Citrus Sinensis ID: 005133

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710---
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
cHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHcccc
cHHHHHHHHHHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHcHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHcccc
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEaalspvnepsaeipngaaGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQnglatqnlylpnedrnlvssksagtedisprqLKHMQAnnlrdipgnyhgAAVSaaaasqplnggpsnasfyntpspittqlsgvappplcrnlqpngpnlnmlgtdsspkstisstiqaprrkfvdegklrkisgrlfsdsgprrstrlageagananmstttvagngttnsskylggsklsSVALRSVTLrkgqswanenidegmrnepfddsrantastvsssfptsdtrsavqegttvpiggtamngsrimtgASDLLGLLRILGEGYRMSCMYRCKDALDVYlklphkhyntgwvLSQVGKAYFEVVDYLEAERAFTLarraspyslegmDIYSTVLYHLKEDMKLSYLAQELittdrlapqswcamgncyslQKDHETALKNFQRAVQlnprfayghtlcgheyvaLEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRmafqisphsSVIMSYLGTAMHALKRSGEAIEMMEKAILadkknplpmyqKANILLSLEKFDEALEVLEELKeyapresgvyalmgch
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKsagtedisprQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGtdsspkstisstiqaprrkfvdegklrkisgrlfsdsgprrstrlageagananmstttvagngttnsskylggsKLSSVALRSVTlrkgqswanenidegmrnepfddSRANTastvsssfptsdtrsavqegttvpiggtamngsrIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTlarraspyslegmDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELkeyapresgVYALMGCH
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGaavsaaaasQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNsskylggsklssVALRSVTLRKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
***ILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAE*************PNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYL*********************************************************************************************************************************************************************************************************************************************AMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPR*SGVYAL****
***ILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSE******************************************************************************************************************************************************************************************************************************PFD**********************************AMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTD************APRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDD**********************QEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQY*Q*****************************************************************************************************************************************************************************************************************************************SAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGCH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query713 2.2.26 [Sep-21-2011]
Q8LGU6744 Cell division cycle prote yes no 0.974 0.934 0.746 0.0
Q06AN9717 Cell division cycle prote no no 0.914 0.909 0.444 1e-173
P30260824 Cell division cycle prote yes no 0.934 0.808 0.341 1e-110
A7Z061825 Cell division cycle prote yes no 0.929 0.803 0.339 1e-109
Q4V8A2824 Cell division cycle prote yes no 0.956 0.827 0.328 1e-108
A2A6Q5825 Cell division cycle prote yes no 0.431 0.373 0.471 8e-90
P17885806 Protein bimA OS=Emericell yes no 0.960 0.849 0.303 1e-82
Q54J83970 Anaphase-promoting comple yes no 0.472 0.347 0.404 2e-75
P10505665 Anaphase-promoting comple yes no 0.374 0.401 0.403 5e-65
P38042758 Anaphase-promoting comple yes no 0.298 0.281 0.338 4e-40
>sp|Q8LGU6|CD27B_ARATH Cell division cycle protein 27 homolog B OS=Arabidopsis thaliana GN=CDC27B PE=1 SV=1 Back     alignment and function desciption
 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/711 (74%), Positives = 605/711 (85%), Gaps = 16/711 (2%)

Query: 1   MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKG 60
           ME +L DCV NSLR+F+Y+NAIF+CERLCAEFPSEVNLQLLAT YLQNNQAY+AY++LKG
Sbjct: 1   MEAMLVDCVNNSLRHFVYKNAIFMCERLCAEFPSEVNLQLLATSYLQNNQAYSAYHLLKG 60

Query: 61  TQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNA 120
           TQMA SRYLFA++C+QMDLL+EAE+AL PVNEP AEIPNGAAGHYL+GLIY+YTDRRKNA
Sbjct: 61  TQMAQSRYLFALSCFQMDLLNEAESALCPVNEPGAEIPNGAAGHYLLGLIYKYTDRRKNA 120

Query: 121 IHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPN 180
              +K +L+IDPLLWAAYEELC+LGAAEEATAVF E AAL IQKQY+Q    +  L   N
Sbjct: 121 AQQFKQSLTIDPLLWAAYEELCILGAAEEATAVFGETAALSIQKQYMQQLSTSLGLNTYN 180

Query: 181 EDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFY 240
           E+RN  S+K+  +ED SPRQ KH Q++ L+DI GN+H         S  +NGG SN SFY
Sbjct: 181 EERNSTSTKNTSSEDYSPRQSKHTQSHGLKDISGNFH---------SHGVNGGVSNMSFY 231

Query: 241 NTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLR 300
           NTPSP+  QLSG+APPPL RN QP   N N L TDSSPKST++ST+QAPRRKFVDEGKLR
Sbjct: 232 NTPSPVAAQLSGIAPPPLFRNFQPAVANPNSLITDSSPKSTVNSTLQAPRRKFVDEGKLR 291

Query: 301 KISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTL 360
           KISGRLFSDSGPRRS+RL+ ++GAN N S  TV+GN   N+SKYLGGSKLSS+ALRSVTL
Sbjct: 292 KISGRLFSDSGPRRSSRLSADSGANINSSVATVSGN-VNNASKYLGGSKLSSLALRSVTL 350

Query: 361 RKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGS 420
           RKG SWANEN+DEG+R EPFDDSR NTAST + S  ++D     QE  T+ IGG AM+  
Sbjct: 351 RKGHSWANENMDEGVRGEPFDDSRPNTAST-TGSMASND-----QEDETMSIGGIAMSSQ 404

Query: 421 RIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVV 480
            I  G S++L LLR LGEG R+S MYRC++ALD Y+KLPHKHYNTGWVLSQVGKAYFE++
Sbjct: 405 TITIGVSEILNLLRTLGEGCRLSYMYRCQEALDTYMKLPHKHYNTGWVLSQVGKAYFELI 464

Query: 481 DYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAM 540
           DYLEAE+AF LAR ASPY LEGMDIYSTVLYHLKEDMKLSYLAQELI+TDRLAPQSWCAM
Sbjct: 465 DYLEAEKAFRLARLASPYCLEGMDIYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAM 524

Query: 541 GNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDAR 600
           GNCYSLQKDHETALKNF RAVQLNPRFAY HTLCGHEY  LEDFENG++SYQ+ALRVD R
Sbjct: 525 GNCYSLQKDHETALKNFLRAVQLNPRFAYAHTLCGHEYTTLEDFENGMKSYQNALRVDTR 584

Query: 601 HYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMME 660
           HYN+WYGLGM+YLRQEK EFSEHHFRMAF I+P SSVIMSYLGT++HALKRS EA+E+ME
Sbjct: 585 HYNAWYGLGMIYLRQEKLEFSEHHFRMAFLINPSSSVIMSYLGTSLHALKRSEEALEIME 644

Query: 661 KAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMG 711
           +AI+AD+KNPLPMYQKANIL+ LE+ DEALEVLEELKEYAP ES VYALMG
Sbjct: 645 QAIVADRKNPLPMYQKANILVCLERLDEALEVLEELKEYAPSESSVYALMG 695
Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex controls several key steps in the cell cycle by mediating ubiquitination and subsequent degradation of target proteins such as cyclins. The APC/C complex is required for the female gametophyte development and is involved in several aspect of development by controlling cell division and cell elongation. Involved in the control of endoreduplication. Functionally redundant with CDC27A in the control of gametophyte development.
Arabidopsis thaliana (taxid: 3702)
>sp|Q06AN9|CD27A_ARATH Cell division cycle protein 27 homolog A OS=Arabidopsis thaliana GN=CDC27A PE=1 SV=2 Back     alignment and function description
>sp|P30260|CDC27_HUMAN Cell division cycle protein 27 homolog OS=Homo sapiens GN=CDC27 PE=1 SV=2 Back     alignment and function description
>sp|A7Z061|CDC27_BOVIN Cell division cycle protein 27 homolog OS=Bos taurus GN=CDC27 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8A2|CDC27_RAT Cell division cycle protein 27 homolog OS=Rattus norvegicus GN=Cdc27 PE=2 SV=1 Back     alignment and function description
>sp|A2A6Q5|CDC27_MOUSE Cell division cycle protein 27 homolog OS=Mus musculus GN=Cdc27 PE=1 SV=1 Back     alignment and function description
>sp|P17885|BIMA_EMENI Protein bimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimA PE=2 SV=1 Back     alignment and function description
>sp|Q54J83|APC3_DICDI Anaphase-promoting complex subunit 3 OS=Dictyostelium discoideum GN=anapc3 PE=3 SV=1 Back     alignment and function description
>sp|P10505|APC3_SCHPO Anaphase-promoting complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nuc2 PE=1 SV=3 Back     alignment and function description
>sp|P38042|CDC27_YEAST Anaphase-promoting complex subunit CDC27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC27 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
225445118761 PREDICTED: cell division cycle protein 2 0.997 0.934 0.785 0.0
224142197760 predicted protein [Populus trichocarpa] 0.997 0.935 0.791 0.0
356526603756 PREDICTED: cell division cycle protein 2 0.991 0.935 0.762 0.0
255546359751 cell division cycle, putative [Ricinus c 0.983 0.933 0.778 0.0
449449531755 PREDICTED: cell division cycle protein 2 0.990 0.935 0.755 0.0
297832142744 hypothetical protein ARALYDRAFT_480470 [ 0.974 0.934 0.749 0.0
356568879756 PREDICTED: cell division cycle protein 2 0.991 0.935 0.760 0.0
30680846744 cell division cycle protein 27-B [Arabid 0.974 0.934 0.746 0.0
149941647753 Cdc27B [Nicotiana tabacum] 0.984 0.932 0.715 0.0
149941649751 Cdc27B [Nicotiana tabacum] 0.984 0.934 0.714 0.0
>gi|225445118|ref|XP_002283828.1| PREDICTED: cell division cycle protein 27 homolog B [Vitis vinifera] gi|297738767|emb|CBI28012.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/712 (78%), Positives = 632/712 (88%), Gaps = 1/712 (0%)

