNLFEEYMTSGLKLNLYQLDIDSFRWEKGPRLKMYLKLFP 496
APL +GYRLKSP SYFP Y + F EY+T L++ YQL IDS++WEKGPRL+MYLKLFP
Sbjct: 439 APLRIGYRLKSPSFSYFPPYIDQFGEYVTDFLQMEPYQLWIDSYQWEKGPRLRMYLKLFP 498
Query: 497 VYDNSSGNSYVFNASEVGRIRSMFTGWNIPDSDIFGPYELINFTLQGPYRDVFPPSRNSG 556
+ + + FN SEV RIR +F W P SD+FGPYEL+NFTLQGPY V S G
Sbjct: 499 KVNETYTRT--FNESEVLRIRGIFASWRFPGSDLFGPYELLNFTLQGPYSYVNFNSERKG 556
Query: 557 ISKXXXXXXXXXXXXXXVTISAIVSLLIVRAHMKNYHAISRRRHSSKTSIKIDGVRSFTY 616
+S V ISA+V+ L++R + K+ ISRRR SSK S+ G+R F++
Sbjct: 557 VSWRRLAAITAGAVVTAVAISAVVAALLLRRYSKHEREISRRRSSSKASLLNSGIRGFSF 616
Query: 617 GEMALATNNFNSSTQIGQGGYGKVYKGILPDGTVVAVKRAQEGSLQGEKEFLTEIQFLSR 676
E+A AT++F+SST +G+GGYGKVY+G+L D TV A+KRA EGSLQGEKEFL EI+ LSR
Sbjct: 617 KELAEATDDFSSSTLVGRGGYGKVYRGVLSDNTVAAIKRADEGSLQGEKEFLNEIELLSR 676
Query: 677 LHHRNLVSLVGYCDEEGEQMLVYEFMSNGTLRDQLS 712
LHHRNLVSL+GYCDEE EQMLVYEFMSNGTLRD LS
Sbjct: 677 LHHRNLVSLIGYCDEESEQMLVYEFMSNGTLRDWLS 712
|
|
| TAIR|locus:2084016 AT3G53590 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2019863 AT1G79620 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157042 AT5G49760 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156992 AT5G49770 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2157002 AT5G49780 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2138268 AT4G08850 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120362 GSO1 "GASSHO1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2009630 AT1G53420 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203718 AT1G53440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 713 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-45 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-38 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-38 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-33 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-24 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 7e-20 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 1e-19 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 1e-19 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-18 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 1e-17 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-17 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 5e-16 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 9e-16 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-13 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 4e-13 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 6e-13 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 2e-12 | |
| cd05112 | 256 | cd05112, PTKc_Itk, Catalytic domain of the Protein | 3e-12 | |
| cd05068 | 261 | cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re | 1e-11 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 2e-11 | |
| cd05052 | 263 | cd05052, PTKc_Abl, Catalytic domain of the Protein | 5e-11 | |
| cd05041 | 251 | cd05041, PTKc_Fes_like, Catalytic domain of Fes-li | 5e-11 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 6e-11 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 8e-11 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 1e-10 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 2e-10 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 3e-10 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 6e-10 | |
| cd05059 | 256 | cd05059, PTKc_Tec_like, Catalytic domain of Tec-li | 8e-10 | |
| cd05050 | 288 | cd05050, PTKc_Musk, Catalytic domain of the Protei | 2e-09 | |
| cd05044 | 269 | cd05044, PTKc_c-ros, Catalytic domain of the Prote | 2e-09 | |
| cd05113 | 256 | cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro | 7e-09 | |
| cd05045 | 290 | cd05045, PTKc_RET, Catalytic domain of the Protein | 1e-08 | |
| cd05085 | 250 | cd05085, PTKc_Fer, Catalytic domain of the Protein | 1e-08 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-08 | |
| cd05148 | 261 | cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro | 2e-08 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 2e-08 | |
| cd05032 | 277 | cd05032, PTKc_InsR_like, Catalytic domain of Insul | 2e-08 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 4e-08 | |
| cd05092 | 280 | cd05092, PTKc_TrkA, Catalytic domain of the Protei | 5e-08 | |
| cd05033 | 266 | cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec | 9e-08 | |
| cd05071 | 262 | cd05071, PTKc_Src, Catalytic domain of the Protein | 1e-07 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 1e-07 | |
| cd05070 | 260 | cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro | 1e-07 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-07 | |
| cd05069 | 260 | cd05069, PTKc_Yes, Catalytic domain of the Protein | 2e-07 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 3e-07 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 3e-07 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 3e-07 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 4e-07 | |
| cd05093 | 288 | cd05093, PTKc_TrkB, Catalytic domain of the Protei | 4e-07 | |
| cd05080 | 283 | cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma | 5e-07 | |
| cd05088 | 303 | cd05088, PTKc_Tie2, Catalytic domain of the Protei | 5e-07 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 6e-07 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 7e-07 | |
| cd05094 | 291 | cd05094, PTKc_TrkC, Catalytic domain of the Protei | 7e-07 | |
| cd05114 | 256 | cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro | 9e-07 | |
| cd05067 | 260 | cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro | 1e-06 | |
| cd05063 | 268 | cd05063, PTKc_EphR_A2, Catalytic domain of the Pro | 2e-06 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 2e-06 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 2e-06 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 3e-06 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 3e-06 | |
| pfam08263 | 42 | pfam08263, LRRNT_2, Leucine rich repeat N-terminal | 3e-06 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 4e-06 | |
| cd05090 | 283 | cd05090, PTKc_Ror1, Catalytic domain of the Protei | 4e-06 | |
| cd05036 | 277 | cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro | 4e-06 | |
| cd05072 | 261 | cd05072, PTKc_Lyn, Catalytic domain of the Protein | 5e-06 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 5e-06 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 5e-06 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 6e-06 | |
| cd05084 | 252 | cd05084, PTKc_Fes, Catalytic domain of the Protein | 6e-06 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 7e-06 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 7e-06 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 9e-06 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 1e-05 | |
| cd05053 | 293 | cd05053, PTKc_FGFR, Catalytic domain of the Protei | 1e-05 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 1e-05 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 1e-05 | |
| cd05042 | 269 | cd05042, PTKc_Aatyk, Catalytic domain of the Prote | 1e-05 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 2e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 2e-05 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 2e-05 | |
| cd05051 | 296 | cd05051, PTKc_DDR, Catalytic domain of the Protein | 2e-05 | |
| cd05087 | 269 | cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t | 3e-05 | |
| cd05065 | 269 | cd05065, PTKc_EphR_B, Catalytic domain of the Prot | 3e-05 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 3e-05 | |
| cd05082 | 256 | cd05082, PTKc_Csk, Catalytic domain of the Protein | 4e-05 | |
| cd05061 | 288 | cd05061, PTKc_InsR, Catalytic domain of the Protei | 4e-05 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 4e-05 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 4e-05 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 5e-05 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 5e-05 | |
| cd05054 | 337 | cd05054, PTKc_VEGFR, Catalytic domain of the Prote | 6e-05 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 7e-05 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 1e-04 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 1e-04 | |
| cd05083 | 254 | cd05083, PTKc_Chk, Catalytic domain of the Protein | 1e-04 | |
| cd05062 | 277 | cd05062, PTKc_IGF-1R, Catalytic domain of the Prot | 1e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-04 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 2e-04 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 2e-04 | |
| cd05089 | 297 | cd05089, PTKc_Tie1, Catalytic domain of the Protei | 2e-04 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 2e-04 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 2e-04 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 2e-04 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 2e-04 | |
| cd05091 | 283 | cd05091, PTKc_Ror2, Catalytic domain of the Protei | 2e-04 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 2e-04 | |
| cd05035 | 273 | cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li | 3e-04 | |
| cd05047 | 270 | cd05047, PTKc_Tie, Catalytic domain of Tie Protein | 3e-04 | |
| cd05097 | 295 | cd05097, PTKc_DDR_like, Catalytic domain of Discoi | 3e-04 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 3e-04 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 4e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 5e-04 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 5e-04 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 6e-04 | |
| cd05079 | 284 | cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma | 7e-04 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 8e-04 | |
| cd05103 | 343 | cd05103, PTKc_VEGFR2, Catalytic domain of the Prot | 8e-04 | |
| cd05106 | 374 | cd05106, PTKc_CSF-1R, Catalytic domain of the Prot | 8e-04 | |
| cd05096 | 304 | cd05096, PTKc_DDR1, Catalytic domain of the Protei | 8e-04 | |
| cd05110 | 303 | cd05110, PTKc_HER4, Catalytic domain of the Protei | 0.001 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 0.001 | |
| cd06651 | 266 | cd06651, STKc_MEKK3, Catalytic domain of the Prote | 0.001 | |
| cd05055 | 302 | cd05055, PTKc_PDGFR, Catalytic domain of the Prote | 0.001 | |
| cd05043 | 280 | cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece | 0.001 | |
| cd05099 | 314 | cd05099, PTKc_FGFR4, Catalytic domain of the Prote | 0.001 | |
| cd05078 | 258 | cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat | 0.002 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 0.002 | |
| cd05073 | 260 | cd05073, PTKc_Hck, Catalytic domain of the Protein | 0.002 | |
| cd06652 | 265 | cd06652, STKc_MEKK2, Catalytic domain of the Prote | 0.002 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 0.002 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 0.002 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.003 | |
| cd00116 | 319 | cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo | 0.003 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 0.003 | |
| cd05095 | 296 | cd05095, PTKc_DDR2, Catalytic domain of the Protei | 0.003 | |
| cd05086 | 268 | cd05086, PTKc_Aatyk2, Catalytic domain of the Prot | 0.003 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 0.003 | |
| cd05066 | 267 | cd05066, PTKc_EphR_A, Catalytic domain of the Prot | 0.004 | |
| cd05064 | 266 | cd05064, PTKc_EphR_A10, Catalytic domain of the Pr | 0.004 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 0.004 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 173 bits (441), Expect = 4e-45
Identities = 120/354 (33%), Positives = 172/354 (48%), Gaps = 40/354 (11%)
Query: 36 EVSALRSIKKSLVDDYSKLSNWN-RGDPCTSNWTGVLCFNTTMDDGYLHLRELQLLNLNL 94
E+ L S K S+ D LSNWN D C W G+ C N++ + + L N+
Sbjct: 30 ELELLLSFKSSINDPLKYLSNWNSSADVC--LWQGITCNNSS------RVVSIDLSGKNI 81
Query: 95 SGNLSPEIGRLSYLTILDFMWNKISGSIPKEI-----------------------GNIKS 131
SG +S I RL Y+ ++ N++SG IP +I G+I +
Sbjct: 82 SGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN 141
Query: 132 LELLLLNGNELTGSLPEELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSIS 191
LE L L+ N L+G +P ++G L + + N + G +P S NL + +N +
Sbjct: 142 LETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLV 201
Query: 192 GQIPPELSRLPSLVHMLLDNNNLTGYLPPELSELPKLLILQLDNNNFEGTTIPASYSNMS 251
GQIP EL ++ SL + L NNL+G +P E+ L L L L NN G IP+S N+
Sbjct: 202 GQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTG-PIPSSLGNLK 260
Query: 252 KLLKLSLRNCSLQGPMP-DLSRIPNLGYLDLSSNQLNGSIPPGRLSL-NITTIKLSNNKL 309
L L L L GP+P + + L LDLS N L+G IP + L N+ + L +N
Sbjct: 261 NLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNF 320
Query: 310 TGTIPSNFSGLPRLQRLFIANNSLSGSIPSSIWQSRTLNATETFILDFQNNNLT 363
TG IP + LPRLQ L + +N SG IP ++ + L +LD NNLT
Sbjct: 321 TGKIPVALTSLPRLQVLQLWSNKFSGEIPKNLGKHNNLT-----VLDLSTNNLT 369
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >gnl|CDD|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >gnl|CDD|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >gnl|CDD|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >gnl|CDD|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >gnl|CDD|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >gnl|CDD|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >gnl|CDD|133209 cd05078, PTK_Jak2_Jak3_rpt1, Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 713 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.96 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.96 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.94 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.93 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.91 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.89 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.87 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.86 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.86 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.83 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.82 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.82 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.82 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.81 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.81 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.79 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.76 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.76 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.71 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.71 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.69 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 99.65 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 99.63 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.6 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 99.58 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 99.54 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 99.54 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 99.51 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 99.5 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 99.48 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 99.45 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 99.41 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 99.38 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 99.37 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.37 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.35 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.31 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.31 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.27 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.24 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 99.21 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 99.2 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.19 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.18 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.17 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.16 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.16 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 99.15 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.15 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.14 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.14 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.14 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.13 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.12 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.12 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 99.11 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.11 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.11 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.11 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 99.1 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.09 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.09 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 99.08 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 99.08 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.08 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.08 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.07 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.07 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.07 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.07 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 99.07 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.07 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.06 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.06 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.06 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.05 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.05 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 99.05 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.04 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.04 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 99.04 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.04 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.04 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.04 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.03 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.03 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 99.02 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.02 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.02 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.02 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.02 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.01 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.01 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.01 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.01 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.01 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.01 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.01 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 99.01 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.0 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.0 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.0 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.0 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.0 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.0 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.0 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 98.99 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 98.99 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 98.99 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 98.99 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 98.99 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.99 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 98.98 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 98.98 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 98.98 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 98.98 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 98.98 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 98.97 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 98.97 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 98.97 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.97 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.97 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 98.97 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 98.97 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 98.97 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 98.96 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 98.96 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 98.96 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 98.96 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 98.96 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 98.96 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 98.96 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 98.96 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 98.96 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 98.95 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 98.95 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 98.95 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 98.95 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 98.94 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 98.94 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 98.94 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 98.94 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 98.94 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 98.94 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 98.94 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 98.94 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 98.94 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.93 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 98.93 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 98.93 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 98.93 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 98.93 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 98.93 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 98.93 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 98.92 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 98.92 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 98.92 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 98.92 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 98.92 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 98.92 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 98.92 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 98.92 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 98.92 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 98.91 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 98.91 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 98.91 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 98.91 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 