Citrus Sinensis ID: 005133


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
cHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHcccc
***ILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQY*Q******************************************************************************************************************************************************************************************************************PFD**********************************AMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division cycle protein 27 homolog B Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication. Functionally redundant with CDC27A in the control of gametophyte development.confidentQ8LGU6
Cell division cycle protein 27 homolog Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.probableP30260
Cell division cycle protein 27 homolog Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.probableQ4V8A2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FP2, chain A
Confidence level:very confident
Coverage over the Query: 439-708
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 3-170,197-204,240-242,258-261,293-300,314-320,373,416-712
View the alignment between query and template
View the model in PyMOL