Query: 1   MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKG 60
           ME IL D V  SLR+F++RNAIF+CERLCAEFPSE NLQLLA+CYL NNQAYAAY ILKG
Sbjct: 1   MEAILVDSVLGSLRHFLHRNAIFICERLCAEFPSETNLQLLASCYLHNNQAYAAYYILKG 60

Query: 61  TQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNA 120
           TQMA SRYLFA++C+QMDLL+EAEAAL PVNEP AEIPNGAAGHYL+GLIYRYTDR+K+A
Sbjct: 61  TQMAQSRYLFAISCFQMDLLTEAEAALCPVNEPGAEIPNGAAGHYLLGLIYRYTDRKKSA 120

Query: 121 IHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPN 180
           +HH+K ALS+DPLLWAAYEELC+LGAAEEATAVF EAAALCIQKQ+L +GLA+QNL    
Sbjct: 121 VHHFKQALSLDPLLWAAYEELCLLGAAEEATAVFGEAAALCIQKQHLHHGLASQNLQTSI 180

Query: 181 EDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFY 240
           EDRNLVS ++  +ED+SPRQLKH+ ANNLR+IPGNYHGAA+S A ASQ LN GPS+ +FY
Sbjct: 181 EDRNLVSGRNLSSEDVSPRQLKHIHANNLREIPGNYHGAAMSGATASQSLNSGPSSTAFY 240

Query: 241 NTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLR 300
           NTPSP+  QLSGVAPPPLCRN+Q NG N + +G DSSP+ST++ TIQAPRRKFVDEGKLR
Sbjct: 241 NTPSPMVAQLSGVAPPPLCRNVQQNGLNPSTVGNDSSPRSTVNPTIQAPRRKFVDEGKLR 300

Query: 301 KISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTL 360
           KISGRLFSDSGPRRSTRLAGEAGAN N S TTVAGNGT +SSKYLGG+K SS A RSVT+
Sbjct: 301 KISGRLFSDSGPRRSTRLAGEAGANTNPSGTTVAGNGTIHSSKYLGGAKSSSAAFRSVTV 360

Query: 361 RKGQSWANENIDEGMRNEPFDDSRANT-ASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNG 419
           RKGQ+ ANE+ DEG R E FDDSR+   A+T +S+  + D +S  Q+  T+ IGG   N 
Sbjct: 361 RKGQTLANESFDEGTRQEVFDDSRSYISAATSTSTSTSGDPKSLEQDEATMTIGGVITNT 420

Query: 420 SRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEV 479
           S+I+ GA+++L LLR LGEGYR+SCMYRC+DALDVY+KLPHKHYNTGWVLSQ+GKAYFE+
Sbjct: 421 SKIINGAAEVLNLLRTLGEGYRLSCMYRCQDALDVYMKLPHKHYNTGWVLSQIGKAYFEL 480

Query: 480 VDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCA 539
           VDYL A+RAF+ AR+ASPYSLEGMDIYSTVLYHL+EDMKLSYLAQELI+TDRLAPQSWCA
Sbjct: 481 VDYLGADRAFSSARQASPYSLEGMDIYSTVLYHLREDMKLSYLAQELISTDRLAPQSWCA 540

Query: 540 MGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDA 599
           MGNCYSLQKDHETALKNFQRAVQLN RFAY HTLCGHEYVALE FENGI+SYQSALR+D 
Sbjct: 541 MGNCYSLQKDHETALKNFQRAVQLNSRFAYAHTLCGHEYVALEYFENGIKSYQSALRIDD 600

Query: 600 RHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMM 659
           RHYNSWYGLGM+ LRQEKFEF+EHHFRMAFQI+P SSVI+ YLGTA+HALKRSGEA+ MM
Sbjct: 601 RHYNSWYGLGMICLRQEKFEFAEHHFRMAFQINPRSSVILCYLGTALHALKRSGEALYMM 660

Query: 660 EKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMG 711
           EKAILADKKNPLPMY+KANILL L+ FDEALEVLEELKEYAPRES VYALMG
Sbjct: 661 EKAILADKKNPLPMYEKANILLGLDNFDEALEVLEELKEYAPRESSVYALMG 712

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224142197|ref|XP_002324445.1| predicted protein [Populus trichocarpa] gi|222865879|gb|EEF03010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356526603|ref|XP_003531906.1| PREDICTED: cell division cycle protein 27 homolog B-like [Glycine max] Back     alignment and taxonomy information
>gi|255546359|ref|XP_002514239.1| cell division cycle, putative [Ricinus communis] gi|223546695|gb|EEF48193.1| cell division cycle, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449449531|ref|XP_004142518.1| PREDICTED: cell division cycle protein 27 homolog B-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297832142|ref|XP_002883953.1| hypothetical protein ARALYDRAFT_480470 [Arabidopsis lyrata subsp. lyrata] gi|297329793|gb|EFH60212.1| hypothetical protein ARALYDRAFT_480470 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|356568879|ref|XP_003552635.1| PREDICTED: cell division cycle protein 27 homolog B-like [Glycine max] Back     alignment and taxonomy information
>gi|30680846|ref|NP_849994.1| cell division cycle protein 27-B [Arabidopsis thaliana] gi|75330104|sp|Q8LGU6.1|CD27B_ARATH RecName: Full=Cell division cycle protein 27 homolog B; Short=CDC27 homolog B; AltName: Full=Protein HOBBIT gi|21304447|emb|CAD31951.1| HOBBIT protein [Arabidopsis thaliana] gi|330251859|gb|AEC06953.1| cell division cycle protein 27-B [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|149941647|dbj|BAF64845.1| Cdc27B [Nicotiana tabacum] Back     alignment and taxonomy information
>gi|149941649|dbj|BAF64846.1| Cdc27B [Nicotiana tabacum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query713
TAIR|locus:2061649744 HBT "HOBBIT" [Arabidopsis thal 0.974 0.934 0.729 7.3e-281
TAIR|locus:2094917717 CDC27a [Arabidopsis thaliana ( 0.457 0.454 0.585 2.9e-161
UNIPROTKB|Q5ZK91833 CDC27 "Uncharacterized protein 0.433 0.370 0.464 5.2e-110
UNIPROTKB|G3V1C4830 CDC27 "Cell division cycle 27, 0.431 0.371 0.471 6.4e-108
UNIPROTKB|A7Z061825 CDC27 "Cell division cycle pro 0.431 0.373 0.471 2.7e-107
UNIPROTKB|F1Q3E7825 CDC27 "Uncharacterized protein 0.431 0.373 0.471 2.7e-107
RGD|1304921824 Cdc27 "cell division cycle 27" 0.433 0.375 0.461 3.1e-106
UNIPROTKB|Q4V8A2824 Cdc27 "Cell division cycle pro 0.433 0.375 0.461 3.1e-106
UNIPROTKB|D4A152825 Cdc27 "Cell division cycle pro 0.431 0.373 0.464 6.4e-106
UNIPROTKB|G5EA36823 CDC27 "Cell division cycle 27, 0.643 0.557 0.375 1.1e-105
TAIR|locus:2061649 HBT "HOBBIT" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 2699 (955.2 bits), Expect = 7.3e-281, P = 7.3e-281
 Identities = 519/711 (72%), Positives = 592/711 (83%)

Query:     1 MEGILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKG 60
             ME +L DCV NSLR+F+Y+NAIF+CERLCAEFPSEVNLQLLAT YLQNNQAY+AY++LKG
Sbjct:     1 MEAMLVDCVNNSLRHFVYKNAIFMCERLCAEFPSEVNLQLLATSYLQNNQAYSAYHLLKG 60

Query:    61 TQMALSRYLFAVACYQMDLLSEAEAALSPVNEPSAEIPNGAAGHYLMGLIYRYTDRRKNA 120
             TQMA SRYLFA++C+QMDLL+EAE+AL PVNEP AEIPNGAAGHYL+GLIY+YTDRRKNA
Sbjct:    61 TQMAQSRYLFALSCFQMDLLNEAESALCPVNEPGAEIPNGAAGHYLLGLIYKYTDRRKNA 120

Query:   121 IHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPN 180
                +K +L+IDPLLWAAYEELC+LGAAEEATAVF E AAL IQKQY+Q    +  L   N
Sbjct:   121 AQQFKQSLTIDPLLWAAYEELCILGAAEEATAVFGETAALSIQKQYMQQLSTSLGLNTYN 180

Query:   181 EDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGXXXXXXXXXQPLNGGPSNASFY 240
             E+RN  S+K+  +ED SPRQ KH Q++ L+DI GN+H            +NGG SN SFY
Sbjct:   181 EERNSTSTKNTSSEDYSPRQSKHTQSHGLKDISGNFHSHG---------VNGGVSNMSFY 231

Query:   241 NTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLR 300
             NTPSP+  QLSG+APPPL RN QP   N N L TDSSPKST++ST+QAPRRKFVDEGKLR
Sbjct:   232 NTPSPVAAQLSGIAPPPLFRNFQPAVANPNSLITDSSPKSTVNSTLQAPRRKFVDEGKLR 291

Query:   301 KISGRLFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNXXXXXXXXXXXXVALRSVTL 360
             KISGRLFSDSGPRRS+RL+ ++GAN N S  TV+GN   N            +ALRSVTL
Sbjct:   292 KISGRLFSDSGPRRSSRLSADSGANINSSVATVSGN-VNNASKYLGGSKLSSLALRSVTL 350

Query:   361 RKGQSWANENIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGS 420
             RKG SWANEN+DEG+R EPFDDSR NTAST + S  ++D     QE  T+ IGG AM+  
Sbjct:   351 RKGHSWANENMDEGVRGEPFDDSRPNTAST-TGSMASND-----QEDETMSIGGIAMSSQ 404