98.91 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 98.91 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 98.91 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 98.9 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 98.9 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 98.9 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 98.9 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 98.9 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 98.9 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 98.9 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 98.9 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 98.89 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 98.89 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 98.89 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 98.89 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 98.89 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 98.89 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 98.89 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 98.89 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 98.89 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 98.89 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 98.89 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 98.88 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 98.88 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 98.88 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 98.88 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 98.88 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 98.88 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 98.88 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 98.88 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 98.88 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 98.88 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 98.88 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 98.87 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 98.87 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 98.87 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 98.87 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 98.87 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 98.87 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 98.87 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 98.87 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 98.87 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 98.87 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 98.87 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 98.87 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 98.86 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 98.86 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 98.86 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 98.86 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 98.86 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 98.86 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 98.86 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 98.86 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 98.86 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 98.85 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 98.85 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 98.85 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 98.85 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 98.85 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 98.85 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 98.85 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 98.85 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 98.85 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 98.85 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 98.85 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 98.84 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 98.84 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 98.84 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 98.84 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 98.84 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 98.84 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 98.84 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 98.83 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 98.83 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 98.83 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 98.83 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 98.83 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 98.83 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 98.83 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 98.83 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.83 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 98.83 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 98.83 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 98.83 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 98.83 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 98.83 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 98.83 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 98.82 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 98.82 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 98.82 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 98.82 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 98.82 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 98.82 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 98.82 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 98.82 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 98.81 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 98.81 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 98.81 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 98.81 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 98.81 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 98.81 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 98.81 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 98.81 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 98.81 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 98.8 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 98.8 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 98.8 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 98.8 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 98.8 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 98.8 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 98.8 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 98.79 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 98.79 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 98.79 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 98.79 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 98.79 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 98.78 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 98.78 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 98.78 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 98.78 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 98.78 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 98.78 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 98.78 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 98.78 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 98.78 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 98.78 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 98.77 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 98.77 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 98.77 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 98.77 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 98.77 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 98.77 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 98.77 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 98.76 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 98.76 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 98.76 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 98.76 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 98.75 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 98.75 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 98.75 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.75 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 98.75 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 98.74 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.74 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 98.74 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 98.74 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 98.74 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 98.74 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 98.74 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 98.74 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 98.73 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 98.73 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 98.72 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 98.72 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 98.72 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 98.72 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 98.71 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 98.71 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.71 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 98.71 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 98.71 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 98.71 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 98.7 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 98.69 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 98.68 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 98.67 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 98.67 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 98.67 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 98.67 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 98.66 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 98.66 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 98.66 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 98.66 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 98.65 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 98.65 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 98.65 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 98.65 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 98.65 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 98.65 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 98.64 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 98.64 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 98.63 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 98.63 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.63 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 98.63 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 98.63 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 98.63 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 98.62 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 98.62 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 98.62 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 98.61 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 98.61 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 98.61 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 98.61 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 98.6 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 98.58 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 98.58 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 98.58 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 98.58 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 98.58 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 98.58 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 98.58 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 98.57 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 98.57 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 98.56 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 98.55 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 98.55 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 98.55 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 98.54 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 98.54 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 98.54 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 98.54 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 98.53 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 98.53 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 98.53 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 98.51 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 98.51 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 98.51 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 98.5 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 98.5 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 98.5 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 98.49 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 98.49 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 98.49 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 98.49 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 98.48 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 98.47 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 98.47 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 98.46 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 98.45 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 98.45 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 98.44 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 98.44 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 98.44 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 98.42 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 98.41 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 98.41 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 98.38 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.38 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 98.36 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 98.36 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 98.33 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 98.33 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 98.32 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 98.32 | |
| PTZ00284 | 467 | protein kinase; Provisional | 98.3 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.3 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 98.3 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.29 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 98.26 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 98.26 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 98.24 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 98.23 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 98.23 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 98.22 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 98.2 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 98.17 | |
| KOG1152 | 772 | consensus Signal transduction serine/threonine kin | 98.16 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 98.14 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 98.1 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.09 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 98.09 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.09 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.09 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 98.08 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 98.06 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 98.05 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 98.01 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 98.0 | |
| PF08263 | 43 | LRRNT_2: Leucine rich repeat N-terminal domain; In | 97.99 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.99 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 97.98 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 97.97 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 97.91 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 97.85 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.78 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 97.76 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 97.75 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.71 | |
| smart00090 | 237 | RIO RIO-like kinase. | 97.7 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 97.69 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 97.68 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.67 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.67 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 97.65 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.64 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.63 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.6 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 97.58 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 97.56 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 97.55 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 97.54 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 97.35 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 97.32 | |
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 97.29 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.29 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 97.26 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 97.19 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 97.18 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 97.18 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 97.1 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.08 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.99 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.9 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 96.89 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 96.84 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 96.8 | |
| KOG1345 | 378 | consensus Serine/threonine kinase [Signal transduc | 96.76 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 96.71 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.7 | |
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 96.61 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 96.26 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 96.18 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 96.14 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 96.07 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.96 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 95.94 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.92 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 95.87 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.4 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 94.94 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 93.94 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.92 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 93.78 | |
| KOG0665 | 369 | consensus Jun-N-terminal kinase (JNK) [Signal tran | 93.56 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 93.21 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 93.14 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 92.71 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 92.4 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-57 Score=552.42 Aligned_cols=347 Identities=34% Similarity=0.536 Sum_probs=269.5
Q ss_pred CCHHHHHHHHHHHHhCCCCCCCCCCCCCC-CCCCCCCceeecCCCC---------------C---CCCCcceeEEEcCCC
Q 005120 32 TDPIEVSALRSIKKSLVDDYSKLSNWNRG-DPCTSNWTGVLCFNTT---------------M---DDGYLHLRELQLLNL 92 (713)
Q Consensus 32 ~~~~~~~~l~~~~~~~~~~~~~l~~w~~~-~~C~~~w~gv~C~~~~---------------~---~~~~~~l~~L~l~~~ 92 (713)
..+.|+.||+.||+.+.++...+.+|+.. ++| .|.||.|++.. . ...+++|+.|+|++|
T Consensus 26 ~~~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c--~w~gv~c~~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n 103 (968)
T PLN00113 26 LHAEELELLLSFKSSINDPLKYLSNWNSSADVC--LWQGITCNNSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNN 103 (968)
T ss_pred CCHHHHHHHHHHHHhCCCCcccCCCCCCCCCCC--cCcceecCCCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCC
Confidence 45688999999999998777778899866 555 79999996421 0 013456666666666
Q ss_pred CCccccCccc-----------------------cCCCCCCEEECCCCCCCcCCCccccCCCCCceEecccCCCCCcCCcc
Q 005120 93 NLSGNLSPEI-----------------------GRLSYLTILDFMWNKISGSIPKEIGNIKSLELLLLNGNELTGSLPEE 149 (713)
Q Consensus 93 ~l~~~~~~~~-----------------------~~l~~L~~L~Ls~n~i~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~ 149 (713)
++++.+|..+ +.+++|++|+|++|.+++.+|..++++++|++|+|++|.+.+.+|..
T Consensus 104 ~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~ 183 (968)
T PLN00113 104 QLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNS 183 (968)
T ss_pred ccCCcCChHHhccCCCCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChh
Confidence 6655554432 24677888889999998888989999999999999999998889999
Q ss_pred CCCCCCCCEEEccccCCCCCCchhhhcCCCCCEEEccCCccccccchhcCCCCCccEEecccCCCcCCCCcCCCCCCCCc
Q 005120 150 LGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSISGQIPPELSRLPSLVHMLLDNNNLTGYLPPELSELPKLL 229 (713)
Q Consensus 150 ~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~ 229 (713)
+.++++|++|+|++|.+.+.+|..+.++++|++|++++|.+.+.+|..+..+++|++|++++|++++.+|..++.+++|+
T Consensus 184 ~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~ 263 (968)
T PLN00113 184 LTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQ 263 (968)
T ss_pred hhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCC
Confidence 99999999999999999888899999999999999999999888888888999999999999998888888888889999
Q ss_pred EEEcccccCCCCCCcccccCCCCCCEEEccCCCCccCCC-CCCCCCCccEEEccCCCCcccCCCCccc-cCccEEEccCC
Q 005120 230 ILQLDNNNFEGTTIPASYSNMSKLLKLSLRNCSLQGPMP-DLSRIPNLGYLDLSSNQLNGSIPPGRLS-LNITTIKLSNN 307 (713)
Q Consensus 230 ~L~L~~N~l~~~~~~~~~~~l~~L~~L~L~~N~l~~~~~-~l~~l~~L~~L~Ls~N~l~~~ip~~~~~-~~L~~L~Ls~N 307 (713)
+|++++|++++ .+|..+.++++|++|++++|.+.+..| .+..+++|+.|++++|.+++.+|..+.. ++|+.|++++|
T Consensus 264 ~L~L~~n~l~~-~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n 342 (968)
T PLN00113 264 YLFLYQNKLSG-PIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSN 342 (968)
T ss_pred EEECcCCeeec-cCchhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCC
Confidence 99999988887 678888888888888888888887777 5778888888888888888777765433 67888888888
Q ss_pred cCcccCChhccCCcccceeecccccCcccCCchhhhhccCCCCCccEEEccCCcCCCcCCC-CC-CCCceEEEecCCCCC
Q 005120 308 KLTGTIPSNFSGLPRLQRLFIANNSLSGSIPSSIWQSRTLNATETFILDFQNNNLTNISGS-FN-IPPNVTVRLRGNPFC 385 (713)
Q Consensus 308 ~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~~~~l~~~~L~~L~ls~N~l~~i~~~-~~-~~~l~~l~l~~N~~~ 385 (713)
.+++.+|..+..+++|+.|++++|++++.+|..++ .+.+|+.|++++|++++..+. +. +++++.|++++|++.