Query:   421 RIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVV 480
              I  G S++L LLR LGEG R+S MYRC++ALD Y+KLPHKHYNTGWVLSQVGKAYFE++
Sbjct:   405 TITIGVSEILNLLRTLGEGCRLSYMYRCQEALDTYMKLPHKHYNTGWVLSQVGKAYFELI 464

Query:   481 DYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAM 540
             DYLEAE+AF LAR ASPY LEGMDIYSTVLYHLKEDMKLSYLAQELI+TDRLAPQSWCAM
Sbjct:   465 DYLEAEKAFRLARLASPYCLEGMDIYSTVLYHLKEDMKLSYLAQELISTDRLAPQSWCAM 524

Query:   541 GNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDAR 600
             GNCYSLQKDHETALKNF RAVQLNPRFAY HTLCGHEY  LEDFENG++SYQ+ALRVD R
Sbjct:   525 GNCYSLQKDHETALKNFLRAVQLNPRFAYAHTLCGHEYTTLEDFENGMKSYQNALRVDTR 584

Query:   601 HYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMME 660
             HYN+WYGLGM+YLRQEK EFSEHHFRMAF I+P SSVIMSYLGT++HALKRS EA+E+ME
Sbjct:   585 HYNAWYGLGMIYLRQEKLEFSEHHFRMAFLINPSSSVIMSYLGTSLHALKRSEEALEIME 644

Query:   661 KAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMG 711
             +AI+AD+KNPLPMYQKANIL+ LE+ DEALEVLEELKEYAP ES VYALMG
Sbjct:   645 QAIVADRKNPLPMYQKANILVCLERLDEALEVLEELKEYAPSESSVYALMG 695
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0005680 "anaphase-promoting complex" evidence=ISS;TAS;IPI
GO:0007346 "regulation of mitotic cell cycle" evidence=RCA;IMP;TAS
GO:0009733 "response to auxin stimulus" evidence=IMP
GO:0030154 "cell differentiation" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0005819 "spindle" evidence=IDA
GO:0007276 "gamete generation" evidence=IGI;RCA
GO:0009504 "cell plate" evidence=IDA
GO:0051302 "regulation of cell division" evidence=IGI;RCA
GO:0051510 "regulation of unidimensional cell growth" evidence=IGI;RCA
GO:0006312 "mitotic recombination" evidence=RCA
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010048 "vernalization response" evidence=RCA
GO:0032875 "regulation of DNA endoreduplication" evidence=RCA
GO:0042023 "DNA endoreduplication" evidence=RCA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=RCA
GO:0043248 "proteasome assembly" evidence=RCA
GO:0051788 "response to misfolded protein" evidence=RCA
GO:0010071 "root meristem specification" evidence=IMP
GO:0048364 "root development" evidence=IMP
GO:0048829 "root cap development" evidence=IMP
TAIR|locus:2094917 CDC27a [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZK91 CDC27 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1C4 CDC27 "Cell division cycle 27, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A7Z061 CDC27 "Cell division cycle protein 27 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3E7 CDC27 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1304921 Cdc27 "cell division cycle 27" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8A2 Cdc27 "Cell division cycle protein 27 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A152 Cdc27 "Cell division cycle protein 27 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G5EA36 CDC27 "Cell division cycle 27, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P30260CDC27_HUMANNo assigned EC number0.34150.93400.8082yesno
A7Z061CDC27_BOVINNo assigned EC number0.33970.92980.8036yesno
Q8LGU6CD27B_ARATHNo assigned EC number0.74680.97470.9341yesno
Q4V8A2CDC27_RATNo assigned EC number0.32890.95650.8276yesno
P17885BIMA_EMENINo assigned EC number0.30320.96070.8498yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
pfam1289580 pfam12895, Apc3, Anaphase-promoting complex, cyclo 2e-16
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-16
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-13
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-12
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-11
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 9e-10
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-09
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 2e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 4e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 4e-06
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 3e-05
smart0002834 smart00028, TPR, Tetratricopeptide repeats 5e-05
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 6e-05
pfam1341469 pfam13414, TPR_11, TPR repeat 1e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 1e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 2e-04
COG4235287 COG4235, COG4235, Cytochrome c biogenesis factor [ 2e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 3e-04
TIGR02552135 TIGR02552, LcrH_SycD, type III secretion low calci 3e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 4e-04
COG2956389 COG2956, COG2956, Predicted N-acetylglucosaminyl t 4e-04
pfam1343265 pfam13432, TPR_16, Tetratricopeptide repeat 4e-04
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 5e-04
TIGR02521234 TIGR02521, type_IV_pilW, type IV pilus biogenesis/ 5e-04
TIGR00990615 TIGR00990, 3a0801s09, mitochondrial precursor prot 7e-04
pfam1341469 pfam13414, TPR_11, TPR repeat 9e-04
COG3063250 COG3063, PilF, Tfp pilus assembly protein PilF [Ce 0.002
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 0.002
>gnl|CDD|221837 pfam12895, Apc3, Anaphase-promoting complex, cyclosome, subunit 3 Back     alignment and domain information 
 Score = 74.2 bits (183), Expect = 2e-16
 Identities = 29/76 (38%), Positives = 37/76 (48%), Gaps = 3/76 (3%)

Query: 15 YFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGTQMALS---RYLFA 71
             Y NAIFL E+L A  PS  +  LLA CY    Q   AY +L+  ++  S   RYL A
Sbjct: 2  QGNYENAIFLAEKLLALTPSNEDAYLLAQCYFLQGQYKRAYELLRKLKLDNSSGCRYLLA 61

Query: 72 VACYQMDLLSEAEAAL 87
              ++    EA A L
Sbjct: 62 QCLLKLGKYDEAIAVL 77

Apc3, otherwise known as Cdc27, is one of the subunits of the anaphase-promoting complex or cyclosome. The anaphase-promoting complex is a multiprotein subunit E3 ubiquitin ligase complex that controls segregation of chromosomes and exit from mitosis in eukaryotes. The protein members of this family contain TPR repeats just as those of Apc7 do, and it appears that these TPR units bind the C-termini of the APC co-activators CDH1 and CDC20. Length = 80
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|226687 COG4235, COG4235, Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|233924 TIGR02552, LcrH_SycD, type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|225504 COG2956, COG2956, Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|222123 pfam13432, TPR_16, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|131573 TIGR02521, type_IV_pilW, type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>gnl|CDD|233223 TIGR00990, 3a0801s09, mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|225605 COG3063, PilF, Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 713
KOG1126638 consensus DNA-binding cell division cycle control 100.0
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 100.0
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.98
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.97
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.96
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.96
KOG1126638 consensus DNA-binding cell division cycle control 99.95
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.95
PRK10049765 pgaA outer membrane protein PgaA; Provisional 99.95
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.93
PRK11788389 tetratricopeptide repeat protein; Provisional 99.93
KOG0547606 consensus Translocase of outer mitochondrial membr 99.92
KOG0547 606 consensus Translocase of outer mitochondrial membr 99.92
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.92
PRK11788389 tetratricopeptide repeat protein; Provisional 99.91
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.91
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.9
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.88
KOG1173 611 consensus Anaphase-promoting complex (APC), Cdc16 99.87
PRK12370553 invasion protein regulator; Provisional 99.86
PRK14574 822 hmsH outer membrane protein; Provisional 99.86
PRK12370553 invasion protein regulator; Provisional 99.85
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.85
KOG1129478 consensus TPR repeat-containing protein [General f 99.84
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.83
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.83
KOG2076 895 consensus RNA polymerase III transcription factor 99.83
KOG1125579 consensus TPR repeat-containing protein [General f 99.83
PRK11189296 lipoprotein NlpI; Provisional 99.82
PRK11189296 lipoprotein NlpI; Provisional 99.82
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.81
KOG1125579 consensus TPR repeat-containing protein [General f 99.81
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.81
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.81
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.81
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.81
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.81
KOG1129478 consensus TPR repeat-containing protein [General f 99.81
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.8
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.8
KOG2003 840 consensus TPR repeat-containing protein [General f 99.8
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.8
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.8
PRK14574 822 hmsH outer membrane protein; Provisional 99.79
PLN03218 1060 maturation of RBCL 1; Provisional 99.79
PLN03077 857 Protein ECB2; Provisional 99.78
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.77
KOG2003 840 consensus TPR repeat-containing protein [General f 99.77
PLN02789320 farnesyltranstransferase 99.77
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.77
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.77
PLN03218 1060 maturation of RBCL 1; Provisional 99.76
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.75
PLN03077857 Protein ECB2; Provisional 99.75
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.75
KOG0495 913 consensus HAT repeat protein [RNA processing and m 99.75
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.75
PLN02789320 farnesyltranstransferase 99.74
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.74
KOG2076 895 consensus RNA polymerase III transcription factor 99.74
KOG0624 504 consensus dsRNA-activated protein kinase inhibitor 99.7
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.67
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.67
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.64
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.64
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.63
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.62
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.59
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.58
KOG0550 486 consensus Molecular chaperone (DnaJ superfamily) [ 99.57
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.57
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.56
PRK15359144 type III secretion system chaperone protein SscB; 99.56
PRK15359144 type III secretion system chaperone protein SscB; 99.56
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.55
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.55
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.55
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.53
PRK10370198 formate-dependent nitrite reductase complex subuni 99.53
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.52
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.5
PRK10370198 formate-dependent nitrite reductase complex subuni 99.49
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.49
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.47
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.47
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.47
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.46
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.44
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.42
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.41
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.4
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.38
KOG1128 777 consensus Uncharacterized conserved protein, conta 99.35
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.31
KOG0553304 consensus TPR repeat-containing protein [General f 99.3
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.28
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.27
KOG0553304 consensus TPR repeat-containing protein [General f 99.27
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.26
PRK04841903 transcriptional regulator MalT; Provisional 99.26
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.25
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.24
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.24
KOG3785 557 consensus Uncharacterized conserved protein [Funct 99.23
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.23
PRK04841 903 transcriptional regulator MalT; Provisional 99.2
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.2
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.2
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 99.17
KOG4340 459 consensus Uncharacterized conserved protein [Funct 99.16
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.13
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.13
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 99.13
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.12
COG0457291 NrfG FOG: TPR repeat [General function prediction 99.08
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 99.05
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.02
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 99.0
PRK10153517 DNA-binding transcriptional activator CadC; Provis 99.0
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.99
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.98
PRK11906458 transcriptional regulator; Provisional 98.98
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.98
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.98
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.97
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.97
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.95
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.94
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.94
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.94
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.94
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.93
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.93
PRK11906458 transcriptional regulator; Provisional 98.93
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.93
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.9
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.88
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.86
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.85
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.85
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.84
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.82
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.8
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.8
KOG1941 518 consensus Acetylcholine receptor-associated protei 98.8
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.79
PRK15331165 chaperone protein SicA; Provisional 98.78
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.77
PRK10803263 tol-pal system protein YbgF; Provisional 98.74
COG3898 531 Uncharacterized membrane-bound protein [Function u 98.74
PRK15331165 chaperone protein SicA; Provisional 98.74
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.73
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.72
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 98.72
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.72
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.72
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.71
PRK10803263 tol-pal system protein YbgF; Provisional 98.7
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.7
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.69
KOG4648 536 consensus Uncharacterized conserved protein, conta 98.69
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.66
PF12688120 TPR_5: Tetratrico peptide repeat 98.63
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.62
PF12688120 TPR_5: Tetratrico peptide repeat 98.6
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 98.56
KOG2047 835 consensus mRNA splicing factor [RNA processing and 98.53
KOG2471696 consensus TPR repeat-containing protein [General f 98.53
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.52
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.5
COG4700251 Uncharacterized protein conserved in bacteria cont 98.47
PF1337173 TPR_9: Tetratricopeptide repeat 98.44
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.44
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.44
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.44
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.43
KOG4234271 consensus TPR repeat-containing protein [General f 98.42
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.42
PF1337173 TPR_9: Tetratricopeptide repeat 98.42
KOG4234271 consensus TPR repeat-containing protein [General f 98.4
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 98.39
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.37
COG4700251 Uncharacterized protein conserved in bacteria cont 98.36
PF13512142 TPR_18: Tetratricopeptide repeat 98.32
KOG1586288 consensus Protein required for fusion of vesicles 98.27
PF13512142 TPR_18: Tetratricopeptide repeat 98.22
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.21
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.21
KOG2471 696 consensus TPR repeat-containing protein [General f 98.19
KOG1586288 consensus Protein required for fusion of vesicles 98.18
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 98.17
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.17
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.16
KOG2610 491 consensus Uncharacterized conserved protein [Funct 98.13
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.12
KOG4555175 consensus TPR repeat-containing protein [Function 98.1
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.08
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.08
KOG4555175 consensus TPR repeat-containing protein [Function 98.06
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.04
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.02
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.02
KOG1585308 consensus Protein required for fusion of vesicles 98.02
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 98.0
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.99
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.92
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.92
KOG3616 1636 consensus Selective LIM binding factor [Transcript 97.83
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.81
PF1342844 TPR_14: Tetratricopeptide repeat 97.75
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.67
KOG4642 284 consensus Chaperone-dependent E3 ubiquitin protein 97.65
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.63
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.63
KOG1550552 consensus Extracellular protein SEL-1 and related 97.57
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 97.57
KOG4507 886 consensus Uncharacterized conserved protein, conta 97.57
PF1342844 TPR_14: Tetratricopeptide repeat 97.53
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.52
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.51
KOG1585308 consensus Protein required for fusion of vesicles 97.51
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.5
KOG1550552 consensus Extracellular protein SEL-1 and related 97.49
KOG1258 577 consensus mRNA processing protein [RNA processing 97.47
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.45
KOG0530318 consensus Protein farnesyltransferase, alpha subun 97.43
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.41
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.41
PF1343134 TPR_17: Tetratricopeptide repeat 97.38
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 97.37
KOG2300629 consensus Uncharacterized conserved protein [Funct 97.35
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.34
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 97.34
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.33
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.32
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.3
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.29
PF1343134 TPR_17: Tetratricopeptide repeat 97.29
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.27
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.27
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.26
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 97.24
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.24
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 97.2
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 97.17
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 97.12
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 97.12
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.07
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 97.06
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 97.04
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.03
PF10345 608 Cohesin_load: Cohesin loading factor; InterPro: IP 97.02
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.01
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.99
KOG1258577 consensus mRNA processing protein [RNA processing 96.98
PF04049142 APC8: Anaphase promoting complex subunit 8 / Cdc23 96.98
KOG3616 1636 consensus Selective LIM binding factor [Transcript 96.97
COG2976207 Uncharacterized protein conserved in bacteria [Fun 96.97
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.92
KOG2300 629 consensus Uncharacterized conserved protein [Funct 96.9
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.89
KOG0551 390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.85
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 96.84
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.77
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 96.74
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 96.74
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 96.73
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 96.43
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 96.42
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.38
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.37
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.14
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 96.02
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.98
PRK10941269 hypothetical protein; Provisional 95.96
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.84
KOG3783546 consensus Uncharacterized conserved protein [Funct 95.8
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.78
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.76
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 95.75
KOG2041 1189 consensus WD40 repeat protein [General function pr 95.65
KOG4507886 consensus Uncharacterized conserved protein, conta 95.6
PRK10941269 hypothetical protein; Provisional 95.53
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 95.48
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 95.47
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.41
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 95.39
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.37
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 95.21
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 95.14
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 95.09
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 95.04
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 95.04
PRK11619 644 lytic murein transglycosylase; Provisional 95.02
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.99
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.96
KOG2396 568 consensus HAT (Half-A-TPR) repeat-containing prote 94.9
COG4649221 Uncharacterized protein conserved in bacteria [Fun 94.89
KOG0529 421 consensus Protein geranylgeranyltransferase type I 94.84
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.81
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.77
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.77
PF09986214 DUF2225: Uncharacterized protein conserved in bact 94.7
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 94.66
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 94.59
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 94.48
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 94.47
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 94.45
PRK15180 831 Vi polysaccharide biosynthesis protein TviD; Provi 94.4
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 94.3
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 94.23
KOG1463411 consensus 26S proteasome regulatory complex, subun 94.19
KOG3364149 consensus Membrane protein involved in organellar 94.15
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 94.03
KOG2581 493 consensus 26S proteasome regulatory complex, subun 94.01
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.0
PF09986214 DUF2225: Uncharacterized protein conserved in bact 93.9
KOG3364149 consensus Membrane protein involved in organellar 93.85
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 93.8
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 93.76
COG1747 711 Uncharacterized N-terminal domain of the transcrip 93.69
COG4976 287 Predicted methyltransferase (contains TPR repeat) 93.6
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.53
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 93.49
KOG4814 872 consensus Uncharacterized conserved protein [Funct 93.49
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 93.46
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.35
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 93.28
KOG1310 758 consensus WD40 repeat protein [General function pr 93.23
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 93.22
KOG2422 665 consensus Uncharacterized conserved protein [Funct 93.12
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 92.81
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 92.73
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 92.66
COG5191 435 Uncharacterized conserved protein, contains HAT (H 92.32
COG1747 711 Uncharacterized N-terminal domain of the transcrip 92.27
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 92.04
COG4976 287 Predicted methyltransferase (contains TPR repeat) 91.98
KOG4814 872 consensus Uncharacterized conserved protein [Funct 91.91
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.85
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 91.8
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 91.41
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 91.35
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 91.32
KOG1310758 consensus WD40 repeat protein [General function pr 91.01
COG5191 435 Uncharacterized conserved protein, contains HAT (H 90.96
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.89
KOG0529 421 consensus Protein geranylgeranyltransferase type I 90.84
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 90.62
KOG2581493 consensus 26S proteasome regulatory complex, subun 90.06
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.79
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 89.78
PF09477116 Type_III_YscG: Bacterial type II secretion system 89.55
COG2912269 Uncharacterized conserved protein [Function unknow 89.08
PRK12798421 chemotaxis protein; Reviewed 88.86
COG4941415 Predicted RNA polymerase sigma factor containing a 88.5
KOG4014248 consensus Uncharacterized conserved protein (conta 88.38
COG2912269 Uncharacterized conserved protein [Function unknow 88.33
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 88.27
TIGR02508115 type_III_yscG type III secretion protein, YscG fam 88.2
KOG2063877 consensus Vacuolar assembly/sorting proteins VPS39 87.78
COG4941415 Predicted RNA polymerase sigma factor containing a 87.73
PF1286294 Apc5: Anaphase-promoting complex subunit 5 87.15
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 87.02
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 86.87
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 86.63
COG3629280 DnrI DNA-binding transcriptional activator of the 86.39
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 86.27
COG3629280 DnrI DNA-binding transcriptional activator of the 86.24
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 85.78
PF1286294 Apc5: Anaphase-promoting complex subunit 5 85.62
smart00299140 CLH Clathrin heavy chain repeat homology. 84.54
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 84.29
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 84.21
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 83.89
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 83.81
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 83.43
KOG1463411 consensus 26S proteasome regulatory complex, subun 82.87
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 82.73
COG3947361 Response regulator containing CheY-like receiver a 82.47
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 81.87
PF09205161 DUF1955: Domain of unknown function (DUF1955); Int 81.48
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 81.21
KOG2063 877 consensus Vacuolar assembly/sorting proteins VPS39 80.68
COG5600413 Transcription-associated recombination protein [DN 80.28
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=1.9e-46  Score=402.01  Aligned_cols=589  Identities=42%  Similarity=0.647  Sum_probs=400.2