T Consensus 343 ~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~-----~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~ 417 (968)
T PLN00113 343 KFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLC-----SSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFS 417 (968)
T ss_pred CCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHh-----CcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEee
Confidence 88877887788888888888888888777777766 344555555555555543221 21 444555555555544
Q ss_pred C
Q 005120 386 L 386 (713)
Q Consensus 386 ~ 386 (713)
+
T Consensus 418 ~ 418 (968)
T PLN00113 418 G 418 (968)
T ss_pred e
Confidence 3
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 713 | ||||
| 3tl8_A | 349 | The Avrptob-Bak1 Complex Reveals Two Structurally S | 1e-19 | ||
| 3uim_A | 326 | Structural Basis For The Impact Of Phosphorylation | 7e-19 | ||
| 2qkw_B | 321 | Structural Basis For Activation Of Plant Immunity B | 3e-17 | ||
| 3hgk_A | 327 | Crystal Structure Of Effect Protein Avrptob Complex | 4e-17 | ||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 5e-13 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 7e-13 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 3e-12 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 2e-04 | ||
| 2oib_A | 301 | Crystal Structure Of Irak4 Kinase Domain Apo Form L | 9e-12 | ||
| 2nru_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 9e-12 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 1e-11 | ||
| 2o8y_A | 298 | Apo Irak4 Kinase Domain Length = 298 | 3e-10 | ||
| 3qgw_A | 286 | Crystal Structure Of Itk Kinase Bound To An Inhibit | 3e-09 | ||
| 4hct_A | 269 | Crystal Structure Of Itk In Complex With Compound 5 | 4e-09 | ||
| 3qrj_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain T | 5e-09 | ||
| 3miy_A | 266 | X-Ray Crystal Structure Of Itk Complexed With Sunit | 5e-09 | ||
| 1sm2_A | 264 | Crystal Structure Of The Phosphorylated Interleukin | 5e-09 | ||
| 3v5j_A | 266 | Crystal Structure Of Interleukin-2 Inducible T-Cell | 5e-09 | ||
| 3qri_A | 277 | The Crystal Structure Of Human Abl1 Kinase Domain I | 6e-09 | ||
| 2v7a_A | 286 | Crystal Structure Of The T315i Abl Mutant In Comple | 6e-09 | ||
| 2hz0_A | 270 | Abl Kinase Domain In Complex With Nvp-Aeg082 Length | 7e-09 | ||
| 2gqg_A | 278 | X-Ray Crystal Structure Of Dasatinib (Bms-354825) B | 7e-09 | ||
| 2hzi_A | 277 | Abl Kinase Domain In Complex With Pd180970 Length = | 7e-09 | ||
| 2hyy_A | 273 | Human Abl Kinase Domain In Complex With Imatinib (S | 7e-09 | ||
| 2g2f_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 7e-09 | ||
| 3oy3_A | 284 | Crystal Structure Of Abl T315i Mutant Kinase Domain | 7e-09 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 8e-09 | ||
| 2f4j_A | 287 | Structure Of The Kinase Domain Of An Imatinib-Resis | 8e-09 | ||
| 1fpu_A | 293 | Crystal Structure Of Abl Kinase Domain In Complex W | 8e-09 | ||
| 2z60_A | 288 | Crystal Structure Of The T315i Mutant Of Abl Kinase | 8e-09 | ||
| 3oxz_A | 284 | Crystal Structure Of Abl Kinase Domain Bound With A | 9e-09 | ||
| 2g1t_A | 287 | A Src-Like Inactive Conformation In The Abl Tyrosin | 9e-09 | ||
| 2e2b_A | 293 | Crystal Structure Of The C-Abl Kinase Domain In Com | 9e-09 | ||
| 2hiw_A | 287 | Crystal Structure Of Inactive Conformation Abl Kina | 9e-09 | ||
| 3pyy_A | 298 | Discovery And Characterization Of A Cell-Permeable, | 1e-08 | ||
| 2qoh_A | 288 | Crystal Structure Of Abl Kinase Bound With Ppy-a Le | 1e-08 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 1e-08 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 1e-08 | ||
| 3t9t_A | 267 | Crystal Structure Of Btk Mutant (F435t,K596r) Compl | 2e-08 | ||
| 3dk7_A | 277 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 2e-08 | ||
| 3dk3_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 3e-08 | ||
| 3dk6_A | 293 | Crystal Structure Of Mutant Abl Kinase Domain In Co | 8e-08 | ||
| 4gt5_A | 306 | Crystal Structure Of The Inactive Trka Kinase Domai | 2e-07 | ||
| 4f0i_A | 300 | Crystal Structure Of Apo Trka Length = 300 | 2e-07 | ||
| 3sxr_A | 268 | Crystal Structure Of Bmx Non-Receptor Tyrosine Kina | 2e-07 | ||
| 4aoj_A | 329 | Human Trka In Complex With The Inhibitor Az-23 Leng | 2e-07 | ||
| 3gvu_A | 292 | The Crystal Structure Of Human Abl2 In Complex With | 3e-07 | ||
| 3pix_A | 274 | Crystal Structure Of Btk Kinase Domain Complexed Wi | 6e-07 | ||
| 4f1m_A | 287 | Crystal Structure Of The G1179s Roco4 Kinase Domain | 6e-07 | ||
| 4f1o_A | 287 | Crystal Structure Of The L1180t Mutant Roco4 Kinase | 6e-07 | ||
| 4f0f_A | 287 | Crystal Structure Of The Roco4 Kinase Domain Bound | 6e-07 | ||
| 3gen_A | 283 | The 1.6 A Crystal Structure Of Human Bruton's Tyros | 9e-07 | ||
| 3k54_A | 283 | Structures Of Human Bruton's Tyrosine Kinase In Act | 9e-07 | ||
| 4asz_A | 299 | Crystal Structure Of Apo Trkb Kinase Domain Length | 1e-06 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 1e-06 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 1e-06 | ||
| 1yi6_A | 276 | C-Term Tail Segment Of Human Tyrosine Kinase (258-5 | 1e-06 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 1e-06 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 1e-06 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 1e-06 | ||
| 2bdf_A | 279 | Src Kinase In Complex With Inhibitor Ap23451 Length | 1e-06 | ||
| 3u4w_A | 275 | Src In Complex With Dna-Templated Macrocyclic Inhib | 1e-06 | ||
| 3d7u_B | 277 | Structural Basis For The Recognition Of C-Src By It | 1e-06 | ||
| 3dqw_A | 286 | C-Src Kinase Domain Thr338ile Mutant In Complex Wit | 1e-06 | ||
| 3g6h_A | 286 | Src Thr338ile Inhibited In The Dfg-Asp-Out Conforma | 1e-06 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 2e-06 | ||
| 3svv_A | 286 | Crystal Structure Of T338c C-Src Covalently Bound T | 2e-06 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 2e-06 | ||
| 2oiq_A | 286 | Crystal Structure Of Chicken C-Src Kinase Domain In | 2e-06 | ||
| 3geq_A | 286 | Structural Basis For The Chemical Rescue Of Src Kin | 2e-06 | ||
| 2qq7_A | 286 | Crystal Structure Of Drug Resistant Src Kinase Doma | 2e-06 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 2e-06 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 2e-06 | ||
| 2hwo_A | 286 | Crystal Structure Of Src Kinase Domain In Complex W | 2e-06 | ||
| 3v5q_A | 297 | Discovery Of A Selective Trk Inhibitor With Efficac | 3e-06 | ||
| 2oo8_X | 317 | Synthesis, Structural Analysis, And Sar Studies Of | 3e-06 | ||
| 2wqb_A | 324 | Structure Of The Tie2 Kinase Domain In Complex With | 3e-06 | ||
| 1fvr_A | 327 | Tie2 Kinase Domain Length = 327 | 3e-06 | ||
| 3oez_A | 286 | Crystal Structure Of The L317i Mutant Of The Chicke | 3e-06 | ||
| 1k2p_A | 263 | Crystal Structure Of Bruton's Tyrosine Kinase Domai | 4e-06 | ||
| 1yoj_A | 283 | Crystal Structure Of Src Kinase Domain Length = 283 | 4e-06 | ||
| 3p08_A | 267 | Crystal Structure Of The Human Btk Kinase Domain Le | 4e-06 | ||
| 3oct_A | 265 | Crystal Structure Of Bruton's Tyrosine Kinase Mutan | 4e-06 | ||
| 1yol_A | 283 | Crystal Structure Of Src Kinase Domain In Complex W | 4e-06 | ||
| 3ocs_A | 271 | Crystal Structure Of Bruton's Tyrosine Kinase In Co | 5e-06 | ||
| 2xa4_A | 298 | Inhibitors Of Jak2 Kinase Domain Length = 298 | 7e-06 | ||
| 3e62_A | 293 | Fragment Based Discovery Of Jak-2 Inhibitors Length | 7e-06 | ||
| 3rvg_A | 303 | Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido | 7e-06 | ||
| 1luf_A | 343 | Crystal Structure Of The Musk Tyrosine Kinase: Insi | 8e-06 | ||
| 4hge_A | 300 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 | 8e-06 | ||
| 3q32_A | 301 | Structure Of Janus Kinase 2 With A Pyrrolotriazine | 8e-06 | ||
| 3ugc_A | 295 | Structural Basis Of Jak2 Inhibition By The Type Ii | 8e-06 | ||
| 4aqc_A | 301 | Triazolopyridine-Based Inhibitor Of Janus Kinase 2 | 8e-06 | ||
| 3tjc_A | 298 | Co-Crystal Structure Of Jak2 With Thienopyridine 8 | 8e-06 | ||
| 3lpb_A | 295 | Crystal Structure Of Jak2 Complexed With A Potent 2 | 8e-06 | ||
| 4bbe_A | 298 | Aminoalkylpyrimidine Inhibitor Complexes With Jak2 | 8e-06 | ||
| 4e4m_A | 302 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 | 9e-06 | ||
| 2w1i_A | 326 | Structure Determination Of Aurora Kinase In Complex | 9e-06 | ||
| 3jy9_A | 311 | Janus Kinase 2 Inhibitors Length = 311 | 9e-06 | ||
| 2b7a_A | 293 | The Structural Basis Of Janus Kinase 2 Inhibition B | 9e-06 | ||
| 4e6d_A | 298 | Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W | 1e-05 | ||
| 3io7_A | 313 | 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel | 1e-05 | ||
| 1mqb_A | 333 | Crystal Structure Of Ephrin A2 (Epha2) Receptor Pro | 2e-05 | ||
| 3hng_A | 360 | Crystal Structure Of Vegfr1 In Complex With N-(4-ch | 2e-05 | ||
| 3o23_A | 305 | Human Unphosphorylated Igf1-R Kinase Domain In Comp | 2e-05 | ||
| 2ofu_A | 273 | X-Ray Crystal Structure Of 2-Aminopyrimidine Carbam | 2e-05 | ||
| 3lck_A | 271 | The Kinase Domain Of Human Lymphocyte Kinase (Lck), | 2e-05 | ||
| 2of2_A | 271 | Crystal Structure Of Furanopyrimidine 8 Bound To Lc | 2e-05 | ||
| 3bym_A | 272 | X-Ray Co-Crystal Structure Aminobenzimidazole Triaz | 2e-05 | ||
| 2ivt_A | 314 | Crystal Structure Of Phosphorylated Ret Tyrosine Ki | 2e-05 | ||
| 3mpm_A | 267 | Lck Complexed With A Pyrazolopyrimidine Length = 26 | 2e-05 | ||
| 3cd3_A | 377 | Crystal Structure Of Phosphorylated Human Feline Sa | 2e-05 | ||
| 2ofv_A | 277 | Crystal Structure Of Aminoquinazoline 1 Bound To Lc | 2e-05 | ||
| 2ivv_A | 314 | Crystal Structure Of Phosphorylated Ret Tyrosine Ki | 2e-05 | ||
| 3kmm_A | 288 | Structure Of Human Lck Kinase With A Small Molecule | 2e-05 | ||
| 3bys_A | 277 | Co-Crystal Structure Of Lck And Aminopyrimidine Ami | 2e-05 | ||
| 2og8_A | 265 | Crystal Structure Of Aminoquinazoline 36 Bound To L | 2e-05 | ||
| 3bkb_A | 377 | Crystal Structure Of Human Feline Sarcoma Viral Onc | 2e-05 | ||
| 2zv7_A | 279 | Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | 2e-05 | ||
| 2ivs_A | 314 | Crystal Structure Of Non-Phosphorylated Ret Tyrosin | 2e-05 | ||
| 1qpe_A | 279 | Structural Analysis Of The Lymphocyte-Specific Kina | 2e-05 | ||
| 2zm1_A | 285 | Crystal Structure Of Imidazo Pyrazin 1 Bound To The | 3e-05 | ||
| 3kxz_A | 287 | The Complex Crystal Structure Of Lck With A Probe M | 3e-05 | ||
| 1p4o_A | 322 | Structure Of Apo Unactivated Igf-1r Kinase Domain A | 3e-05 | ||
| 3lw0_A | 304 | Igf-1rk In Complex With Ligand Msc1609119a-1 Length | 3e-05 | ||
| 2pl0_A | 289 | Lck Bound To Imatinib Length = 289 | 3e-05 | ||
| 3i81_A | 315 | Crystal Structure Of Insulin-Like Growth Factor 1 R | 3e-05 | ||
| 2dq7_X | 283 | Crystal Structure Of Fyn Kinase Domain Complexed Wi | 3e-05 | ||
| 2zm3_A | 308 | Complex Structure Of Insulin-Like Growth Factor Rec | 3e-05 | ||
| 1m7n_A | 322 | Crystal Structure Of Unactivated Apo Insulin-Like G | 3e-05 | ||
| 3lvp_A | 336 | Crystal Structure Of Bisphosphorylated Igf1-R Kinas | 3e-05 | ||
| 3d94_A | 301 | Crystal Structure Of The Insulin-Like Growth Factor | 3e-05 | ||
| 2oj9_A | 307 | Structure Of Igf-1r Kinase Domain Complexed With A | 3e-05 | ||
| 1k3a_A | 299 | Structure Of The Insulin-Like Growth Factor 1 Recep | 3e-05 | ||
| 1jqh_A | 308 | Igf-1 Receptor Kinase Domain Length = 308 | 3e-05 | ||
| 4fnw_A | 327 | Crystal Structure Of The Apo F1174l Anaplastic Lymp | 3e-05 | ||
| 3qqu_A | 301 | Cocrystal Structure Of Unphosphorylated Igf With Py | 3e-05 | ||
| 2pk9_A | 317 | Structure Of The Pho85-pho80 Cdk-cyclin Complex Of | 3e-05 | ||
| 2yjr_A | 342 | Structure Of F1174l Mutant Anaplastic Lymphoma Kina | 4e-05 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 4e-05 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 4e-05 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 5e-05 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 5e-05 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 5e-05 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 5e-05 | ||
| 3dtc_A | 271 | Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp | 5e-05 | ||
| 1p8v_A | 279 | Crystal Structure Of The Complex Of Platelet Recept | 6e-05 | ||
| 4dce_A | 333 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 8e-05 | ||
| 3a4o_X | 286 | Lyn Kinase Domain Length = 286 | 8e-05 | ||
| 4fnz_A | 327 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 8e-05 | ||
| 1qpd_A | 279 | Structural Analysis Of The Lymphocyte-specific Kina | 8e-05 | ||
| 4fnx_A | 327 | Crystal Structure Of The Apo R1275q Anaplastic Lymp | 9e-05 | ||
| 1sq0_B | 288 | Crystal Structure Of The Complex Of The Wild-Type V | 9e-05 | ||
| 1gwb_B | 281 | Structure Of Glycoprotein 1b Length = 281 | 9e-05 | ||
| 2qoi_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 9e-05 | ||
| 2qoo_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 9e-05 | ||
| 2yfx_A | 327 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 9e-05 | ||
| 2yhv_A | 342 | Structure Of L1196m Mutant Anaplastic Lymphoma Kina | 9e-05 | ||
| 2qol_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596:y | 9e-05 | ||
| 2qok_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 9e-05 | ||
| 2xp2_A | 327 | Structure Of The Human Anaplastic Lymphoma Kinase I | 9e-05 | ||
| 2qof_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f | 9e-05 | ||
| 2xb7_A | 315 | Structure Of Human Anaplastic Lymphoma Kinase In Co | 1e-04 | ||
| 3l9p_A | 367 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 1e-04 | ||
| 3aox_A | 344 | X-Ray Crystal Structure Of Human Anaplastic Lymphom | 1e-04 | ||
| 3lct_A | 344 | Crystal Structure Of The Anaplastic Lymphoma Kinase | 1e-04 | ||
| 4fob_A | 353 | Crystal Structure Of Human Anaplastic Lymphoma Kina | 1e-04 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 1e-04 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 1e-04 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 1e-04 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 1e-04 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 1e-04 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 1e-04 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 1e-04 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 1e-04 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 1e-04 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 1e-04 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 1e-04 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 1e-04 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 1e-04 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 1e-04 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 1e-04 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 1e-04 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 1e-04 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 1e-04 | ||
| 2yjs_A | 342 | Structure Of C1156y Mutant Anaplastic Lymphoma Kina | 1e-04 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 1e-04 | ||
| 1m10_B | 290 | Crystal Structure Of The Complex Of Glycoprotein Ib | 1e-04 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 1e-04 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 1e-04 | ||
| 1m0z_A | 290 | Crystal Structure Of The Von Willebrand Factor Bind | 1e-04 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 1e-04 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 1e-04 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 1e-04 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 2e-04 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 2e-04 | ||
| 4e1z_A | 291 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 2e-04 | ||
| 4e20_A | 290 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 2e-04 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 2e-04 | ||
| 4gg5_A | 319 | Crystal Structure Of Cmet In Complex With Novel Inh | 2e-04 | ||
| 3fxx_A | 371 | Human Epha3 Kinase And Juxtamembrane Region Bound T | 2e-04 | ||
| 2g15_A | 318 | Structural Characterization Of Autoinhibited C-Met | 2e-04 | ||
| 2vwu_A | 302 | Ephb4 Kinase Domain Inhibitor Complex Length = 302 | 2e-04 | ||
| 3q6w_A | 307 | Structure Of Dually-phosphorylated Met Receptor Kin | 2e-04 | ||
| 3c1x_A | 373 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-04 | ||
| 1r0p_A | 312 | Crystal Structure Of The Tyrosine Kinase Domain Of | 2e-04 | ||
| 2qod_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y602f | 2e-04 | ||
| 4aw5_A | 291 | Complex Of The Ephb4 Kinase Domain With An Oxindole | 2e-04 | ||
| 3a4p_A | 319 | Human C-Met Kinase Domain Complexed With 6-Benzylox | 2e-04 | ||
| 2gsf_A | 373 | The Human Epha3 Receptor Tyrosine Kinase And Juxtam | 2e-04 | ||
| 3qti_A | 314 | C-Met Kinase In Complex With Nvp-Bvu972 Length = 31 | 3e-04 | ||
| 3cth_A | 314 | Crystal Structure Of The Tyrosine Kinase Domain Of | 3e-04 | ||
| 3q6u_A | 308 | Structure Of The Apo Met Receptor Kinase In The Dua | 3e-04 | ||
| 3dkg_A | 317 | Sgx Clone 5698a109kfg1h1 Length = 317 | 3e-04 | ||
| 2rfn_A | 310 | X-ray Structure Of C-met With Inhibitor. Length = 3 | 3e-04 | ||
| 2wd1_A | 292 | Human C-Met Kinase In Complex With Azaindole Inhibi | 3e-04 | ||
| 3f66_A | 298 | Human C-Met Kinase In Complex With Quinoxaline Inhi | 3e-04 | ||
| 2wgj_A | 306 | X-Ray Structure Of Pf-02341066 Bound To The Kinase | 3e-04 | ||
| 3i5n_A | 309 | Crystal Structure Of C-Met With Triazolopyridazine | 3e-04 | ||
| 3dkc_A | 317 | Sgx Clone 5698a65kfg1h1 Length = 317 | 3e-04 | ||
| 2hk5_A | 270 | Hck Kinase In Complex With Lck Targetted Inhibitor | 3e-04 | ||
| 2qon_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Y596f: | 3e-04 | ||
| 1u0n_D | 265 | The Ternary Von Willebrand Factor A1-Glycoprotein I | 3e-04 | ||
| 3lq8_A | 302 | Structure Of The Kinase Domain Of C-Met Bound To Xl | 3e-04 | ||
| 3p72_A | 269 | Structure Of Platelet Glycoprotein 1b Alpha With A | 4e-04 | ||
| 2wqm_A | 310 | Structure Of Apo Human Nek7 Length = 310 | 4e-04 | ||
| 3d7t_A | 269 | Structural Basis For The Recognition Of C-Src By It | 4e-04 | ||
| 3d7u_A | 263 | Structural Basis For The Recognition Of C-Src By It | 4e-04 | ||
| 1ad5_A | 438 | Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | 5e-04 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 5e-04 | ||
| 2i1m_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An | 5e-04 | ||
| 1qcf_A | 454 | Crystal Structure Of Hck In Complex With A Src Fami | 5e-04 | ||
| 3bea_A | 333 | Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A P | 5e-04 | ||
| 1byg_A | 278 | Kinase Domain Of Human C-Terminal Src Kinase (Csk) | 5e-04 | ||
| 3lco_A | 324 | Inhibitor Bound To A Dfg-Out Structure Of The Kinas | 5e-04 | ||
| 2hen_A | 286 | Crystal Structure Of The Ephb2 Receptor Kinase Doma | 6e-04 | ||
| 2ogv_A | 317 | Crystal Structure Of The Autoinhibited Human C-Fms | 6e-04 | ||
| 1jpa_A | 312 | Crystal Structure Of Unphosphorylated Ephb2 Recepto | 6e-04 | ||
| 1p9a_G | 290 | Crystal Structure Of N-terminal Domain Of Human Pla | 6e-04 | ||
| 2i0v_A | 335 | C-Fms Tyrosine Kinase In Complex With A Quinolone I | 6e-04 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 6e-04 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 6e-04 | ||
| 4hvd_A | 314 | Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h | 6e-04 | ||
| 2oh4_A | 316 | Crystal Structure Of Vegfr2 With A Benzimidazole-Ur | 6e-04 | ||
| 4gt4_A | 308 | Structure Of Unliganded, Inactive Ror2 Kinase Domai | 7e-04 | ||
| 3zzw_A | 289 | Crystal Structure Of The Kinase Domain Of Ror2 Leng | 7e-04 | ||
| 3lcd_A | 329 | Inhibitor Bound To A Dfg-In Structure Of The Kinase | 7e-04 | ||
| 3cjg_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 7e-04 | ||
| 3pjc_A | 315 | Crystal Structure Of Jak3 Complexed With A Potent A | 7e-04 | ||
| 1ir3_A | 306 | Phosphorylated Insulin Receptor Tyrosine Kinase In | 7e-04 | ||
| 1ook_G | 290 | Crystal Structure Of The Complex Of Platelet Recept | 7e-04 | ||
| 3cjf_A | 309 | Crystal Structure Of Vegfr2 In Complex With A 3,4,5 | 7e-04 | ||
| 3lxk_A | 327 | Structural And Thermodynamic Characterization Of Th | 8e-04 | ||
| 1irk_A | 306 | Crystal Structure Of The Tyrosine Kinase Domain Of | 8e-04 | ||