Q ss_pred             CcchHHHHHHHHHHHHhcCChhHHHHHHHHHhhhCCcchHHHHHHHhcCCccchhHHHHHhHHH-----HHHHHhhhccc
Q 005133           97 IPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLGAAEEATAVFSEAAAL-----CIQKQYLQNGL  171 (713)
Q Consensus        97 ~p~~a~~~~llg~~~~~~~~~~~A~~~y~~Al~~~p~~~~a~~~L~~~~~~~~~~~~f~~~~~~-----~~~~~~~~~~~  171 (713)
                      +++.|..+|++|.+| ..++...+...+++|+..+|++|.||..||.+|........+.....+     .+++.+...-.
T Consensus         2 f~~lAcf~yllg~~y-r~~~~~~~s~~~r~als~~p~~~safs~l~~l~~~~~l~t~l~~v~~l~~q~tl~~nR~~~~~~   80 (638)
T KOG1126|consen    2 FGDLACFYYLLGIIY-RGARFEHSSQVIRKALSLEPLVWSAFSSLCSLGSDDVLSTCLGSVNILLWQNTLNENRYSGSDS   80 (638)
T ss_pred             CcchhhHHHhhchhh-hhhHHHHHHHHhhhhhccCchHHHHHHHHHhhhhHHHHHHhhcccchHHHHHHHHHHHhccccc
Confidence            566777799999999 999999999999999999999999999999999444444444321111     11122211000


Q ss_pred             ccccCCCCCCCCccccCCCCCCCCCChhhhhhhhhcccCCCCCCCCCccccccccCCCCCCCCCCCCccCCCCCCccCCC
Q 005133          172 ATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAAASQPLNGGPSNASFYNTPSPITTQLS  251 (713)
Q Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (713)
                             ..+. ...+++ ..+.+.+....+.-..+...++.++.      ++-.+...++...++-...+++|.-   +
T Consensus        81 -------a~e~-~ntdS~-~~nidss~ss~~~v~~s~~l~~Ls~~------~~~kp~t~rs~~~~~~~~sslSP~~---s  142 (638)
T KOG1126|consen   81 -------ATEF-HNTDSN-VLNIDSSVSSPKHVPLSPGLDDLSKQ------AQKKPNTLRSLVRNSADLSSLSPFR---S  142 (638)
T ss_pred             -------cccc-ccccCc-ccCccccccccCCCCCCCCccchhhc------ccCCCccchhhhcCCcccCCCCccc---c
Confidence                   0011 000000 00001100000000000000000000      0000000010001111122222211   3


Q ss_pred             CCCCCCcccCCCCCCCCCCCCCCCCCCCccccccccCCccccccCCccccccccccCCCC-CCCcccccccccCCCCCcc
Q 005133          252 GVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGRLFSDSG-PRRSTRLAGEAGANANMST  330 (713)
Q Consensus       252 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~rl~~~~~~~~~~~~  330 (713)
                      ++.|+ | +++.|.+.|..++..++.+.-.+..+.+..+..+..++.+++..++..+..+ .|++.++.........++.
T Consensus       143 ~i~P~-L-~~~sP~~~n~~~~~~~~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~~~~~~~r~~~~l~~~~~~~~~ss~  220 (638)
T KOG1126|consen  143 GILPP-L-TPPSPAVANPTSLISNSLPKICVSSRSRSSRTASVSEGFLLPKSPEARSSSSINRNSESLAADASNSKASST  220 (638)
T ss_pred             cCCCC-C-CCCCCCCCCCcccccCCCcccccCCCCcccchhccccccccccChhhhhcccccccchhhccchhcCccccc
Confidence            33333 2 2222444443333333333333444445566666666666666666555544 5666666544322221211


Q ss_pred             ccccCCC-CCCCCcccCCCcCcccccccccccCCcCCCcc-ccccCCCCCCCCccccCcCCccccCCCCCCCccccccCC
Q 005133          331 TTVAGNG-TTNSSKYLGGSKLSSVALRSVTLRKGQSWANE-NIDEGMRNEPFDDSRANTASTVSSSFPTSDTRSAVQEGT  408 (713)
Q Consensus       331 ~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  408 (713)
                      ++-.... +.+.+..+++++.......+...+....++.. .....++...+++.++++..+.+.......      +..
T Consensus       221 t~~~~s~~~~~~~~~~~~~~s~~~~~~s~t~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ti~~~~~~~~------~~~  294 (638)
T KOG1126|consen  221 TPRTISLNVGKPSSYLKVRKSLKLASESKTSKENNKRARIQKKFVNPRDENFNESRTNDLNTISSTASEGP------EES  294 (638)
T ss_pred             ccchhcccccCChhhhhhhhhhHhhcCCccccccchhhhhhcccCCCCCccccccCcCCccccccccccCc------ccc
Confidence            1101000 01111112222222222222222211111111 111122333344444443333222111111      111


Q ss_pred             cc-ccCCCCCCcchhhhhHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHcCcccCCCCHHHHHHHHHHHHHhhcHHHHHH
Q 005133          409 TV-PIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAER  487 (713)
Q Consensus       409 ~~-~~~~~~~~~~~~~~~~~~l~~ll~~l~~a~~l~~~g~~~eAi~~l~~~~~~~~~~~~~~~~lg~~~~~~g~~~eA~~  487 (713)
                      .. ..+...++...+......++++++.+++|+....+.++.+|+..|.++....++.+|++..+|++|+++++|++|.+
T Consensus       295 ~~~n~~~~~~~~~~l~~~~~~l~~llr~~~~~~~~~s~y~~~~A~~~~~klp~h~~nt~wvl~q~GrayFEl~~Y~~a~~  374 (638)
T KOG1126|consen  295 KGPNPGELAPQSFGLKDDASELMELLRGLGEGYRSLSQYNCREALNLFEKLPSHHYNTGWVLSQLGRAYFELIEYDQAER  374 (638)
T ss_pred             cCCCCCccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHhcCCchHHHHHHHHHHHHHHHHHHHHH
Confidence            11 22334455555556688999999999999999999999999999999888999999999999999999999999999


Q ss_pred             HHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCC
Q 005133          488 AFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRF  567 (713)
Q Consensus       488 ~~~kal~~~p~~~~a~~~la~~l~~~g~~~~A~~~~~kal~~~p~~~~~~~~la~~~~~~g~~~~Al~~~~kal~~~p~~  567 (713)
                      +|+.+.+..|...+.+..+..++|++.+..+...+.+.+++.+|..|+.|+.+|+||..+++++.|+++|++|++++|.+
T Consensus       375 ~F~~~r~~~p~rv~~meiyST~LWHLq~~v~Ls~Laq~Li~~~~~sPesWca~GNcfSLQkdh~~Aik~f~RAiQldp~f  454 (638)
T KOG1126|consen  375 IFSLVRRIEPYRVKGMEIYSTTLWHLQDEVALSYLAQDLIDTDPNSPESWCALGNCFSLQKDHDTAIKCFKRAIQLDPRF  454 (638)
T ss_pred             HHHHHHhhccccccchhHHHHHHHHHHhhHHHHHHHHHHHhhCCCCcHHHHHhcchhhhhhHHHHHHHHHHHhhccCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Q 005133          568 AYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMH  647 (713)
Q Consensus       568 ~~a~~~lg~~~~~~g~~eeAl~~~~~al~~~p~~~~~~~~lg~~y~~~g~~~eA~~~l~kal~~~p~~~~~~~~la~~~~  647 (713)
                      .++|..+|+-+....++|.|..+|++|+..+|.+..+|+++|.+|.++++++.|+-+|++|++++|.+..+...+|.++.
T Consensus       455 aYayTLlGhE~~~~ee~d~a~~~fr~Al~~~~rhYnAwYGlG~vy~Kqek~e~Ae~~fqkA~~INP~nsvi~~~~g~~~~  534 (638)
T KOG1126|consen  455 AYAYTLLGHESIATEEFDKAMKSFRKALGVDPRHYNAWYGLGTVYLKQEKLEFAEFHFQKAVEINPSNSVILCHIGRIQH  534 (638)
T ss_pred             chhhhhcCChhhhhHHHHhHHHHHHhhhcCCchhhHHHHhhhhheeccchhhHHHHHHHhhhcCCccchhHHhhhhHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HcCChHHHHHHHHHHHHhCCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHHHCCCChhHHHhccC
Q 005133          648 ALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKEYAPRESGVYALMGC  712 (713)
Q Consensus       648 ~~g~~eeAl~~l~kal~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~kal~l~P~~~~~~~~Lg~  712 (713)
                      ++|+.++|+.+|++|+.++|.++...+..|.+++.++++++|+..++++.++.|++..++++||.
T Consensus       535 ~~k~~d~AL~~~~~A~~ld~kn~l~~~~~~~il~~~~~~~eal~~LEeLk~~vP~es~v~~llgk  599 (638)
T KOG1126|consen  535 QLKRKDKALQLYEKAIHLDPKNPLCKYHRASILFSLGRYVEALQELEELKELVPQESSVFALLGK  599 (638)
T ss_pred             HhhhhhHHHHHHHHHHhcCCCCchhHHHHHHHHHhhcchHHHHHHHHHHHHhCcchHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999884

>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>PF04049 APC8: Anaphase promoting complex subunit 8 / Cdc23 ; InterPro: IPR007192 The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8) Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PRK11619 lytic murein transglycosylase; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PRK15180 Vi polysaccharide biosynthesis protein TviD; Provisional Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA [Function unknown] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF09477 Type_III_YscG: Bacterial type II secretion system chaperone protein (type_III_yscG); InterPro: IPR013348 YscG is a molecular chaperone for YscE, where both are part of the type III secretion system that in Yersinia is designated Ysc (Yersinia secretion) Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK12798 chemotaxis protein; Reviewed Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>TIGR02508 type_III_yscG type III secretion protein, YscG family Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4941 Predicted RNA polymerase sigma factor containing a TPR repeat domain [Transcription] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>smart00299 CLH Clathrin heavy chain repeat homology Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>PF09205 DUF1955: Domain of unknown function (DUF1955); InterPro: IPR015288 Members of this family are found in hypothetical proteins synthesised by the Archaeal organism Sulfolobus Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>KOG2063 consensus Vacuolar assembly/sorting proteins VPS39/VAM6/VPS3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 7e-17
2fo7_A136 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 1e-11
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 6e-13
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-08
1na0_A125 Design Of Stable Alpha-Helical Arrays From An Ideal 9e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 1e-11
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 8e-07
3kd7_A125 Designed Tpr Module (Ctpr390) In Complex With Its P 2e-04
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 1e-10
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 3e-05
1w3b_A 388 The Superhelical Tpr Domain Of O-Linked Glcnac Tran 4e-09
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 8e-07
2avp_A70 Crystal Structure Of An 8 Repeat Consensus Tpr Supe 3e-04
3hym_B330 Insights Into Anaphase Promoting Complex Tpr Subdom 2e-06
3lca_A533 Structure Of Tom71 Complexed With Hsp70 Ssa1 C Term 8e-06
3fp2_A537 Crystal Structure Of Tom71 Complexed With Hsp82 C-T 9e-06
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 2e-05
1na3_A91 Design Of Stable Alpha-Helical Arrays From An Ideal 3e-05
2q7f_A243 Crystal Structure Of Yrrb: A Tpr Protein With An Un 2e-05
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure 
Iteration: 1

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 72/132 (54%)
Query: 535 QSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSA 594
           ++W  +GN Y  Q D++ A++ +Q+A++L+PR A      G+ Y    D++  I  YQ A
Sbjct: 2   EAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKA 61
Query: 595 LRVDARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGE 654
           L +D R   +WY LG  Y +Q  ++ +  +++ A ++ P S+     LG A +      E
Sbjct: 62  LELDPRSAEAWYNLGNAYYKQGDYDEAIEYYQKALELDPRSAEAWYNLGNAYYKQGDYDE 121
Query: 655 AIEMMEKAILAD 666
           AIE  +KA+  D
Sbjct: 122 AIEYYQKALELD 133
>pdb|2FO7|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix (Trigonal Crystal Form) Length = 136 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|1NA0|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|3KD7|A Chain A, Designed Tpr Module (Ctpr390) In Complex With Its Peptide-Ligand (Hsp90 Peptide) Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure
>pdb|1W3B|A Chain A, The Superhelical Tpr Domain Of O-Linked Glcnac Transferase Reveals Structural Similarities To Importin Alpha. Length = 388 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|2AVP|A Chain A, Crystal Structure Of An 8 Repeat Consensus Tpr Superhelix Length = 70 Back     alignment and structure
>pdb|3HYM|B Chain B, Insights Into Anaphase Promoting Complex Tpr Subdomain Assembly From A Cdc26-Apc6 Structure Length = 330 Back     alignment and structure
>pdb|3LCA|A Chain A, Structure Of Tom71 Complexed With Hsp70 Ssa1 C Terminal Tail Indicating Conformational Plasticity Length = 533 Back     alignment and structure
>pdb|3FP2|A Chain A, Crystal Structure Of Tom71 Complexed With Hsp82 C-Terminal Fragment Length = 537 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|1NA3|A Chain A, Design Of Stable Alpha-Helical Arrays From An Idealized Tpr Motif Length = 91 Back     alignment and structure
>pdb|2Q7F|A Chain A, Crystal Structure Of Yrrb: A Tpr Protein With An Unusual Peptide- Binding Site Length = 243 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query713
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 4e-76
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-20
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 7e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 9e-14
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 1e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-06
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-04
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 3e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 4e-68
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-24
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-12
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 7e-05
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-29
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-27
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-25
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 9e-22
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 2e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 6e-05
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-26
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-15
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 1e-08
2gw1_A514 Mitochondrial precursor proteins import receptor; 7e-26
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-20
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-15
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-12
2gw1_A 514 Mitochondrial precursor proteins import receptor; 5e-11
2gw1_A 514 Mitochondrial precursor proteins import receptor; 2e-09
2gw1_A514 Mitochondrial precursor proteins import receptor; 2e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 4e-04
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 7e-24
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-20
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-19
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-12
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-06
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-04
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-24
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-22
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 2e-22
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 1e-21
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 2e-21
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-17
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 8e-17
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 7e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 9e-04
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-23
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-22
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-22
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-23
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-22
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-21
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-16
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-14
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-23
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 3e-22
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 7e-13
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 4e-09
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-23
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-22
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-17
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-13
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 9e-12
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-05
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 8e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 7e-23
3u4t_A272 TPR repeat-containing protein; structural genomics 8e-21
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-17
3u4t_A272 TPR repeat-containing protein; structural genomics 9e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 4e-04
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-23
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 4e-18
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-13
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 3e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 2e-04
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-22
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 9e-18
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 4e-17
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-10
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-06
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-22
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 3e-19
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 7e-18
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-10
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-09
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 8e-06
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-22
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 1e-16
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-12
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 8e-12
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-21
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-20
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-10
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-21
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-17
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 1e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 6e-15
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 8e-11
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-04
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 5e-04
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-21
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-19
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 8e-17
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 6e-13
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 4e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 5e-04
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 1e-19
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 3e-17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-10
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 5e-04
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-19
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-15
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 2e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 8e-14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 3e-04
4eqf_A365 PEX5-related protein; accessory protein, tetratric 2e-19
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 3e-16
4eqf_A365 PEX5-related protein; accessory protein, tetratric 7e-15
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 1e-14
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-13
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-19
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-18
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 5e-14
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 4e-10
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-04
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 7e-19
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 3e-12
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 2e-05
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-19
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-17
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 8e-17
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 4e-16
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-15
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-15
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 7e-11
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-10
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 1e-06
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 5e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-18
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-17
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-15
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 6e-08
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-05
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-17
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-11
4g1t_A 472 Interferon-induced protein with tetratricopeptide 4e-11
4g1t_A472 Interferon-induced protein with tetratricopeptide 1e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-16
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 3e-12
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-11
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 6e-08
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-16
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 5e-13
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 2e-09
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 4e-04
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-15
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 5e-15
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 9e-13
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 2e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-06
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-12
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 2e-11
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 3e-07
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-13
3q15_A378 PSP28, response regulator aspartate phosphatase H; 9e-10
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-12
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 1e-11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 3e-04
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 3e-13
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 4e-10
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 1e-06
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-12
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 1e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 1e-12
3k9i_A117 BH0479 protein; putative protein binding protein, 2e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 5e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-12
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 2e-06
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 3e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-05
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-12
2kat_A115 Uncharacterized protein; NESG, structure, structur 2e-11
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-10
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 8e-06
2kat_A115 Uncharacterized protein; NESG, structure, structur 1e-05
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 3e-12
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 1e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 6e-12
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 1e-08
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 2e-05
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 6e-12
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-09
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 7e-12
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 5e-09
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 1e-06
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-11
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 9e-09
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-07
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 4e-10
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 5e-08
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 1e-07
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 2e-07
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 9e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-09
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 2e-08
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 7e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 5e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-04
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 7e-08
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 6e-05
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 2e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 7e-07
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 1e-04
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-06
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 2e-05
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 6e-04
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 1e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 8e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 2e-04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-05
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 3e-04
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 7e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 3e-05
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 3e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 5e-05
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 1e-04
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 7e-04
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 2e-04
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-04
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-04
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-04
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 4e-04
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 4e-04
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 5e-04
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 5e-04
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-04
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
 Score =  247 bits (632), Expect = 4e-76
 Identities = 45/276 (16%), Positives = 100/276 (36%), Gaps = 11/276 (3%)

Query: 446 YRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDI 505
           Y       +   +     N   V+  + + ++   D+    +  ++     P+    + +
Sbjct: 3   YNKPSETVIPESVDGLQENL-DVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPV 61

Query: 506 YSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQ-KDHETALKNFQRAVQLN 564
           +   L  L +  +L YL+ +L+      P SW A+G  Y +    +E A +   +A  L 
Sbjct: 62  HIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLE 121

Query: 565 PRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHH 624
             +       GH +    + +  + +Y +A ++    +     +G+ Y      + +E  
Sbjct: 122 KTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERF 181

Query: 625 FRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPM---------YQ 675
           F  A  I+P    +M  +G           A +    A+   K     +           
Sbjct: 182 FSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNN 241