| 2z8c_A | 303 | Phosphorylated Insulin Receptor Tyrosine Kinase In | 8e-04 | ||
| 3pmh_G | 290 | Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib | 8e-04 | ||
| 1i44_A | 306 | Crystallographic Studies Of An Activation Loop Muta | 8e-04 | ||
| 2qo7_A | 373 | Human Epha3 Kinase And Juxtamembrane Region, Dephos | 8e-04 | ||
| 1yvj_A | 290 | Crystal Structure Of The Jak3 Kinase Domain In Comp | 8e-04 | ||
| 2pz5_A | 324 | Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase D | 8e-04 | ||
| 2r4b_A | 321 | Erbb4 Kinase Domain Complexed With A Thienopyrimidi | 8e-04 | ||
| 1rqq_A | 306 | Crystal Structure Of The Insulin Receptor Kinase In | 9e-04 | ||
| 1p14_A | 306 | Crystal Structure Of A Catalytic-Loop Mutant Of The | 9e-04 |
| >pdb|3TL8|A Chain A, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector Length = 349 | Back alignment and structure |
|
| >pdb|3UIM|A Chain A, Structural Basis For The Impact Of Phosphorylation On Plant Receptor- Like Kinase Bak1 Activation Length = 326 | Back alignment and structure |
| >pdb|2QKW|B Chain B, Structural Basis For Activation Of Plant Immunity By Bacterial Effector Protein Avrpto Length = 321 | Back alignment and structure |
| >pdb|3HGK|A Chain A, Crystal Structure Of Effect Protein Avrptob Complexed With Kinase Pto Length = 327 | Back alignment and structure |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|2OIB|A Chain A, Crystal Structure Of Irak4 Kinase Domain Apo Form Length = 301 | Back alignment and structure |
| >pdb|2NRU|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
| >pdb|2O8Y|A Chain A, Apo Irak4 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|3QGW|A Chain A, Crystal Structure Of Itk Kinase Bound To An Inhibitor Length = 286 | Back alignment and structure |
| >pdb|4HCT|A Chain A, Crystal Structure Of Itk In Complex With Compound 52 Length = 269 | Back alignment and structure |
| >pdb|3QRJ|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain T315i Mutant In Complex With Dcc-2036 Length = 277 | Back alignment and structure |
| >pdb|3MIY|A Chain A, X-Ray Crystal Structure Of Itk Complexed With Sunitinib Length = 266 | Back alignment and structure |
| >pdb|1SM2|A Chain A, Crystal Structure Of The Phosphorylated Interleukin-2 Tyrosine Kinase Catalytic Domain Length = 264 | Back alignment and structure |
| >pdb|3V5J|A Chain A, Crystal Structure Of Interleukin-2 Inducible T-Cell Kinase Itk Catalytic Domain With Thienopyrazolylindole Inhibitor 090 Length = 266 | Back alignment and structure |
| >pdb|3QRI|A Chain A, The Crystal Structure Of Human Abl1 Kinase Domain In Complex With Dcc- 2036 Length = 277 | Back alignment and structure |
| >pdb|2V7A|A Chain A, Crystal Structure Of The T315i Abl Mutant In Complex With The Inhibitor Pha-739358 Length = 286 | Back alignment and structure |
| >pdb|2HZ0|A Chain A, Abl Kinase Domain In Complex With Nvp-Aeg082 Length = 270 | Back alignment and structure |
| >pdb|2GQG|A Chain A, X-Ray Crystal Structure Of Dasatinib (Bms-354825) Bound To Activated Abl Kinase Domain Length = 278 | Back alignment and structure |
| >pdb|2HZI|A Chain A, Abl Kinase Domain In Complex With Pd180970 Length = 277 | Back alignment and structure |
| >pdb|2HYY|A Chain A, Human Abl Kinase Domain In Complex With Imatinib (Sti571, Glivec) Length = 273 | Back alignment and structure |
| >pdb|2G2F|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3OY3|A Chain A, Crystal Structure Of Abl T315i Mutant Kinase Domain Bound With A Dfg- Out Inhibitor Ap24589 Length = 284 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|2F4J|A Chain A, Structure Of The Kinase Domain Of An Imatinib-Resistant Abl Mutant In Complex With The Aurora Kinase Inhibitor Vx-680 Length = 287 | Back alignment and structure |
| >pdb|1FPU|A Chain A, Crystal Structure Of Abl Kinase Domain In Complex With A Small Molecule Inhibitor Length = 293 | Back alignment and structure |
| >pdb|2Z60|A Chain A, Crystal Structure Of The T315i Mutant Of Abl Kinase Bound With Ppy-A Length = 288 | Back alignment and structure |
| >pdb|3OXZ|A Chain A, Crystal Structure Of Abl Kinase Domain Bound With A Dfg-Out Inhibitor Ap24534 Length = 284 | Back alignment and structure |
| >pdb|2G1T|A Chain A, A Src-Like Inactive Conformation In The Abl Tyrosine Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|2E2B|A Chain A, Crystal Structure Of The C-Abl Kinase Domain In Complex With Inno-406 Length = 293 | Back alignment and structure |
| >pdb|2HIW|A Chain A, Crystal Structure Of Inactive Conformation Abl Kinase Catalytic Domain Complexed With Type Ii Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3PYY|A Chain A, Discovery And Characterization Of A Cell-Permeable, Small-Molecule C- Abl Kinase Activator That Binds To The Myristoyl Binding Site Length = 298 | Back alignment and structure |
| >pdb|2QOH|A Chain A, Crystal Structure Of Abl Kinase Bound With Ppy-a Length = 288 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|3T9T|A Chain A, Crystal Structure Of Btk Mutant (F435t,K596r) Complexed With Imidazo[1,5-A]quinoxaline Length = 267 | Back alignment and structure |
| >pdb|3DK7|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 277 | Back alignment and structure |
| >pdb|3DK3|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|3DK6|A Chain A, Crystal Structure Of Mutant Abl Kinase Domain In Complex With Small Molecule Fragment Length = 293 | Back alignment and structure |
| >pdb|4GT5|A Chain A, Crystal Structure Of The Inactive Trka Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4F0I|A Chain A, Crystal Structure Of Apo Trka Length = 300 | Back alignment and structure |
| >pdb|3SXR|A Chain A, Crystal Structure Of Bmx Non-Receptor Tyrosine Kinase Complex With Dasatinib Length = 268 | Back alignment and structure |
| >pdb|4AOJ|A Chain A, Human Trka In Complex With The Inhibitor Az-23 Length = 329 | Back alignment and structure |
| >pdb|3GVU|A Chain A, The Crystal Structure Of Human Abl2 In Complex With Gleevec Length = 292 | Back alignment and structure |
| >pdb|3PIX|A Chain A, Crystal Structure Of Btk Kinase Domain Complexed With 2-Isopropyl-7- (4-Methyl-Piperazin-1-Yl)-4-(5-Methyl-2h-Pyrazol-3- Ylamino)-2h- Phthalazin-1-One Length = 274 | Back alignment and structure |
| >pdb|4F1M|A Chain A, Crystal Structure Of The G1179s Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|4F1O|A Chain A, Crystal Structure Of The L1180t Mutant Roco4 Kinase Domain From D. Discoideum Bound To Appcp Length = 287 | Back alignment and structure |
| >pdb|4F0F|A Chain A, Crystal Structure Of The Roco4 Kinase Domain Bound To Appcp From D. Discoideum Length = 287 | Back alignment and structure |
| >pdb|3GEN|A Chain A, The 1.6 A Crystal Structure Of Human Bruton's Tyrosine Kinase Bound To A Pyrrolopyrimidine-Containing Compound Length = 283 | Back alignment and structure |
| >pdb|3K54|A Chain A, Structures Of Human Bruton's Tyrosine Kinase In Active And Inactive Conformations Suggests A Mechanism Of Activation For Tec Family Kinases Length = 283 | Back alignment and structure |
| >pdb|4ASZ|A Chain A, Crystal Structure Of Apo Trkb Kinase Domain Length = 299 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|1YI6|A Chain A, C-Term Tail Segment Of Human Tyrosine Kinase (258-533) Length = 276 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|2BDF|A Chain A, Src Kinase In Complex With Inhibitor Ap23451 Length = 279 | Back alignment and structure |
| >pdb|3U4W|A Chain A, Src In Complex With Dna-Templated Macrocyclic Inhibitor Mc4b Length = 275 | Back alignment and structure |
| >pdb|3D7U|B Chain B, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 277 | Back alignment and structure |
| >pdb|3DQW|A Chain A, C-Src Kinase Domain Thr338ile Mutant In Complex With Atpgs Length = 286 | Back alignment and structure |
| >pdb|3G6H|A Chain A, Src Thr338ile Inhibited In The Dfg-Asp-Out Conformation Length = 286 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3SVV|A Chain A, Crystal Structure Of T338c C-Src Covalently Bound To Vinylsulfonamide- Pyrazolopyrimidine 9 Length = 286 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|2OIQ|A Chain A, Crystal Structure Of Chicken C-Src Kinase Domain In Complex With The Cancer Drug Imatinib. Length = 286 | Back alignment and structure |
| >pdb|3GEQ|A Chain A, Structural Basis For The Chemical Rescue Of Src Kinase Activity Length = 286 | Back alignment and structure |
| >pdb|2QQ7|A Chain A, Crystal Structure Of Drug Resistant Src Kinase Domain With Irreversible Inhibitor Length = 286 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|2HWO|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Covalent Inhibitor Length = 286 | Back alignment and structure |
| >pdb|3V5Q|A Chain A, Discovery Of A Selective Trk Inhibitor With Efficacy In Rodent Cancer Tumor Models Length = 297 | Back alignment and structure |
| >pdb|2OO8|X Chain X, Synthesis, Structural Analysis, And Sar Studies Of Triazine Derivatives As Potent, Selective Tie-2 Inhibitors Length = 317 | Back alignment and structure |
| >pdb|2WQB|A Chain A, Structure Of The Tie2 Kinase Domain In Complex With A Thiazolopyrimidine Inhibitor Length = 324 | Back alignment and structure |
| >pdb|1FVR|A Chain A, Tie2 Kinase Domain Length = 327 | Back alignment and structure |
| >pdb|3OEZ|A Chain A, Crystal Structure Of The L317i Mutant Of The Chicken C-Src Tyrosine Kinase Domain Complexed With Imatinib Length = 286 | Back alignment and structure |
| >pdb|1K2P|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Domain Length = 263 | Back alignment and structure |
| >pdb|1YOJ|A Chain A, Crystal Structure Of Src Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3P08|A Chain A, Crystal Structure Of The Human Btk Kinase Domain Length = 267 | Back alignment and structure |
| >pdb|3OCT|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase Mutant V555r In Complex With Dasatinib Length = 265 | Back alignment and structure |
| >pdb|1YOL|A Chain A, Crystal Structure Of Src Kinase Domain In Complex With Cgp77675 Length = 283 | Back alignment and structure |
| >pdb|3OCS|A Chain A, Crystal Structure Of Bruton's Tyrosine Kinase In Complex With Inhibitor Cgi1746 Length = 271 | Back alignment and structure |
| >pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 | Back alignment and structure |
| >pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 | Back alignment and structure |
| >pdb|1LUF|A Chain A, Crystal Structure Of The Musk Tyrosine Kinase: Insights Into Receptor Autoregulation Length = 343 | Back alignment and structure |
| >pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 | Back alignment and structure |
| >pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 | Back alignment and structure |
| >pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 | Back alignment and structure |
| >pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 | Back alignment and structure |
| >pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 | Back alignment and structure |
| >pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 | Back alignment and structure |
| >pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 | Back alignment and structure |
| >pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 | Back alignment and structure |
| >pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 | Back alignment and structure |
| >pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 | Back alignment and structure |
| >pdb|1MQB|A Chain A, Crystal Structure Of Ephrin A2 (Epha2) Receptor Protein Kinase Length = 333 | Back alignment and structure |
| >pdb|3HNG|A Chain A, Crystal Structure Of Vegfr1 In Complex With N-(4-chlorophenyl)-2- ((pyridin-4-ylmethyl)amino)benzamide Length = 360 | Back alignment and structure |
| >pdb|3O23|A Chain A, Human Unphosphorylated Igf1-R Kinase Domain In Complex With An Hydantoin Inhibitor Length = 305 | Back alignment and structure |
| >pdb|2OFU|A Chain A, X-Ray Crystal Structure Of 2-Aminopyrimidine Carbamate 43 Bound To Lck Length = 273 | Back alignment and structure |
| >pdb|3LCK|A Chain A, The Kinase Domain Of Human Lymphocyte Kinase (Lck), Activated Form (Auto-Phosphorylated On Tyr394) Length = 271 | Back alignment and structure |
| >pdb|2OF2|A Chain A, Crystal Structure Of Furanopyrimidine 8 Bound To Lck Length = 271 | Back alignment and structure |
| >pdb|3BYM|A Chain A, X-Ray Co-Crystal Structure Aminobenzimidazole Triazine 1 Bound To Lck Length = 272 | Back alignment and structure |
| >pdb|2IVT|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Length = 314 | Back alignment and structure |
| >pdb|3MPM|A Chain A, Lck Complexed With A Pyrazolopyrimidine Length = 267 | Back alignment and structure |
| >pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 | Back alignment and structure |
| >pdb|2OFV|A Chain A, Crystal Structure Of Aminoquinazoline 1 Bound To Lck Length = 277 | Back alignment and structure |
| >pdb|2IVV|A Chain A, Crystal Structure Of Phosphorylated Ret Tyrosine Kinase Domain Complexed With The Inhibitor Pp1 Length = 314 | Back alignment and structure |
| >pdb|3KMM|A Chain A, Structure Of Human Lck Kinase With A Small Molecule Inhibitor Length = 288 | Back alignment and structure |
| >pdb|3BYS|A Chain A, Co-Crystal Structure Of Lck And Aminopyrimidine Amide 10b Length = 277 | Back alignment and structure |
| >pdb|2OG8|A Chain A, Crystal Structure Of Aminoquinazoline 36 Bound To Lck Length = 265 | Back alignment and structure |
| >pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 | Back alignment and structure |
| >pdb|2ZV7|A Chain A, Lyn Tyrosine Kinase Domain, Apo Form Length = 279 | Back alignment and structure |
| >pdb|2IVS|A Chain A, Crystal Structure Of Non-Phosphorylated Ret Tyrosine Kinase Domain Length = 314 | Back alignment and structure |
| >pdb|1QPE|A Chain A, Structural Analysis Of The Lymphocyte-Specific Kinase Lck In Complex With Non-Selective And Src Family Selective Kinase Inhibitors Length = 279 | Back alignment and structure |
| >pdb|2ZM1|A Chain A, Crystal Structure Of Imidazo Pyrazin 1 Bound To The Kinase Domain Of Human Lck, (Auto-Phosphorylated On Tyr394) Length = 285 | Back alignment and structure |
| >pdb|3KXZ|A Chain A, The Complex Crystal Structure Of Lck With A Probe Molecule W259 Length = 287 | Back alignment and structure |
| >pdb|1P4O|A Chain A, Structure Of Apo Unactivated Igf-1r Kinase Domain At 1.5a Resolution. Length = 322 | Back alignment and structure |
| >pdb|3LW0|A Chain A, Igf-1rk In Complex With Ligand Msc1609119a-1 Length = 304 | Back alignment and structure |
| >pdb|2PL0|A Chain A, Lck Bound To Imatinib Length = 289 | Back alignment and structure |
| >pdb|3I81|A Chain A, Crystal Structure Of Insulin-Like Growth Factor 1 Receptor (Igf-1r-Wt) Complex With Bms-754807 [1-(4-((5-Cyclopropyl- 1h-Pyrazol-3-Yl)amino)pyrrolo[2,1-F][1,2, 4]triazin-2-Yl)-N- (6-Fluoro-3-Pyridinyl)-2-Methyl-L-Prolinamide] Length = 315 | Back alignment and structure |
| >pdb|2DQ7|X Chain X, Crystal Structure Of Fyn Kinase Domain Complexed With Staurosporine Length = 283 | Back alignment and structure |
| >pdb|2ZM3|A Chain A, Complex Structure Of Insulin-Like Growth Factor Receptor And Isoquinolinedione Inhibitor Length = 308 | Back alignment and structure |
| >pdb|1M7N|A Chain A, Crystal Structure Of Unactivated Apo Insulin-Like Growth Factor-1 Receptor Kinase Domain Length = 322 | Back alignment and structure |
| >pdb|3LVP|A Chain A, Crystal Structure Of Bisphosphorylated Igf1-R Kinase Domain (2p) In Complex With A Bis-Azaindole Inhibitor Length = 336 | Back alignment and structure |
| >pdb|3D94|A Chain A, Crystal Structure Of The Insulin-Like Growth Factor-1 Receptor Kinase In Complex With Pqip Length = 301 | Back alignment and structure |
| >pdb|2OJ9|A Chain A, Structure Of Igf-1r Kinase Domain Complexed With A Benzimidazole Inhibitor Length = 307 | Back alignment and structure |
| >pdb|1K3A|A Chain A, Structure Of The Insulin-Like Growth Factor 1 Receptor Kinase Length = 299 | Back alignment and structure |
| >pdb|1JQH|A Chain A, Igf-1 Receptor Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|4FNW|A Chain A, Crystal Structure Of The Apo F1174l Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|3QQU|A Chain A, Cocrystal Structure Of Unphosphorylated Igf With Pyrimidine 8 Length = 301 | Back alignment and structure |
| >pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 | Back alignment and structure |
| >pdb|2YJR|A Chain A, Structure Of F1174l Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 | Back alignment and structure |
| >pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 | Back alignment and structure |
| >pdb|4DCE|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With A Piperidine-Carboxamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|3A4O|X Chain X, Lyn Kinase Domain Length = 286 | Back alignment and structure |
| >pdb|4FNZ|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Piperidine-Carboxamide Inhibitor 2 Length = 327 | Back alignment and structure |
| >pdb|1QPD|A Chain A, Structural Analysis Of The Lymphocyte-specific Kinase Lck In Complex With Non-selective And Src Family Selective Kinase Inhibitors Length = 279 | Back alignment and structure |
| >pdb|4FNX|A Chain A, Crystal Structure Of The Apo R1275q Anaplastic Lymphoma Kinase Catalytic Domain Length = 327 | Back alignment and structure |
| >pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 | Back alignment and structure |
| >pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 | Back alignment and structure |
| >pdb|2QOI|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f Double Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOO|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742f Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2YFX|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase In Complex With Crizotinib Length = 327 | Back alignment and structure |
| >pdb|2YHV|A Chain A, Structure Of L1196m Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|2QOL|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596:y602:s768g Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2QOK|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:s768a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|2XP2|A Chain A, Structure Of The Human Anaplastic Lymphoma Kinase In Complex With Crizotinib (Pf-02341066) Length = 327 | Back alignment and structure |
| >pdb|2QOF|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f Mutant Length = 373 | Back alignment and structure |
| >pdb|2XB7|A Chain A, Structure Of Human Anaplastic Lymphoma Kinase In Complex With Nvp- Tae684 Length = 315 | Back alignment and structure |
| >pdb|3L9P|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 367 | Back alignment and structure |
| >pdb|3AOX|A Chain A, X-Ray Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Ch5424802 Length = 344 | Back alignment and structure |
| >pdb|3LCT|A Chain A, Crystal Structure Of The Anaplastic Lymphoma Kinase Catalytic Domain Length = 344 | Back alignment and structure |
| >pdb|4FOB|A Chain A, Crystal Structure Of Human Anaplastic Lymphoma Kinase In Complex With Acyliminobenzimidazole Inhibitor 1 Length = 353 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|2YJS|A Chain A, Structure Of C1156y Mutant Anaplastic Lymphoma Kinase Length = 342 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|4GG5|A Chain A, Crystal Structure Of Cmet In Complex With Novel Inhibitor Length = 319 | Back alignment and structure |
| >pdb|3FXX|A Chain A, Human Epha3 Kinase And Juxtamembrane Region Bound To Substrate Kqwdnye[ptyr]iw Length = 371 | Back alignment and structure |
| >pdb|2G15|A Chain A, Structural Characterization Of Autoinhibited C-Met Kinase Length = 318 | Back alignment and structure |
| >pdb|2VWU|A Chain A, Ephb4 Kinase Domain Inhibitor Complex Length = 302 | Back alignment and structure |
| >pdb|3Q6W|A Chain A, Structure Of Dually-phosphorylated Met Receptor Kinase In Complex With An Mk-2461 Analog With Specificity For The Activated Receptor Length = 307 | Back alignment and structure |
| >pdb|3C1X|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Pyrrolotriazine Based Inhibitor Length = 373 | Back alignment and structure |
| >pdb|1R0P|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With The Microbial Alkaloid K-252a Length = 312 | Back alignment and structure |
| >pdb|2QOD|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y602f Mutant Length = 373 | Back alignment and structure |
| >pdb|4AW5|A Chain A, Complex Of The Ephb4 Kinase Domain With An Oxindole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|3A4P|A Chain A, Human C-Met Kinase Domain Complexed With 6-Benzyloxyquinoline Inhibitor Length = 319 | Back alignment and structure |
| >pdb|2GSF|A Chain A, The Human Epha3 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 373 | Back alignment and structure |
| >pdb|3QTI|A Chain A, C-Met Kinase In Complex With Nvp-Bvu972 Length = 314 | Back alignment and structure |
| >pdb|3CTH|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Hepatocyte Growth Factor Receptor C-Met In Complex With A Aminopyridine Based Inhibitor Length = 314 | Back alignment and structure |
| >pdb|3Q6U|A Chain A, Structure Of The Apo Met Receptor Kinase In The Dually-Phosphorylated, Activated State Length = 308 | Back alignment and structure |
| >pdb|3DKG|A Chain A, Sgx Clone 5698a109kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|2RFN|A Chain A, X-ray Structure Of C-met With Inhibitor. Length = 310 | Back alignment and structure |
| >pdb|2WD1|A Chain A, Human C-Met Kinase In Complex With Azaindole Inhibitor Length = 292 | Back alignment and structure |
| >pdb|3F66|A Chain A, Human C-Met Kinase In Complex With Quinoxaline Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2WGJ|A Chain A, X-Ray Structure Of Pf-02341066 Bound To The Kinase Domain Of C-Met Length = 306 | Back alignment and structure |
| >pdb|3I5N|A Chain A, Crystal Structure Of C-Met With Triazolopyridazine Inhibitor 13 Length = 309 | Back alignment and structure |
| >pdb|3DKC|A Chain A, Sgx Clone 5698a65kfg1h1 Length = 317 | Back alignment and structure |
| >pdb|2HK5|A Chain A, Hck Kinase In Complex With Lck Targetted Inhibitor Pg- 1009247 Length = 270 | Back alignment and structure |
| >pdb|2QON|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Y596f:y602f:y742a Triple Mutant Length = 373 | Back alignment and structure |
| >pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 | Back alignment and structure |
| >pdb|3LQ8|A Chain A, Structure Of The Kinase Domain Of C-Met Bound To Xl880 (Gsk1 Length = 302 | Back alignment and structure |
| >pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 | Back alignment and structure |
| >pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 | Back alignment and structure |
| >pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 | Back alignment and structure |
| >pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 | Back alignment and structure |
| >pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|2I1M|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With An Arylamide Inhibitor Length = 333 | Back alignment and structure |
| >pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 | Back alignment and structure |
| >pdb|3BEA|A Chain A, Cfms Tyrosine Kinase (Tie2 Kid) In Complex With A Pyrimidinopyridone Inhibitor Length = 333 | Back alignment and structure |
| >pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 | Back alignment and structure |
| >pdb|3LCO|A Chain A, Inhibitor Bound To A Dfg-Out Structure Of The Kinase Domain Of Csf-1r Length = 324 | Back alignment and structure |
| >pdb|2HEN|A Chain A, Crystal Structure Of The Ephb2 Receptor Kinase Domain In Complex With Adp Length = 286 | Back alignment and structure |
| >pdb|2OGV|A Chain A, Crystal Structure Of The Autoinhibited Human C-Fms Kinase Domain Length = 317 | Back alignment and structure |
| >pdb|1JPA|A Chain A, Crystal Structure Of Unphosphorylated Ephb2 Receptor Tyrosine Kinase And Juxtamembrane Region Length = 312 | Back alignment and structure |
| >pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 | Back alignment and structure |
| >pdb|2I0V|A Chain A, C-Fms Tyrosine Kinase In Complex With A Quinolone Inhibitor Length = 335 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 | Back alignment and structure |
| >pdb|2OH4|A Chain A, Crystal Structure Of Vegfr2 With A Benzimidazole-Urea Inhibitor Length = 316 | Back alignment and structure |
| >pdb|4GT4|A Chain A, Structure Of Unliganded, Inactive Ror2 Kinase Domain Length = 308 | Back alignment and structure |
| >pdb|3ZZW|A Chain A, Crystal Structure Of The Kinase Domain Of Ror2 Length = 289 | Back alignment and structure |
| >pdb|3LCD|A Chain A, Inhibitor Bound To A Dfg-In Structure Of The Kinase Domain Of Csf-1r Length = 329 | Back alignment and structure |
| >pdb|3CJG|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 | Back alignment and structure |
| >pdb|1IR3|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With Peptide Substrate And Atp Analog Length = 306 | Back alignment and structure |
| >pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 | Back alignment and structure |
| >pdb|3CJF|A Chain A, Crystal Structure Of Vegfr2 In Complex With A 3,4,5-Trimethoxy Aniline Containing Pyrimidine Length = 309 | Back alignment and structure |
| >pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 | Back alignment and structure |
| >pdb|1IRK|A Chain A, Crystal Structure Of The Tyrosine Kinase Domain Of The Human Insulin Receptor Length = 306 | Back alignment and structure |
| >pdb|2Z8C|A Chain A, Phosphorylated Insulin Receptor Tyrosine Kinase In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin-2- Yl]amino}phenyl)acetic Acid Length = 303 | Back alignment and structure |
| >pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 | Back alignment and structure |
| >pdb|1I44|A Chain A, Crystallographic Studies Of An Activation Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 | Back alignment and structure |
| >pdb|2QO7|A Chain A, Human Epha3 Kinase And Juxtamembrane Region, Dephosphorylated, Amp-Pnp Bound Length = 373 | Back alignment and structure |
| >pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 | Back alignment and structure |
| >pdb|2PZ5|A Chain A, Crystal Strucure Of Fgf Receptor 2 (Fgfr2) Kinase Domain Harboring The Pathogenic N549t Mutation Responsible For Pfeiffer Syndrome Length = 324 | Back alignment and structure |
| >pdb|2R4B|A Chain A, Erbb4 Kinase Domain Complexed With A Thienopyrimidine Inhibitor Length = 321 | Back alignment and structure |
| >pdb|1RQQ|A Chain A, Crystal Structure Of The Insulin Receptor Kinase In Complex With The Sh2 Domain Of Aps Length = 306 | Back alignment and structure |
| >pdb|1P14|A Chain A, Crystal Structure Of A Catalytic-Loop Mutant Of The Insulin Receptor Tyrosine Kinase Length = 306 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 713 | |||
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 4e-79 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 5e-31 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 7e-24 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-66 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-64 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-60 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-58 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-26 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-25 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 3e-59 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-48 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-47 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-42 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-35 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-27 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-22 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-05 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 3e-48 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-47 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-43 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-40 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-39 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-20 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 2e-46 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-44 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-34 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-21 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-44 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-39 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-36 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-34 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-27 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-16 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-40 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-39 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-38 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-38 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-36 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-35 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-37 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-30 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-36 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-34 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-34 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-36 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-34 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-33 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-31 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-31 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 8e-35 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-33 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-24 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-34 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-33 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 6e-21 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 5e-10 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 1e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-33 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-25 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-23 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-33 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-31 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-26 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-24 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-19 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 9e-33 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-32 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-25 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-32 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-23 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 7e-12 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-07 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-32 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-31 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-29 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-26 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-17 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-11 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-30 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-29 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-30 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-24 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-14 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 6e-30 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 3e-27 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-23 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-23 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-12 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-30 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-29 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 6e-15 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-29 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 3e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-29 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 4e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-27 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-27 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-26 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-24 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 9e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-27 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-25 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-24 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 7e-27 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 6e-23 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 4e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-26 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-24 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-23 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-22 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-20 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-25 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-25 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-24 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 5e-07 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-25 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-24 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 8e-21 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-19 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-08 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 2e-24 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-23 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-23 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-22 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-22 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-21 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-23 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 5e-21 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 7e-20 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-15 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-05 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 2e-23 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-21 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-19 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 2e-21 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 2e-21 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-21 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-17 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 5e-14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-20 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-15 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-06 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 4e-20 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-20 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-15 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-14 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-12 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-11 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-05 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 5e-20 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 9e-20 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-16 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 2e-19 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 4e-19 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 1e-18 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 1e-18 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 2e-18 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 3e-18 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 4e-18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-18 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-16 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-15 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-13 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-10 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-10 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 5e-18 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-18 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-17 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-14 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-10 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 7e-18 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 8e-18 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-17 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-17 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-13 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 5e-06 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 2e-17 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 2e-17 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 2e-17 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 2e-17 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 2e-17 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-17 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 9e-15 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 5e-17 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 5e-17 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 8e-17 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-12 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-11 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-09 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 8e-17 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 1e-16 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 1e-16 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 1e-16 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 2e-16 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-16 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-12 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-11 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 3e-16 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 4e-16 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 5e-16 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 6e-16 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 6e-16 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 6e-16 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 1e-15 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-15 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 7e-10 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 9e-10 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 8e-16 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 8e-16 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 8e-16 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 9e-16 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 5e-14 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-07 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 6e-06 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 9e-16 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 1e-15 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 1e-15 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 1e-15 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 1e-15 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 1e-15 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 2e-15 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 2e-15 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 2e-15 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 2e-15 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 2e-15 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-15 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 3e-15 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 4e-15 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 4e-15 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 4e-15 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 4e-15 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 4e-15 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 6e-15 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 7e-15 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 7e-15 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 7e-15 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 8e-15 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 8e-15 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 1e-14 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 1e-14 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 2e-14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-11 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 1e-07 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 5e-14 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 9e-14 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 2e-13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 6e-13 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 5e-12 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 7e-13 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-12 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 8e-10 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-12 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 1e-11 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-10 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-09 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 3e-05 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 3e-12 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 6e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-10 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 7e-11 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 9e-11 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-10 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-10 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 4e-07 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 2e-06 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 2e-10 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 3e-10 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 4e-10 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 4e-10 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 5e-10 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 5e-10 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 7e-10 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 8e-10 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 9e-10 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 9e-10 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 1e-09 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-09 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 2e-09 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 3e-09 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 4e-07 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 6e-06 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 3e-09 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 3e-09 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 3e-09 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 3e-09 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 4e-09 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 5e-09 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 5e-09 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 5e-09 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 6e-09 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 6e-09 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 6e-09 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 6e-09 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 6e-09 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 8e-09 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 8e-09 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 8e-09 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 1e-08 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 1e-08 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 1e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-08 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-07 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 2e-08 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 2e-08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 2e-08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 4e-07 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-08 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 2e-08 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 2e-08 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 3e-08 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 3e-08 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 3e-08 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 3e-08 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 3e-08 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 3e-08 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 4e-08 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 4e-08 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 6e-08 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 5e-07 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-06 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 9e-05 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 6e-08 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 7e-08 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 9e-05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 9e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 8e-08 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 5e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 9e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-05 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-04 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 1e-07 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-07 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 1e-07 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 1e-07 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 1e-07 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 2e-07 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 2e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 1e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-04 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 2e-07 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 3e-07 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 3e-07 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 4e-07 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 4e-07 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 4e-07 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 6e-07 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 7e-07 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 8e-07 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 9e-07 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 1e-06 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-06 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 2e-06 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 2e-06 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 2e-06 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 2e-06 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 2e-06 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 2e-06 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 3e-06 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 3e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 3e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 2e-05 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 3e-06 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 3e-06 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 4e-06 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 5e-06 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 6e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 6e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-05 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 7e-04 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 6e-06 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 6e-06 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 7e-06 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 7e-06 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 9e-06 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 1e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 1e-05 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-04 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 1e-05 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 2e-05 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 2e-05 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 2e-05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 3e-05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 1e-04 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 3e-05 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 4e-05 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 4e-05 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 5e-05 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 6e-05 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 7e-05 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 8e-05 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 9e-05 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 1e-04 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 1e-04 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 1e-04 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 1e-04 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 1e-04 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 1e-04 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 2e-04 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 2e-04 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 2e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 2e-04 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 3e-04 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 3e-04 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 3e-04 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 5e-04 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 5e-04 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 7e-04 |
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
Score = 254 bits (651), Expect = 4e-79
Identities = 89/315 (28%), Positives = 134/315 (42%), Gaps = 15/315 (4%)
Query: 31 ITDPIEVSALRSIKKSLVDDYSKLSNWNRG-DPCTSNWTGVLCFNTTMDDGYLHLRELQL 89
+ +P + AL IKK L + + LS+W D C W GVLC T + L L
Sbjct: 2 LCNPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDL 57
Query: 90 LNLNLSG--NLSPEIGRLSYLTILDFM-WNKISGSIPKEIGNIKSLELLLLNGNELTGSL 146
LNL + + L YL L N + G IP I + L L + ++G++
Sbjct: 58 SGLNLPKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAI 117
Query: 147 PEELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSISGQIPPELSRLPSLVH 206
P+ L + L + N +SG+LP S ++L + N ISG IP L
Sbjct: 118 PDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFT 177
Query: 207 ML-LDNNNLTGYLPPELSELPKLLILQLDNNNFEGTTIPASYSNMSKLLKLSLRNCSLQG 265
+ + N LTG +PP + L L + L N EG + + K+ L SL
Sbjct: 178 SMTISRNRLTGKIPPTFANL-NLAFVDLSRNMLEG-DASVLFGSDKNTQKIHLAKNSLAF 235
Query: 266 PMPDLSRIPNLGYLDLSSNQLNGSIPP--GRLSLNITTIKLSNNKLTGTIPSNFSGLPRL 323
+ + NL LDL +N++ G++P +L + ++ +S N L G IP + L R
Sbjct: 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLK-FLHSLNVSFNNLCGEIPQGGN-LQRF 293
Query: 324 QRLFIANNSLSGSIP 338
ANN P
Sbjct: 294 DVSAYANNKCLCGSP 308
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 713 | |||
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 100.0 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 100.0 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 100.0 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 100.0 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 100.0 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 100.0 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 100.0 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 100.0 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 100.0 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 100.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 100.0 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 100.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 100.0 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 100.0 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 100.0 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 100.0 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 100.0 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.98 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.98 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.98 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.97 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.97 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.97 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.97 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.97 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.97 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.97 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.97 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.97 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.97 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.96 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.96 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.96 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.96 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.96 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.96 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.96 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.96 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.96 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.96 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.96 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.96 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.96 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.95 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.95 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.95 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.95 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.95 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.94 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.94 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.94 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.94 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.93 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.93 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.93 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.93 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.92 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.92 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.91 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.91 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.91 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.9 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.9 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.9 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.9 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.9 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.89 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.88 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.88 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.88 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.88 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.88 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.87 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.87 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.87 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.87 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.86 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.86 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.84 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.84 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.83 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.81 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.81 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.8 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.79 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.79 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.78 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.78 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.78 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.77 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.77 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.76 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.76 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.76 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.75 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.73 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.73 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.73 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.71 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.71 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.71 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.69 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.68 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.68 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.68 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.68 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.67 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.67 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.65 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.65 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.65 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.64 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.63 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.62 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.61 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.6 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.6 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.56 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 99.56 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.56 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.55 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 99.54 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.53 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.52 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.51 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 99.51 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.51 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.51 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.51 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.48 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.48 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.47 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.47 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 99.46 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.46 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.43 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 99.43 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.42 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.41 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.37 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.36 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.34 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.34 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.32 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.3 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.29 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.29 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.28 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.28 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.27 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.24 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.24 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.23 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.22 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.22 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.22 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.21 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.21 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.21 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.21 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.21 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.21 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 99.2 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.2 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.2 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.2 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.2 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.19 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.19 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.19 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.19 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.19 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.19 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.19 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.18 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.18 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.18 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.17 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.17 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.17 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.17 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.17 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.17 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.17 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.16 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.16 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.16 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.16 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.16 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.16 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.15 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.15 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.15 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.15 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.15 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.14 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.14 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.14 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.13 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.13 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.13 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.13 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.13 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.13 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.12 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.12 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.12 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.12 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.12 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.12 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.12 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.11 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.11 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.11 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.11 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.11 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.1 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.1 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.1 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.1 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.1 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.1 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.09 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.09 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.09 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.09 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.09 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.09 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.09 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.09 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.09 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.09 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.08 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.08 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.08 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.08 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.08 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.08 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.07 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.07 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.07 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.07 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.07 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.07 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.07 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.06 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.06 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.06 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.06 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.06 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.06 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.06 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.06 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.06 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.05 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.05 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.05 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.05 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.05 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.05 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.05 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.05 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.05 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.05 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.04 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.04 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.04 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.03 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.03 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.03 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.03 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.03 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.03 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.03 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.03 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.02 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.02 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.02 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.02 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.02 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.02 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.02 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.02 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.02 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.02 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.02 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.01 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.01 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.01 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.01 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.0 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.0 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.0 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.0 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.0 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.0 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.0 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.0 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.99 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 98.99 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 98.99 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 98.99 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 98.99 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 98.98 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 98.98 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 98.98 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 98.98 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 98.97 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 98.97 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 98.97 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 98.96 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 98.95 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 98.94 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 98.94 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 98.94 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 98.94 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 98.94 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.93 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 98.93 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 98.91 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 98.91 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 98.91 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 98.91 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 98.91 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 98.9 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 98.9 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 98.9 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 98.9 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 98.9 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 98.89 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 98.89 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 98.89 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 98.89 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 98.89 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 98.89 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 98.88 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 98.87 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 98.87 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 98.87 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 98.86 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.86 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 98.86 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 98.86 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 98.86 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 98.85 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 98.85 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 98.85 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 98.84 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 98.84 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.84 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 98.84 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 98.83 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 98.83 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 98.83 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 98.83 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 98.82 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 98.82 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 98.81 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 98.81 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 98.8 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 98.8 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 98.8 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 98.79 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 98.79 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 98.78 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 98.77 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 98.77 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.77 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 98.76 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 98.73 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.73 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 98.72 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 98.7 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 98.7 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 98.7 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 98.69 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 98.68 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 98.67 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 98.66 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 98.66 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 98.63 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 98.6 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 98.59 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 98.57 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 98.56 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 98.56 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 98.5 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 98.41 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 98.34 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.31 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.26 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.23 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.16 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 97.97 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 97.73 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 97.69 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.61 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.61 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.12 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 97.1 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 97.1 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.84 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.76 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 96.68 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 96.6 | |
| 2k1k_A | 38 | Ephrin type-A receptor 1; EPHA1, receptor tyrosine | 94.18 | |
| 3f7w_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 93.65 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 92.95 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 92.47 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 92.03 | |
| 2jwa_A | 44 | Receptor tyrosine-protein kinase ERBB-2; transmemb | 90.73 | |
| 3jr1_A | 312 | Putative fructosamine-3-kinase; YP_719053.1, struc | 90.56 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 89.32 | |
| 2olc_A | 397 | MTR kinase, methylthioribose kinase; kinase ADP-2H | 88.61 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 86.58 | |
| 3ovc_A | 362 | Hygromycin-B 4-O-kinase; aminoglycoside phosphotra | 84.01 | |
| 3r70_A | 320 | Aminoglycoside phosphotransferase; structural geno | 83.55 |
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.3e-42 Score=404.55 Aligned_cols=339 Identities=26% Similarity=0.397 Sum_probs=296.3
Q ss_pred CCCCHHHHHHHHHHHHhCCCCCCCCCCCCCC-CCCCCCCceeecCCCCCCCCCcceeEEEcCCCCCccc---cC------
Q 005120 30 SITDPIEVSALRSIKKSLVDDYSKLSNWNRG-DPCTSNWTGVLCFNTTMDDGYLHLRELQLLNLNLSGN---LS------ 99 (713)
Q Consensus 30 ~~~~~~~~~~l~~~~~~~~~~~~~l~~w~~~-~~C~~~w~gv~C~~~~~~~~~~~l~~L~l~~~~l~~~---~~------ 99 (713)
..+.+.|++||++||+.+.|+. .+.+|... |+| .|.||+|+. .+|+.|+|+++.+.|. ++
T Consensus 7 ~~~~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C--~w~gv~C~~-------~~v~~L~L~~~~l~g~~~~l~~~l~~L 76 (768)
T 3rgz_A 7 SQSLYREIHQLISFKDVLPDKN-LLPDWSSNKNPC--TFDGVTCRD-------DKVTSIDLSSKPLNVGFSAVSSSLLSL 76 (768)
T ss_dssp -CCHHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGG--GSTTEEEET-------TEEEEEECTTSCCCEEHHHHHHHTTTC
T ss_pred ccCCHHHHHHHHHHHhhCCCcc-cccCCCCCCCCc--CCcceEECC-------CcEEEEECCCCCcCCccCccChhHhcc
Confidence 3445789999999999999887 89999755 566 799999962 5899999999888876 33
Q ss_pred -----------------ccccCCCCCCEEECCCCCCCcCCCc--cccCCCCCceEecccCCCCCcCCccC-CCCCCCCEE
Q 005120 100 -----------------PEIGRLSYLTILDFMWNKISGSIPK--EIGNIKSLELLLLNGNELTGSLPEEL-GYLPKLDRI 159 (713)
Q Consensus 100 -----------------~~~~~l~~L~~L~Ls~n~i~~~~p~--~~~~l~~L~~L~L~~N~l~~~~p~~~-~~l~~L~~L 159 (713)
+.++.+++|++|+|++|.+++.+|. .++++++|++|+|++|.+++..|..+ .++++|++|
T Consensus 77 ~~L~~l~~~~~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L 156 (768)
T 3rgz_A 77 TGLESLFLSNSHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVL 156 (768)
T ss_dssp TTCCEEECTTSCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEE
T ss_pred CcccccCCcCCCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEE
Confidence 5678889999999999999988888 89999999999999999988888776 889999999
Q ss_pred EccccCCCCCCchh---hhcCCCCCEEEccCCccccccchhcCCCCCccEEecccCCCcCCCCcCCCCCCCCcEEEcccc
Q 005120 160 QIDQNYISGSLPKS---FANLNKTRHFHMNNNSISGQIPPELSRLPSLVHMLLDNNNLTGYLPPELSELPKLLILQLDNN 236 (713)
Q Consensus 160 ~L~~N~l~~~~p~~---~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~l~~~~~~~l~~l~~L~~L~L~~N 236 (713)
+|++|++++..|.. +.++++|++|++++|.+.+..+. ..+++|++|++++|++++.+|. ++.+++|++|++++|
T Consensus 157 ~Ls~n~l~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~--~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n 233 (768)
T 3rgz_A 157 DLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDV--SRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGN 233 (768)
T ss_dssp ECCSSCCEEETHHHHHHTTCCTTCCEEECCSSEEESCCBC--TTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSS
T ss_pred ECCCCccCCcCChhhhhhccCCCCCEEECCCCcccccCCc--ccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCC
Confidence 99999999888877 78899999999999999877654 7899999999999999988877 999999999999999
Q ss_pred cCCCCCCcccccCCCCCCEEEccCCCCccCCCCCCCCCCccEEEccCCCCcccCCCCccc--cCccEEEccCCcCcccCC
Q 005120 237 NFEGTTIPASYSNMSKLLKLSLRNCSLQGPMPDLSRIPNLGYLDLSSNQLNGSIPPGRLS--LNITTIKLSNNKLTGTIP 314 (713)
Q Consensus 237 ~l~~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~l~~l~~L~~L~Ls~N~l~~~ip~~~~~--~~L~~L~Ls~N~l~~~~p 314 (713)
++++ .+|..+.++++|++|++++|++++..|.. .+++|++|++++|.+++.+|..... ++|++|+|++|++++.+|
T Consensus 234 ~l~~-~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~-~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p 311 (768)
T 3rgz_A 234 KLSG-DFSRAISTCTELKLLNISSNQFVGPIPPL-PLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVP 311 (768)
T ss_dssp CCCS-CHHHHTTTCSSCCEEECCSSCCEESCCCC-CCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCC
T ss_pred cCCC-cccHHHhcCCCCCEEECCCCcccCccCcc-ccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccc
Confidence 9997 78999999999999999999999888865 8899999999999999999987655 789999999999999999
Q ss_pred hhccCCcccceeecccccCcccCCch-hhhhccCCCCCccEEEccCCcCCCc-CCCCC-CC-CceEEEecCCCCCCCC
Q 005120 315 SNFSGLPRLQRLFIANNSLSGSIPSS-IWQSRTLNATETFILDFQNNNLTNI-SGSFN-IP-PNVTVRLRGNPFCLNT 388 (713)
Q Consensus 315 ~~~~~l~~L~~L~L~~N~l~~~~p~~-~~~~~~l~~~~L~~L~ls~N~l~~i-~~~~~-~~-~l~~l~l~~N~~~~~~ 388 (713)
..|+.+++|++|++++|+++|.+|.. +. .+++|+.|++++|++++. +..+. ++ +++.|++++|.+.+..
T Consensus 312 ~~~~~l~~L~~L~L~~n~l~~~ip~~~l~-----~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~L~Ls~N~l~~~~ 384 (768)
T 3rgz_A 312 PFFGSCSLLESLALSSNNFSGELPMDTLL-----KMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 384 (768)
T ss_dssp GGGGGCTTCCEEECCSSEEEEECCHHHHT-----TCTTCCEEECCSSEEEECCCTTHHHHTTTCSEEECCSSEEEEEC
T ss_pred hHHhcCCCccEEECCCCcccCcCCHHHHh-----cCCCCCEEeCcCCccCccccHHHHhhhcCCcEEEccCCCcCCCc
Confidence 99999999999999999999999977 66 788999999999999854 44443 44 8899999999887654
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >2k1k_A Ephrin type-A receptor 1; EPHA1, receptor tyrosine kinase, dimeric transmembrane domain, ATP-binding, glycoprotein, nucleotide-binding; NMR {Homo sapiens} PDB: 2k1l_A | Back alignment and structure |
|---|
| >3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jwa_A Receptor tyrosine-protein kinase ERBB-2; transmembrane helix dimer, protein kinase receptor membrane domain, ATP-binding, glycoprotein; NMR {Homo sapiens} PDB: 2ks1_A | Back alignment and structure |
|---|
| >3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 713 | ||||
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 5e-31 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 2e-25 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 8e-25 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 2e-23 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 5e-23 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 8e-23 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 5e-22 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 1e-21 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 2e-21 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 2e-21 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 5e-21 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 8e-21 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 1e-20 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 1e-20 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 2e-20 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 2e-20 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 4e-20 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 7e-20 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 7e-20 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 8e-20 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 1e-19 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-19 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 3e-19 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 5e-19 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 6e-19 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 7e-19 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 2e-18 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 2e-18 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 2e-18 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 3e-18 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 3e-18 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 4e-18 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-18 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-16 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-14 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 3e-07 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 6e-04 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.004 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-18 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 3e-17 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 8e-18 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 2e-17 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 3e-17 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 3e-17 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 7e-17 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 7e-17 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 1e-16 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 3e-16 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 5e-16 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 8e-16 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 1e-15 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 1e-15 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 1e-15 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 2e-15 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 3e-15 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 5e-15 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 7e-15 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 2e-14 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 3e-14 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 3e-14 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 3e-14 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 1e-13 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 2e-13 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 5e-13 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 6e-13 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-12 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 6e-12 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 6e-12 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 9e-12 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 1e-11 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 4e-11 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 1e-09 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 5e-09 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 9e-08 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-06 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 6e-06 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 2e-08 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 7e-08 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 8e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 1e-07 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-06 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 5e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.003 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.004 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 2e-06 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 9e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 8e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 2e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-05 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.001 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 3e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 9e-05 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.003 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 7e-05 | |
| d1h6ta2 | 210 | c.10.2.1 (A:31-240) Internalin B {Listeria monocyt | 2e-04 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 7e-05 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 5e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.002 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 6e-04 | |
| d2ifga3 | 156 | c.10.2.7 (A:36-191) High affinity nerve growth fac | 7e-04 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Score = 121 bits (304), Expect = 5e-31
Identities = 83/334 (24%), Positives = 134/334 (40%), Gaps = 34/334 (10%)
Query: 31 ITDPIEVSALRSIKKSLVDDYSKLSNWNRG-DPCTSNWTGVLCFNTTMDDGYLHLRELQL 89
+ +P + AL IKK L + + LS+W D C W GVLC T + L L
Sbjct: 2 LCNPQDKQALLQIKKDLGNP-TTLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDL 57
Query: 90 LNLNLSGNLSPEIGRLSYLTILDFMWNKISGSIPKEIGNIKSLELLLLNGNE-LTGSLPE 148
LNL IP + N+ L L + G L G +P
Sbjct: 58 SGLNLPKPYP----------------------IPSSLANLPYLNFLYIGGINNLVGPIPP 95
Query: 149 ELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMNNNSISGQIPPELSRLPSLVHML 208
+ L +L + I +SG++P + + + N++SG +PP +S LP+LV +
Sbjct: 96 AIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGIT 155
Query: 209 LDNNNLTGYLPPELSELPKLLILQLDNNNFEGTTIPASYSNMSKLLKLSLRNCSLQGPMP 268
D N ++G +P KL + N IP +++N++ RN
Sbjct: 156 FDGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASV 215
Query: 269 DLSRIPNLGYLDLSSNQLNGSIPPGRLSLNITTIKLSNNKLTGTIPSNFSGLPRLQRLFI 328
N + L+ N L + LS N+ + L NN++ GT+P + L L L +
Sbjct: 216 LFGSDKNTQKIHLAKNSLAFDLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNV 275
Query: 329 ANNSLSGSIPSSIWQSRTLNATETFILDFQNNNL 362
+ N+L G IP + + + + NN
Sbjct: 276 SFNNLCGEIP-QGGNLQRFD-----VSAYANNKC 303
|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 713 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.97 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.94 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.93 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.93 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.93 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.92 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.9 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.89 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.88 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.75 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.75 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.74 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.74 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.73 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.72 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.71 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.7 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.68 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.59 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.58 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.58 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.56 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.55 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.55 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.52 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.52 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.51 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.51 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.5 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.5 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.5 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.49 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.49 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.49 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.48 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.47 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.47 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.47 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.46 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.46 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.45 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.45 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.45 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.44 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.44 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.44 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.44 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.44 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.43 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.43 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.43 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.42 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.42 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.42 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.39 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.39 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.38 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.37 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.36 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.36 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.36 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.34 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.32 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.3 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.29 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.28 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.27 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.26 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.26 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.25 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.25 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.23 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.23 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.21 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.21 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.19 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.18 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.13 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.13 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.12 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.09 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.06 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.06 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.06 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.05 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.04 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 98.92 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 98.92 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 98.84 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.32 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 98.27 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.23 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 98.15 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.46 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.46 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.52 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 96.49 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 90.94 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00 E-value=3.1e-40 Score=345.15 Aligned_cols=295 Identities=30% Similarity=0.490 Sum_probs=237.1
Q ss_pred CCCHHHHHHHHHHHHhCCCCCCCCCCCCCC-CCCCCCCceeecCCCCCCCCCcceeEEEcCCCCCcc--ccCccccCCCC
Q 005120 31 ITDPIEVSALRSIKKSLVDDYSKLSNWNRG-DPCTSNWTGVLCFNTTMDDGYLHLRELQLLNLNLSG--NLSPEIGRLSY 107 (713)
Q Consensus 31 ~~~~~~~~~l~~~~~~~~~~~~~l~~w~~~-~~C~~~w~gv~C~~~~~~~~~~~l~~L~l~~~~l~~--~~~~~~~~l~~ 107 (713)
-|.++|++||++||+.+.++. .+.+|... |+|.+.|.||+|+... ...+|+.|+|++++++| .+|+.++++++
T Consensus 2 ~c~~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~---~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~ 77 (313)
T d1ogqa_ 2 LCNPQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDT---QTYRVNNLDLSGLNLPKPYPIPSSLANLPY 77 (313)
T ss_dssp CSCHHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSS---SCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred CCCHHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCC---CcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence 367899999999999998764 68999754 8886679999997532 34589999999999987 57899999999
Q ss_pred CCEEECCC-CCCCcCCCccccCCCCCceEecccCCCCCcCCccCCCCCCCCEEEccccCCCCCCchhhhcCCCCCEEEcc
Q 005120 108 LTILDFMW-NKISGSIPKEIGNIKSLELLLLNGNELTGSLPEELGYLPKLDRIQIDQNYISGSLPKSFANLNKTRHFHMN 186 (713)
Q Consensus 108 L~~L~Ls~-n~i~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~ 186 (713)
|++|+|++ |+++|.+|.+|+++++|++|+|++|++.+..+..+..+.+|+.+++++|.+.+.+|..+.++++|+.++++
T Consensus 78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~ 157 (313)
T d1ogqa_ 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence 99999986 88999999999999999999999999999999989999999999999999998999999999999999999
Q ss_pred CCccccccchhcCCCCCc-cEEecccCCCcCCCCcCCCCCCCCcEEEcccccCCCCCCcccccCCCCCCEEEccCCCCcc
Q 005120 187 NNSISGQIPPELSRLPSL-VHMLLDNNNLTGYLPPELSELPKLLILQLDNNNFEGTTIPASYSNMSKLLKLSLRNCSLQG 265 (713)
Q Consensus 187 ~N~l~~~~p~~l~~l~~L-~~L~L~~N~l~~~~~~~l~~l~~L~~L~L~~N~l~~~~~~~~~~~l~~L~~L~L~~N~l~~ 265 (713)
+|.+.+.+|..+..+..+ +.+++++|++++..|..+..+..+ .++++.+.+.+ .+|..+..+++|+.+++++|.+.+
T Consensus 158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~~~-~l~l~~~~~~~-~~~~~~~~~~~l~~l~~~~~~l~~ 235 (313)
T d1ogqa_ 158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLA-FVDLSRNMLEG-DASVLFGSDKNTQKIHLAKNSLAF 235 (313)
T ss_dssp SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCCCS-EEECCSSEEEE-CCGGGCCTTSCCSEEECCSSEECC
T ss_pred ccccccccccccccccccccccccccccccccccccccccccc-ccccccccccc-cccccccccccccccccccccccc
Confidence 999998899888887775 788899999988888877766544 68888888877 677777788888888888888777
Q ss_pred CCCCCCCCCCccEEEccCCCCcccCCCCccc-cCccEEEccCCcCcccCChhccCCcccceeeccccc
Q 005120 266 PMPDLSRIPNLGYLDLSSNQLNGSIPPGRLS-LNITTIKLSNNKLTGTIPSNFSGLPRLQRLFIANNS 332 (713)
Q Consensus 266 ~~~~l~~l~~L~~L~Ls~N~l~~~ip~~~~~-~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~~N~ 332 (713)
.++.+..+++|+.|+|++|+++|.+|..+.. ++|++|+|++|+|+|.+|. ++++++|+.+++++|+
T Consensus 236 ~~~~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~ 302 (313)
T d1ogqa_ 236 DLGKVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNK 302 (313)
T ss_dssp BGGGCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSS
T ss_pred cccccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCC-cccCCCCCHHHhCCCc
Confidence 6666666677777777777776666654333 5566666666666655553 4555556666665554
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|