Query: 676 KANILLSLEKFDEALEVLEELKEYAPRESGVYALMG 711
             ++   L+K+ EAL+   +     P+ +  Y+ +G
Sbjct: 242 LGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIG 277
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Length = 91 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Length = 372 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 100.0
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.98
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.98
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.96
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.96
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.96
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.96
3u4t_A272 TPR repeat-containing protein; structural genomics 99.95
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.95
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.95
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.94
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.94
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.93
3u4t_A272 TPR repeat-containing protein; structural genomics 99.93
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.93
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.92
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.92
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.92
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.92
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.91
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.91
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.91
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.91
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.91
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.91
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.91
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.9
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.9
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.9
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.9
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.89
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.89
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.88
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.88
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.87
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.87
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.87
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.86
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.86
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.86
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.85
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.85
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.84
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.83
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.82
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.82
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.82
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.82
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.81
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.81
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.81
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.8
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.8
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.8
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.79
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.79
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.79
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.79
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.78
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.78
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.78
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.77
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.76
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.76
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.76
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.75
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.75
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.72
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.72
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.71
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.71
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.71
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.71
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.71
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.69
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.68
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.68
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.68
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.67
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.65
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.65
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.64
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.64
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.63
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.63
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.63
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.63
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.62
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.61
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.61
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.6
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.6
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.58
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.57
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.57
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.56
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.56
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.55
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.55
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.55
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.55
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.55
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.54
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.54
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.53
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.52
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.51
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.51
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.51
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.5
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.5
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.47
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.46
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.46
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.45
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.45
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.44
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.44
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.44
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.43
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.43
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.42
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.42
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.41
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.41
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.41
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.41
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.4
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.4
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.4
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.38
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.37
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.37
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.36
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.36
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.35
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.35
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.34
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.34
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.33
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.3
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.3
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.3
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.28
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.28
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.28
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.27
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.26
3k9i_A117 BH0479 protein; putative protein binding protein, 99.26
3k9i_A117 BH0479 protein; putative protein binding protein, 99.26
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.25
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 99.24
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.15
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.04
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.02
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.02
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.99
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.97
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.96
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.94
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.9
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.88
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 98.87
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.82
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.82
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.81
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.8
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.8
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.79
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.78
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.78
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.68
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.42
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.41
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.39
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.33
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.28
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.25
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.23
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.2
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.13
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.79
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.76
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.64
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 97.56
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.07
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.95
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.93
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.81
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.81
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.41
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 96.33
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.25
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.97
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.96
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.94
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 95.86
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 95.82
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 95.74
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 95.0
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 94.95
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.82
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 94.74
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 94.43
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.88
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.86
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 93.84
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 93.79
1qsa_A 618 Protein (soluble lytic transglycosylase SLT70); al 93.69
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.55
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 92.72
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 92.36
1zbp_A273 Hypothetical protein VPA1032; alpha-beta protein, 92.2
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 92.17
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.75
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.73
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.45
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 91.43
4fhn_B 1139 Nucleoporin NUP120; protein complex,structural pro 91.21
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 90.55
2p58_C116 Putative type III secretion protein YSCG; type III 88.93
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 88.55
2uwj_G115 Type III export protein PSCG; virulence, chaperone 87.89
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 83.1
3lpz_A 336 GET4 (YOR164C homolog); protein targeting, tail-an 81.99
1wy6_A172 Hypothetical protein ST1625; helical repeat protei 81.94
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.4e-39  Score=369.31  Aligned_cols=484  Identities=17%  Similarity=0.113  Sum_probs=398.9

Q ss_pred             hHHHHHHHHHHhhccchhhHHHHHhhhhcCCCchhHHHHHHHHhhcCCHHHHHHHHhcC----CCcchhHHHHHHHhhcC
Q 005133            3 GILTDCVQNSLRYFMYRNAIFLCERLCAEFPSEVNLQLLATCYLQNNQAYAAYNILKGT----QMALSRYLFAVACYQMD   78 (713)
Q Consensus         3 ~~l~~~i~~~l~~~~~~~A~flaerl~a~~~~~~~~~llA~~~~~~~~~~~A~~~l~~~----~~~~~~~l~A~~~~~l~   78 (713)
                      ..+..++..+++.+.|+.|+.+.+++....|++...+.+|.+|+..|++.+|..++++.    .++.+.+.+|.|+.+.|
T Consensus        85 ~~~~~~~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~l~~~~~~~g  164 (597)
T 2xpi_A           85 DYLRLWRHDALMQQQYKCAAFVGEKVLDITGNPNDAFWLAQVYCCTGDYARAKCLLTKEDLYNRSSACRYLAAFCLVKLY  164 (597)
T ss_dssp             HHHHHHHHHHHHTTCHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHTTCHHHHHHHHHHTCGGGTCHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHccCchHHHHHHHHHHhhCCCchHHHHHHHHHHHcCcHHHHHHHHHHHhccccchhHHHHHHHHHHHHh
Confidence            35778999999999999999999999999998888999999999999999999999976    56789999999999999


Q ss_pred             ChhHHHHhhCCCCCC-------------CccCcchHHHHHHHHHHHHhcCChhHHHHHHHHHhhhCCcchHHHHHHHhcC
Q 005133           79 LLSEAEAALSPVNEP-------------SAEIPNGAAGHYLMGLIYRYTDRRKNAIHHYKMALSIDPLLWAAYEELCMLG  145 (713)
Q Consensus        79 ~~~ea~~~L~~~~~~-------------~~~~p~~a~~~~llg~~~~~~~~~~~A~~~y~~Al~~~p~~~~a~~~L~~~~  145 (713)
                      ++++|+.++......             ....|..+.+++.+|.+|.+.|+.++|+++|+++++.+|..++++..|+.+.
T Consensus       165 ~~~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~  244 (597)
T 2xpi_A          165 DWQGALNLLGETNPFRKDEKNANKLLMQDGGIKLEASMCYLRGQVYTNLSNFDRAKECYKEALMVDAKCYEAFDQLVSNH  244 (597)
T ss_dssp             CHHHHHHHHCSSCTTC----------CCCSSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHTT
T ss_pred             hHHHHHHHHhccCCccccccccccccccccccchhHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCchhhHHHHHHHHhh
Confidence            999999999732111             1122445779999999999999999999999999999999999999998775


Q ss_pred             CccchhHHHHHhHHHHHHHHhhhcccccccCCCCCCCCccccCCCCCCCCCChhhhhhhhhcccCCCCCCCCCccccccc
Q 005133          146 AAEEATAVFSEAAALCIQKQYLQNGLATQNLYLPNEDRNLVSSKSAGTEDISPRQLKHMQANNLRDIPGNYHGAAVSAAA  225 (713)
Q Consensus       146 ~~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  225 (713)
                      ........ .....+.+.....  .                          .+......                     
T Consensus       245 ~~~~~~~~-~~~~~l~~~~~~~--~--------------------------~~~~~~~~---------------------  274 (597)
T 2xpi_A          245 LLTADEEW-DLVLKLNYSTYSK--E--------------------------DAAFLRSL---------------------  274 (597)
T ss_dssp             CSCHHHHH-HHHHHSCTHHHHG--G--------------------------GHHHHHHH---------------------
T ss_pred             cccchhHH-HHHHhcCCccccc--c--------------------------hHHHHHHH---------------------
Confidence            44321110 0000000000000  0                          00000000                     


Q ss_pred             cCCCCCCCCCCCCccCCCCCCccCCCCCCCCCcccCCCCCCCCCCCCCCCCCCCccccccccCCccccccCCcccccccc
Q 005133          226 ASQPLNGGPSNASFYNTPSPITTQLSGVAPPPLCRNLQPNGPNLNMLGTDSSPKSTISSTIQAPRRKFVDEGKLRKISGR  305 (713)
Q Consensus       226 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  305 (713)
                                    +..               +...                               ....+...     
T Consensus       275 --------------~~~---------------~~~~-------------------------------~~~~g~~~-----  289 (597)
T 2xpi_A          275 --------------YML---------------KLNK-------------------------------TSHEDELR-----  289 (597)
T ss_dssp             --------------HHT---------------TSCT-------------------------------TTTHHHHH-----
T ss_pred             --------------HHH---------------HHHH-------------------------------HcCcchHH-----
Confidence                          000               0000                               00000000     


Q ss_pred             ccCCCCCCCcccccccccCCCCCccccccCCCCCCCCcccCCCcCcccccccccccCCcCCCccccccCCCCCCCCcccc
Q 005133          306 LFSDSGPRRSTRLAGEAGANANMSTTTVAGNGTTNSSKYLGGSKLSSVALRSVTLRKGQSWANENIDEGMRNEPFDDSRA  385 (713)
Q Consensus       306 ~~~~~~~~~~~rl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  385 (713)
                              ...+++.                                                    .            
T Consensus       290 --------~A~~~~~----------------------------------------------------~------------  297 (597)
T 2xpi_A          290 --------RAEDYLS----------------------------------------------------S------------  297 (597)
T ss_dssp             --------HHHHHHH----------------------------------------------------T------------
T ss_pred             --------HHHHHHH----------------------------------------------------H------------
Confidence                    0000000                                                    0            


Q ss_pred             CcCCccccCCCCCCCccccccCCccccCCCCCCcchhhhhHHHHHHHHHHHHHHHHHHccCCHHHHHHHHHcCcccCCCC
Q 005133          386 NTASTVSSSFPTSDTRSAVQEGTTVPIGGTAMNGSRIMTGASDLLGLLRILGEGYRMSCMYRCKDALDVYLKLPHKHYNT  465 (713)
Q Consensus       386 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~ll~~l~~a~~l~~~g~~~eAi~~l~~~~~~~~~~  465 (713)
                                                    ..   +...      +...++..|..+...|++++|+.+|++++...|.+
T Consensus       298 ------------------------------~~---~~~~------~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~  338 (597)
T 2xpi_A          298 ------------------------------IN---GLEK------SSDLLLCKADTLFVRSRFIDVLAITTKILEIDPYN  338 (597)
T ss_dssp             ------------------------------ST---TGGG------CHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTC
T ss_pred             ------------------------------hh---cCCc------hHHHHHHHHHHHHHhcCHHHHHHHHHHHHHcCccc
Confidence                                          00   0000      12234556677789999999999999999988999


Q ss_pred             HHHHHHHHHHHHHhhcHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Q 005133          466 GWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYS  545 (713)
Q Consensus       466 ~~~~~~lg~~~~~~g~~~eA~~~~~kal~~~p~~~~a~~~la~~l~~~g~~~~A~~~~~kal~~~p~~~~~~~~la~~~~  545 (713)
                      ..++..++.++...|++++|+..|+++++..|.+...+..++.++...|++++|..+++++++..|.+..+|..+|.+|.
T Consensus       339 ~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~  418 (597)
T 2xpi_A          339 LDVYPLHLASLHESGEKNKLYLISNDLVDRHPEKAVTWLAVGIYYLCVNKISEARRYFSKSSTMDPQFGPAWIGFAHSFA  418 (597)
T ss_dssp             CTTHHHHHHHHHHHTCHHHHHHHHHHHHHHCTTSHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhCCHHHHHHHHHHHHhhCcccHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCCHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHH
Q 005133          546 LQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQEKFEFSEHHF  625 (713)
Q Consensus       546 ~~g~~~~Al~~~~kal~~~p~~~~a~~~lg~~~~~~g~~eeAl~~~~~al~~~p~~~~~~~~lg~~y~~~g~~~eA~~~l  625 (713)
                      ..|++++|+++|+++++..|.+..+|..+|.+|...|++++|+.+|+++++..|.++.+|..+|.+|...|++++|+++|
T Consensus       419 ~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~A~~~~  498 (597)
T 2xpi_A          419 IEGEHDQAISAYTTAARLFQGTHLPYLFLGMQHMQLGNILLANEYLQSSYALFQYDPLLLNELGVVAFNKSDMQTAINHF  498 (597)
T ss_dssp             HHTCHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHTCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHTTCHHHHHHHH
T ss_pred             HcCCHHHHHHHHHHHHHhCccchHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHh------CCCC-HHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCChhHHHHHHHHHHHcCCHHHHHHHHHHHHH
Q 005133          626 RMAFQI------SPHS-SVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKANILLSLEKFDEALEVLEELKE  698 (713)
Q Consensus       626 ~kal~~------~p~~-~~~~~~la~~~~~~g~~eeAl~~l~kal~~~p~~~~~~~~la~~~~~~g~~~eA~~~~~kal~  698 (713)
                      +++++.      +|+. ..++..+|.++.+.|++++|+..|+++++..|+++.++..+|.+|...|++++|+.+|+++++
T Consensus       499 ~~~~~~~~~~~~~p~~~~~~~~~l~~~~~~~g~~~~A~~~~~~~~~~~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~~l~  578 (597)
T 2xpi_A          499 QNALLLVKKTQSNEKPWAATWANLGHAYRKLKMYDAAIDALNQGLLLSTNDANVHTAIALVYLHKKIPGLAITHLHESLA  578 (597)
T ss_dssp             HHHHHHHHHSCCCSGGGHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             HHHHHhhhccccchhhHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCHHHHHHHHHHHHh
Confidence            999998      5654 789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HCCCChhHHHhccC
Q 005133          699 YAPRESGVYALMGC  712 (713)
Q Consensus       699 l~P~~~~~~~~Lg~  712 (713)
                      ++|+++.++..||.
T Consensus       579 ~~p~~~~~~~~l~~  592 (597)
T 2xpi_A          579 ISPNEIMASDLLKR  592 (597)
T ss_dssp             HCTTCHHHHHHHHH
T ss_pred             cCCCChHHHHHHHH
Confidence            99999999998874
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1qsa_A Protein (soluble lytic transglycosylase SLT70); alpha-superhelix, transferase; HET: GOL; 1.65A {Escherichia coli} SCOP: a.118.5.1 d.2.1.6 PDB: 1qte_A* 1sly_A* Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2p58_C Putative type III secretion protein YSCG; type III secretion system, structure, needle protein, YSCE, YSCF, transport protein/chaperone complex; 1.80A {Yersinia pestis} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>2uwj_G Type III export protein PSCG; virulence, chaperones, coiled coil, needle formation, type III secretion, bacterial pathogenicity; 2.0A {Pseudomonas aeruginosa} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>1wy6_A Hypothetical protein ST1625; helical repeat protein, structural genomics, unknown function; 2.20A {Sulfolobus tokodaii} SCOP: a.118.20.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 713
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-24
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-23
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-18
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-16
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 1e-15
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 8e-14
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 7e-10
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-09
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-04
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 5e-17
d1dcea1 334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 1e-06
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 6e-04
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 5e-15
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 2e-04
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 6e-14
d2c2la1201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-07
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 2e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 8e-11
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 0.003
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 9e-11
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-07
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.002
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 1e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 2e-10
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 4e-06
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-10
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 1e-05
d2h6fa1 315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 7e-04
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 4e-10
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 7e-09
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 3e-09
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 7e-09
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-06
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-05
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 2e-08
d1a17a_159 a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo 6e-04
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 7e-07
d1ihga1169 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos tau 1e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 4e-06
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-05
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 6e-06
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 2e-05
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 9e-06
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 4e-04
d2ff4a2179 a.118.8.3 (A:105-283) Probable regulatory protein 1e-05
d1kt1a1168 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {M 2e-05
d1p5qa1170 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal d 7e-04
d2fbna1153 a.118.8.1 (A:22-174) Putative 70 kda peptidylproly 8e-04
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 0.001
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 0.004
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  103 bits (256), Expect = 4e-24
 Identities = 38/215 (17%), Positives = 77/215 (35%)

Query: 497 PYSLEGMDIYSTVLYHLKEDMKLSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKN 556
           P           V     E     +  ++ +T D     ++  +GN     +  + A+  
Sbjct: 166 PNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDRAVAA 225

Query: 557 FQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVDARHYNSWYGLGMVYLRQE 616
           + RA+ L+P  A  H      Y      +  I +Y+ A+ +     +++  L      + 
Sbjct: 226 YLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKG 285

Query: 617 KFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQK 676
               +E  +  A ++ P  +  ++ L           EA+ +  KA+    +        
Sbjct: 286 SVAEAEDCYNTALRLCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNL 345

Query: 677 ANILLSLEKFDEALEVLEELKEYAPRESGVYALMG 711
           A++L    K  EAL   +E    +P  +  Y+ MG
Sbjct: 346 ASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMG 380
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Length = 169 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 179 Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 168 Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Length = 153 Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query713
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.9
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.87
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.87
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.83
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.81
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.78
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.66
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.64
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.61
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.58
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.57
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.57
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.56
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.55
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.48
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.47
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.45
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.42
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.39
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.37
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.37
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.35
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.35
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.33
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.32
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.32
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.3
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.3
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.29
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.29
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.28
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.94
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.93
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.9
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.89
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.87
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.75
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.58
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.07
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 98.07
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.92
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 96.89
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.72
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 96.27
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 94.29
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=5.9e-34  Score=302.67  Aligned_cols=247  Identities=18%  Similarity=0.162  Sum_probs=237.6

Q ss_pred             HHHHHccCCHHHHHHHHHcCcccCCCCHHHHHHHHHHHHHhhcHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHH
Q 005133          439 GYRMSCMYRCKDALDVYLKLPHKHYNTGWVLSQVGKAYFEVVDYLEAERAFTLARRASPYSLEGMDIYSTVLYHLKEDMK  518 (713)
Q Consensus       439 a~~l~~~g~~~eAi~~l~~~~~~~~~~~~~~~~lg~~~~~~g~~~eA~~~~~kal~~~p~~~~a~~~la~~l~~~g~~~~  518 (713)
                      +......+....+...+.+.+...|..+.++..+|..+...|++++|+..++++++.+|++..++..+|.++...|++++
T Consensus       142 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~  221 (388)
T d1w3ba_         142 GNLLKALGRLEEAKACYLKAIETQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTLDPNFLDAYINLGNVLKEARIFDR  221 (388)
T ss_dssp             HHHHHTTSCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTTTCTTH
T ss_pred             cccccccchhhhhHHHHHHhhccCcchhHHHHhhcccccccCcHHHHHHHHHHHHHhCcccHHHHHHHhhhhhccccHHH
Confidence            33445677888888889888889999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhCCCCHHHHHHHHHHHHhcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHccCHHHHHHHHHHHHHhC
Q 005133          519 LSYLAQELITTDRLAPQSWCAMGNCYSLQKDHETALKNFQRAVQLNPRFAYGHTLCGHEYVALEDFENGIRSYQSALRVD  598 (713)
Q Consensus       519 A~~~~~kal~~~p~~~~~~~~la~~~~~~g~~~~Al~~~~kal~~~p~~~~a~~~lg~~~~~~g~~eeAl~~~~~al~~~  598 (713)
                      |+..++++....+.....+..+|.++...|++++|+.+|+++++++|+++.++..+|.++...|++++|+..|++++...
T Consensus       222 A~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~  301 (388)
T d1w3ba_         222 AVAAYLRALSLSPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANALKEKGSVAEAEDCYNTALRLC  301 (388)
T ss_dssp             HHHHHHHHHHHCTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSSCHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHhHHHhhhHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHhhhccC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCChHHHHHHHHHHHHhCCCChhHHHHHHH
Q 005133          599 ARHYNSWYGLGMVYLRQEKFEFSEHHFRMAFQISPHSSVIMSYLGTAMHALKRSGEAIEMMEKAILADKKNPLPMYQKAN  678 (713)
Q Consensus       599 p~~~~~~~~lg~~y~~~g~~~eA~~~l~kal~~~p~~~~~~~~la~~~~~~g~~eeAl~~l~kal~~~p~~~~~~~~la~  678 (713)
                      |.+...+..+|.++...|++++|+.+|+++++.+|+++.++..+|.+|...|++++|+.+|+++++++|+++.++..+|.
T Consensus       302 ~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~  381 (388)
T d1w3ba_         302 PTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGN  381 (388)
T ss_dssp             TTCHHHHHHHHHHHHTTTCHHHHHHHHHHHTTSCTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHH
T ss_pred             CccchhhhHHHHHHHHCCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHcCC
Q 005133          679 ILLSLEK  685 (713)
Q Consensus       679 ~~~~~g~  685 (713)
                      +|.++||
T Consensus       382 ~~~~~~D  388 (388)
T d1w3ba_         382 TLKEMQD  388 (388)
T ss_dssp             HHHHTCC
T ss_pred             HHHHcCC
Confidence            9999986
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure