Citrus Sinensis ID: 005139


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710--
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIEVRQ
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHcccccccccccHHHHHHHHHccccccccccccccccccHHHHHHcHHccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccc
cccEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHcccccHEEEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccHHHHcccHHHHHHHHccHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccc
mpgiimddiheegvvselngnstpvkensvsnkspkstpcpqsprdqpdgegvdTSIEQLYENVcdmqssdqspsrhsfgsdgeesriDSELRHlvggemreveimeeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpglgpLLLKQARELISSGDNPQKALELALRAAKSfeigangkpsLELVMCLHVIAAIYCSlgqyneaipvleqsieipvieeGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQkqvlgetdprvGETCRYLAEAHVQALQFSEAQKFCQMALDIhkdngspaslEEAADRRLMGLICETKGDHEAALEHLVLASMTMIAndqdaevasvdcsigdtylslsrydEAGFAYQKALTAFktnkgenhpaVASVFVRLADMYNrtgklreskSYCENALRiyekpvpgvppeeiasgltdVSSIYESMNELEQAIKLLQKALKIyndapgqqstvAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEqecgpyhpdtlgvysNLAGTYdaigreeklgtanpdvdDEKRRLAELLKEAGRVRSRKAQSLETLLDAnsrvnndgievrq
mpgiimddihEEGVVSelngnstpvkensvsnkspkstpcpqsprdqpdGEGVDTSIEQLYENVCDMQSSDQSPSRhsfgsdgeesridsELRHLVGGEMREVEIMEeeevekpeddshsissskkgsssgskksgkleksqsagtksissghskkvshsgmdsevssktnskgkslpekppidkgvkksnagatpmkkrkgklhkgqdvseagldkpgLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAfktnkgenhpAVASVFVRLADMYNRtgklresksyCENALRIyekpvpgvppeEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEklgtanpdvddekRRLAELLKeagrvrsrkaqsletlldansrvnndgievrq
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGemreveimeeeevekpeDDshsissskkgsssgskksgkleksqsAGTksissghskkvshsgMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAgldkpglgplllkQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIEVRQ
***************************************************************************************************************************************************************************************************************************************************LALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH**************RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGV****IASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIG********************************************************
*PGI*************************************************DTSIEQLYE*************************IDSELRHLVGGEMREV*****************************************************************************PPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDA*************
MPGIIMDDIHEEGVVSELNGN******************************GVDTSIEQLYENVC***********************DSELRHLVGGEMREVEIM*************************************************************************KPPIDKG*************************EAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVNNDGIEVRQ
********IHE***********************************QPDGEGVDTSIEQLYENVCDMQ******************RIDSELRHLVGGEMREVEIMEEEEVEKP************************************************************KSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSRVN********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQPDGEGVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSELRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISSGHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDKGVKKSNAGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDxxxxxxxxxxxxxxxxxxxxxxxxxxxxPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGREEKLGTANPDxxxxxxxxxxxxxxxxxxxxxKAQSLETLLDANSRVNNDGIEVRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query712 2.2.26 [Sep-21-2011]
Q5PQM2619 Kinesin light chain 4 OS= yes no 0.220 0.253 0.276 1e-10
Q9DBS5619 Kinesin light chain 4 OS= yes no 0.219 0.252 0.278 2e-10
P46822540 Kinesin light chain OS=Ca no no 0.330 0.435 0.254 3e-10
Q9NSK0619 Kinesin light chain 4 OS= yes no 0.220 0.253 0.270 5e-10
Q2HJJ0616 Kinesin light chain 4 OS= yes no 0.219 0.253 0.265 7e-10
Q05090 686 Kinesin light chain OS=St no no 0.220 0.228 0.276 2e-09
P46824508 Kinesin light chain OS=Dr yes no 0.296 0.415 0.259 2e-09
Q9H0B6 622 Kinesin light chain 2 OS= no no 0.269 0.308 0.252 2e-09
A0JM231311 Nephrocystin-3 OS=Xenopus yes no 0.435 0.236 0.227 2e-09
O88448599 Kinesin light chain 2 OS= no no 0.269 0.320 0.247 3e-09
>sp|Q5PQM2|KLC4_RAT Kinesin light chain 4 OS=Rattus norvegicus GN=Klc4 PE=2 SV=1 Back     alignment and function desciption
 Score = 68.9 bits (167), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 81/159 (50%), Gaps = 2/159 (1%)

Query: 430 EVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGK 489
           +VA++   +   Y   ++Y EA      AL+  ++  G +HPAVA+    LA +Y + GK
Sbjct: 251 DVATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGK 310

Query: 490 LRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYND 549
            +E++  C+ AL I EK V G    ++A  L +++ + ++  + E   +  Q+AL IY  
Sbjct: 311 YKEAEPLCQRALEIREK-VLGTDHPDVAKQLNNLALLCQNQGKYEAVERYYQRALAIYER 369

Query: 550 APGQQS-TVAGIEAQMGVMYYMLGNYSDSYDSFKNAISK 587
             G  +  VA  +  +   Y   G YS++   +K  +++
Sbjct: 370 QLGPDNPNVARTKNNLASCYLKQGKYSEAETLYKEILTR 408




Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport. The light chain may function in coupling of cargo to the heavy chain or in the modulation of its ATPase activity.
Rattus norvegicus (taxid: 10116)
>sp|Q9DBS5|KLC4_MOUSE Kinesin light chain 4 OS=Mus musculus GN=Klc4 PE=1 SV=1 Back     alignment and function description
>sp|P46822|KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans GN=klc-2 PE=2 SV=2 Back     alignment and function description
>sp|Q9NSK0|KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens GN=KLC4 PE=1 SV=3 Back     alignment and function description
>sp|Q2HJJ0|KLC4_BOVIN Kinesin light chain 4 OS=Bos taurus GN=KLC4 PE=2 SV=2 Back     alignment and function description
>sp|Q05090|KLC_STRPU Kinesin light chain OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description
>sp|P46824|KLC_DROME Kinesin light chain OS=Drosophila melanogaster GN=Klc PE=1 SV=1 Back     alignment and function description
>sp|Q9H0B6|KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens GN=KLC2 PE=1 SV=1 Back     alignment and function description
>sp|A0JM23|NPHP3_XENTR Nephrocystin-3 OS=Xenopus tropicalis GN=nphp3 PE=2 SV=2 Back     alignment and function description
>sp|O88448|KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus GN=Klc2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query712
255540685767 kinesin light chain, putative [Ricinus c 0.997 0.925 0.774 0.0
359491584757 PREDICTED: uncharacterized protein LOC10 0.985 0.927 0.764 0.0
449477406736 PREDICTED: LOW QUALITY PROTEIN: uncharac 0.990 0.957 0.721 0.0
449440678736 PREDICTED: uncharacterized protein LOC10 0.990 0.957 0.720 0.0
356507244761 PREDICTED: uncharacterized protein LOC10 0.987 0.923 0.692 0.0
356518977753 PREDICTED: uncharacterized protein LOC10 0.988 0.934 0.680 0.0
357461993767 Kinesin light chain [Medicago truncatula 0.988 0.917 0.651 0.0
357461995795 Kinesin light chain [Medicago truncatula 0.988 0.885 0.651 0.0
224133522624 predicted protein [Populus trichocarpa] 0.849 0.969 0.754 0.0
359488843710 PREDICTED: uncharacterized protein LOC10 0.952 0.954 0.663 0.0
>gi|255540685|ref|XP_002511407.1| kinesin light chain, putative [Ricinus communis] gi|223550522|gb|EEF52009.1| kinesin light chain, putative [Ricinus communis] Back     alignment and taxonomy information
 Score = 1110 bits (2870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/766 (77%), Positives = 647/766 (84%), Gaps = 56/766 (7%)

Query: 1   MPGIIMDDIHEEGVVSELNGNSTPVKENSVSNKSPKSTPCPQSPRDQ---------PDGE 51
           MPGI+MD  +EE +V+E+N NS P+KEN++SNKSP+ST  PQSP            P GE
Sbjct: 1   MPGIVMDGNNEEAIVNEMNDNSVPIKENAMSNKSPRSTLSPQSPCSNSVDLPAGGVPVGE 60

Query: 52  --------------------GVDTSIEQLYENVCDMQSSDQSPSRHSFGSDGEESRIDSE 91
                               GVDTSIEQLYENVCDMQSSD SPSRHSFGSDGEESRIDSE
Sbjct: 61  LTVDEVVVNEVAADETSVHGGVDTSIEQLYENVCDMQSSDLSPSRHSFGSDGEESRIDSE 120

Query: 92  LRHLVGGEMREVEIMEEEEVEKPEDDSHSISSSKKGSSSGSKKSGKLEKSQSAGTKSISS 151
           LRHLVGGEMREVEIM+EEEV+KPE+D+HS SSSKKGSSSGSKKSGKL K+QSA + SISS
Sbjct: 121 LRHLVGGEMREVEIMQEEEVDKPENDTHSNSSSKKGSSSGSKKSGKLNKNQSASSNSISS 180

Query: 152 GHSKKVSHSGMDSEVSSKTNSKGKSLPEKPPIDK----GVKKSNAGATPMKKRKG----- 202
             SKK SH  +DSE SSK + K KS PEKPPIDK      KK+N G    KK +      
Sbjct: 181 NTSKKDSHIILDSEASSKLSPKSKSPPEKPPIDKRNDKNFKKANGGVKSTKKWRNSPLGG 240

Query: 203 -KLHKG-QDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKP 260
            KL  G +D S++GL  P LG  LLKQ+R+LISSGDNPQKALELALRA+KSFEI ANGKP
Sbjct: 241 KKLQNGVEDSSDSGLGNPDLGRFLLKQSRDLISSGDNPQKALELALRASKSFEICANGKP 300

Query: 261 SLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 320
           SLELVM LHV+AAIYCS+GQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM
Sbjct: 301 SLELVMSLHVVAAIYCSVGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAM 360

Query: 321 LGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIH 380
           LGQLENS  CYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQF +A++ CQMALDIH
Sbjct: 361 LGQLENSTKCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFDDAKRLCQMALDIH 420

Query: 381 KDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGD 440
           ++NG+PAS EEAADRRLMGLICETKGDHEAALEHLVLASM M+AN Q+AEVASVDCSIGD
Sbjct: 421 RENGAPASPEEAADRRLMGLICETKGDHEAALEHLVLASMAMVANGQEAEVASVDCSIGD 480

Query: 441 TYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENA 500
           TYLSLSRYDEA FAYQKALTAFKT KGENHPAVA+VFVRLAD+YN+TGKLR+SKSYCENA
Sbjct: 481 TYLSLSRYDEAVFAYQKALTAFKTTKGENHPAVAAVFVRLADLYNKTGKLRDSKSYCENA 540

Query: 501 LRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGI 560
           LRIYEKP PG+PPEEIASGLTDVS+IYESMNELEQAIKLLQKALKIYNDAPGQQST+AGI
Sbjct: 541 LRIYEKPAPGIPPEEIASGLTDVSAIYESMNELEQAIKLLQKALKIYNDAPGQQSTIAGI 600

Query: 561 EAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAV 620
           EAQMGVMYYMLGNYS+SY++FKNA+SKLRA GERKSAFFG+ALNQMGLACVQRYSINEA 
Sbjct: 601 EAQMGVMYYMLGNYSESYNTFKNAVSKLRASGERKSAFFGIALNQMGLACVQRYSINEAA 660

Query: 621 ELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIG---------------REEKLGTAN 665
           ELFEEA+SILEQECGPYHPDTLGVYSNLAGTYDA+G               REEKLGTAN
Sbjct: 661 ELFEEAKSILEQECGPYHPDTLGVYSNLAGTYDAMGRLDDAIEILELVVGMREEKLGTAN 720

Query: 666 PDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSR-VNNDGIEV 710
           PDVDDEK+RLAELLKEAGRVRSRK +SLE LLD+NS  ++  GI V
Sbjct: 721 PDVDDEKKRLAELLKEAGRVRSRKGRSLENLLDSNSHSIDKAGIPV 766




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359491584|ref|XP_002279663.2| PREDICTED: uncharacterized protein LOC100255253 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449477406|ref|XP_004155014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449440678|ref|XP_004138111.1| PREDICTED: uncharacterized protein LOC101208453 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356507244|ref|XP_003522379.1| PREDICTED: uncharacterized protein LOC100791625 [Glycine max] Back     alignment and taxonomy information
>gi|356518977|ref|XP_003528151.1| PREDICTED: uncharacterized protein LOC100783201 [Glycine max] Back     alignment and taxonomy information
>gi|357461993|ref|XP_003601278.1| Kinesin light chain [Medicago truncatula] gi|355490326|gb|AES71529.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|357461995|ref|XP_003601279.1| Kinesin light chain [Medicago truncatula] gi|355490327|gb|AES71530.1| Kinesin light chain [Medicago truncatula] Back     alignment and taxonomy information
>gi|224133522|ref|XP_002321593.1| predicted protein [Populus trichocarpa] gi|222868589|gb|EEF05720.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359488843|ref|XP_002274441.2| PREDICTED: uncharacterized protein LOC100254332 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query712
TAIR|locus:2015959650 KLCR3 "AT1G27500" [Arabidopsis 0.75 0.821 0.663 8.2e-201
TAIR|locus:2086834663 KLCR2 "kinesin light chain-rel 0.758 0.814 0.618 1.4e-196
TAIR|locus:2123411609 KLCR1 "kinesin light chain-rel 0.665 0.778 0.636 1.9e-168
TAIR|locus:2042506617 AT2G31240 "AT2G31240" [Arabido 0.641 0.740 0.268 7.5e-37
ASPGD|ASPL00000183131288 AN3547 [Emericella nidulans (t 0.573 0.316 0.220 2.1e-18
ASPGD|ASPL00000615671185 AN1071 [Emericella nidulans (t 0.609 0.366 0.221 4.8e-12
UNIPROTKB|Q6AZT71300 nphp3 "Nephrocystin-3" [Xenopu 0.200 0.11 0.282 5.9e-12
UNIPROTKB|Q21592516 klc-1 "Protein KLC-1, isoform 0.345 0.476 0.244 7.5e-12
WB|WBGene00002214536 klc-1 [Caenorhabditis elegans 0.345 0.458 0.244 8.1e-12
WB|WBGene00002215540 klc-2 [Caenorhabditis elegans 0.366 0.483 0.25 1.4e-11
TAIR|locus:2015959 KLCR3 "AT1G27500" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1810 (642.2 bits), Expect = 8.2e-201, Sum P(2) = 8.2e-201
 Identities = 372/561 (66%), Positives = 437/561 (77%)

Query:   165 EVSSKTNSKGKSL---P---EKPPIDKGVKKSNAGATPMKKRK-G--KLHKGQDVSEAXX 215
             E   K+NS    L   P   EK    K V KSN G   M+K+K G  KL  G +  E   
Sbjct:    84 EFDVKSNSSNLDLEVMPRDMEKQTGKKNVTKSNVGVGGMRKKKVGGTKLQNGNE--EPSS 141

Query:   216 XXXXXXXXXXXQARELISSGDNPQKALELALRAAKSFEIGA-NGKPSLELVMCLHVIAAI 274
                        QAR L+SSGD+  KALEL  RAAK FE  A NGKP LE +MCLHV AA+
Sbjct:   142 ENVELARFLLNQARNLVSSGDSTHKALELTHRAAKLFEASAENGKPCLEWIMCLHVTAAV 201

Query:   275 YCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTG 334
             +C L +YNEAIPVL++S+EIPV+EEG+EHALAKFAG MQLGDTYAM+GQLE+S+ CYT G
Sbjct:   202 HCKLKEYNEAIPVLQRSVEIPVVEEGEEHALAKFAGLMQLGDTYAMVGQLESSISCYTEG 261

Query:   335 LEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAAD 394
             L +QK+VLGE DPRVGETCRYLAEA VQAL+F EAQ+ C+ AL IH+++G P S+ EAAD
Sbjct:   262 LNIQKKVLGENDPRVGETCRYLAEALVQALRFDEAQQVCETALSIHRESGLPGSIAEAAD 321

Query:   395 RRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFA 454
             RRLMGLICETKGDHE ALEHLVLASM M AN Q++EVA VD SIGD+YLSLSR+DEA  A
Sbjct:   322 RRLMGLICETKGDHENALEHLVLASMAMAANGQESEVAFVDTSIGDSYLSLSRFDEAICA 381

Query:   455 YQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPE 514
             YQK+LTA KT KGENHPAV SV++RLAD+YNRTGK+RE+KSYCENALRIYE     + PE
Sbjct:   382 YQKSLTALKTAKGENHPAVGSVYIRLADLYNRTGKVREAKSYCENALRIYESHNLEISPE 441

Query:   515 EIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNY 574
             EIASGLTD+S I ESMNE+EQAI LLQKALKIY D+PGQ+  +AGIEAQMGV+YYM+G Y
Sbjct:   442 EIASGLTDISVICESMNEVEQAITLLQKALKIYADSPGQKIMIAGIEAQMGVLYYMMGKY 501

Query:   575 SDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQEC 634
              +SY++FK+AISKLRA G+++S FFG+ALNQMGLAC+Q  +I EAVELFEEA+ ILEQEC
Sbjct:   502 MESYNTFKSAISKLRATGKKQSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCILEQEC 561

Query:   635 GPYHPDTLGVYSNLAGTYDAIGR---------------EEKLGTANPDVDDEKRRLAELL 679
             GPYHP+TLG+YSNLAG YDAIGR               EEKLGTANP  +DEKRRLA+LL
Sbjct:   562 GPYHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVREEKLGTANPVTEDEKRRLAQLL 621

Query:   680 KEAGRVRSRKAQSLETLLDAN 700
             KEAG V  RKA+SL+TL+D++
Sbjct:   622 KEAGNVTGRKAKSLKTLIDSD 642


GO:0005575 "cellular_component" evidence=ND
TAIR|locus:2086834 KLCR2 "kinesin light chain-related 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2123411 KLCR1 "kinesin light chain-related 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042506 AT2G31240 "AT2G31240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000018313 AN3547 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
ASPGD|ASPL0000061567 AN1071 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZT7 nphp3 "Nephrocystin-3" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q21592 klc-1 "Protein KLC-1, isoform a" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00002214 klc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00002215 klc-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query712
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 3e-10
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-09
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-09
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 1e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 5e-07
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 8e-07
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 5e-06
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-06
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 2e-05
COG0457291 COG0457, NrfG, FOG: TPR repeat [General function p 2e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 3e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 6e-05
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-05
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 1e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 2e-04
TIGR02917899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 6e-04
pfam1342478 pfam13424, TPR_12, Tetratricopeptide repeat 7e-04
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.001
TIGR02917 899 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system 0.003
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
 Score = 57.4 bits (139), Expect = 3e-10
 Identities = 29/111 (26%), Positives = 47/111 (42%), Gaps = 17/111 (15%)

Query: 436 CSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKS 495
            ++G+ Y  L  YDEA   Y+KAL     N        A  +  LA  Y + GK  E+  
Sbjct: 4   LNLGNLYYKLGDYDEALEYYEKALELDPDN--------ADAYYNLAAAYYKLGKYEEALE 55

Query: 496 YCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKI 546
             E AL +             A    ++   Y  + + E+A++  +KAL++
Sbjct: 56  DYEKALELDPDN---------AKAYYNLGLAYYKLGKYEEALEAYEKALEL 97


Length = 100

>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|223533 COG0457, NrfG, FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>gnl|CDD|205602 pfam13424, TPR_12, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|234059 TIGR02917, PEP_TPR_lipo, putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 712
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 100.0
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 100.0
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.98
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.97
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.96
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 99.96
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 99.95
KOG0547606 consensus Translocase of outer mitochondrial membr 99.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.95
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.94
KOG0547606 consensus Translocase of outer mitochondrial membr 99.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.94
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.92
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.92
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.91
KOG1130 639 consensus Predicted G-alpha GTPase interaction pro 99.9
PRK11788389 tetratricopeptide repeat protein; Provisional 99.9
KOG1126638 consensus DNA-binding cell division cycle control 99.89
KOG2003 840 consensus TPR repeat-containing protein [General f 99.89
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.89
KOG1126638 consensus DNA-binding cell division cycle control 99.89
PRK14574 822 hmsH outer membrane protein; Provisional 99.89
PRK11788389 tetratricopeptide repeat protein; Provisional 99.88
KOG2003 840 consensus TPR repeat-containing protein [General f 99.88
KOG2076 895 consensus RNA polymerase III transcription factor 99.88
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.87
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.87
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.86
PLN03218 1060 maturation of RBCL 1; Provisional 99.85
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 99.85
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.84
KOG2076 895 consensus RNA polymerase III transcription factor 99.83
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.83
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 99.83
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 99.83
PRK14574 822 hmsH outer membrane protein; Provisional 99.82
PLN03218 1060 maturation of RBCL 1; Provisional 99.8
PLN03077 857 Protein ECB2; Provisional 99.79
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.79
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 99.79
KOG1129478 consensus TPR repeat-containing protein [General f 99.78
PRK04841 903 transcriptional regulator MalT; Provisional 99.78
PRK04841903 transcriptional regulator MalT; Provisional 99.77
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 99.75
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.75
KOG1941518 consensus Acetylcholine receptor-associated protei 99.75
PLN03077 857 Protein ECB2; Provisional 99.74
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.73
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.72
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.72
PRK12370553 invasion protein regulator; Provisional 99.72
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 99.72
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.72
KOG1941518 consensus Acetylcholine receptor-associated protei 99.71
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.71
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.71
PRK12370553 invasion protein regulator; Provisional 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.7
KOG4162799 consensus Predicted calmodulin-binding protein [Si 99.7
cd05804355 StaR_like StaR_like; a well-conserved protein foun 99.69
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.68
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 99.68
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.68
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.68
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.68
PRK11189296 lipoprotein NlpI; Provisional 99.68
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.67
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.66
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.66
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.66
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 99.66
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 99.66
KOG1125579 consensus TPR repeat-containing protein [General f 99.64
PRK10747398 putative protoheme IX biogenesis protein; Provisio 99.64
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 99.62
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 99.62
KOG2376 652 consensus Signal recognition particle, subunit Srp 99.62
KOG1125579 consensus TPR repeat-containing protein [General f 99.61
KOG2376652 consensus Signal recognition particle, subunit Srp 99.61
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.6
KOG1915 677 consensus Cell cycle control protein (crooked neck 99.56
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.56
KOG3785557 consensus Uncharacterized conserved protein [Funct 99.5
KOG2300629 consensus Uncharacterized conserved protein [Funct 99.49
KOG1915677 consensus Cell cycle control protein (crooked neck 99.48
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.48
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 99.46
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.42
KOG2300 629 consensus Uncharacterized conserved protein [Funct 99.4
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.39
PLN02789320 farnesyltranstransferase 99.39
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 99.37
PLN02789320 farnesyltranstransferase 99.36
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.32
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 99.29
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.28
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.23
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 99.2
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.2
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.2
PRK15359144 type III secretion system chaperone protein SscB; 99.18
PRK15359144 type III secretion system chaperone protein SscB; 99.17
KOG3617 1416 consensus WD40 and TPR repeat-containing protein [ 99.17
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.17
KOG1128777 consensus Uncharacterized conserved protein, conta 99.17
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 99.16
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.15
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.13
PRK10370198 formate-dependent nitrite reductase complex subuni 99.09
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.08
KOG4340459 consensus Uncharacterized conserved protein [Funct 99.08
PRK10370198 formate-dependent nitrite reductase complex subuni 99.07
KOG1128777 consensus Uncharacterized conserved protein, conta 99.06
KOG3060289 consensus Uncharacterized conserved protein [Funct 99.06
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 99.0
PF10345608 Cohesin_load: Cohesin loading factor; InterPro: IP 98.99
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.99
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.98
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.96
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.95
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.93
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.92
KOG0553304 consensus TPR repeat-containing protein [General f 98.91
KOG1585308 consensus Protein required for fusion of vesicles 98.89
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 98.88
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.88
KOG0553304 consensus TPR repeat-containing protein [General f 98.88
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.88
KOG3616 1636 consensus Selective LIM binding factor [Transcript 98.87
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.87
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.86
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.83
COG2909894 MalT ATP-dependent transcriptional regulator [Tran 98.83
KOG1585308 consensus Protein required for fusion of vesicles 98.82
KOG2471696 consensus TPR repeat-containing protein [General f 98.81
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 98.8
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.79
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.78
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.76
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.74
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.73
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.71
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.7
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.69
KOG1586288 consensus Protein required for fusion of vesicles 98.69
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.68
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.68
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.67
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.65
COG3898531 Uncharacterized membrane-bound protein [Function u 98.64
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.63
KOG1586288 consensus Protein required for fusion of vesicles 98.62
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.6
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.56
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.55
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.53
KOG2471696 consensus TPR repeat-containing protein [General f 98.52
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 98.52
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.52
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.51
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.5
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.49
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.49
KOG18391236 consensus Uncharacterized protein CLU1/cluA/TIF31 98.48
PF12688120 TPR_5: Tetratrico peptide repeat 98.44
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.42
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.41
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.4
PF12688120 TPR_5: Tetratrico peptide repeat 98.4
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.37
PRK10803263 tol-pal system protein YbgF; Provisional 98.34
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.32
PRK10803263 tol-pal system protein YbgF; Provisional 98.3
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.3
COG0457291 NrfG FOG: TPR repeat [General function prediction 98.3
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.27
COG3898531 Uncharacterized membrane-bound protein [Function u 98.27
PRK15331165 chaperone protein SicA; Provisional 98.24
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.23
PRK11906458 transcriptional regulator; Provisional 98.23
KOG4555175 consensus TPR repeat-containing protein [Function 98.22
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 98.22
KOG4555175 consensus TPR repeat-containing protein [Function 98.21
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.2
KOG1464440 consensus COP9 signalosome, subunit CSN2 [Posttran 98.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.18
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.16
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.16
PRK11906458 transcriptional regulator; Provisional 98.15
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.15
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.14
COG5159421 RPN6 26S proteasome regulatory complex component [ 98.14
COG4700251 Uncharacterized protein conserved in bacteria cont 98.13
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.11
PRK15331165 chaperone protein SicA; Provisional 98.11
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.11
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 98.11
KOG1463411 consensus 26S proteasome regulatory complex, subun 98.09
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.08
COG4105254 ComL DNA uptake lipoprotein [General function pred 98.07
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 98.07
KOG2796366 consensus Uncharacterized conserved protein [Funct 98.04
KOG4234271 consensus TPR repeat-containing protein [General f 98.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.03
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.02
KOG4234271 consensus TPR repeat-containing protein [General f 98.01
COG1729262 Uncharacterized protein conserved in bacteria [Fun 97.97
KOG2796366 consensus Uncharacterized conserved protein [Funct 97.92
COG4700251 Uncharacterized protein conserved in bacteria cont 97.92
PF13512142 TPR_18: Tetratricopeptide repeat 97.9
KOG20411189 consensus WD40 repeat protein [General function pr 97.9
COG5159421 RPN6 26S proteasome regulatory complex component [ 97.89
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.86
KOG2610491 consensus Uncharacterized conserved protein [Funct 97.85
PF13512142 TPR_18: Tetratricopeptide repeat 97.85
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.83
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.82
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.78
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.78
PF1337173 TPR_9: Tetratricopeptide repeat 97.76
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.72
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.7
PF1337173 TPR_9: Tetratricopeptide repeat 97.7
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.68
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.68
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.68
KOG0985 1666 consensus Vesicle coat protein clathrin, heavy cha 97.66
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 97.62
KOG1550552 consensus Extracellular protein SEL-1 and related 97.61
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 97.6
KOG4648 536 consensus Uncharacterized conserved protein, conta 97.58
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.52
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.46
KOG2610 491 consensus Uncharacterized conserved protein [Funct 97.44
KOG1550552 consensus Extracellular protein SEL-1 and related 97.43
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.41
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 97.37
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.36
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 97.36
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.34
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 97.34
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 97.33
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.33
KOG20411189 consensus WD40 repeat protein [General function pr 97.32
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 97.32
PF13281374 DUF4071: Domain of unknown function (DUF4071) 97.3
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.28
PF1342844 TPR_14: Tetratricopeptide repeat 97.26
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 97.23
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.21
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.19
KOG3783546 consensus Uncharacterized conserved protein [Funct 97.15
KOG0890 2382 consensus Protein kinase of the PI-3 kinase family 97.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.12
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 97.1
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.09
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 97.05
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 97.04
PF09986214 DUF2225: Uncharacterized protein conserved in bact 97.04
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.96
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.93
KOG4507 886 consensus Uncharacterized conserved protein, conta 96.9
KOG0545329 consensus Aryl-hydrocarbon receptor-interacting pr 96.86
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 96.86
KOG0551390 consensus Hsp90 co-chaperone CNS1 (contains TPR re 96.84
KOG3783546 consensus Uncharacterized conserved protein [Funct 96.8
PF1342844 TPR_14: Tetratricopeptide repeat 96.79
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.73
PF1286294 Apc5: Anaphase-promoting complex subunit 5 96.73
PF07079 549 DUF1347: Protein of unknown function (DUF1347); In 96.73
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 96.69
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.69
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.64
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 96.63
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.61
PF1343134 TPR_17: Tetratricopeptide repeat 96.58
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 96.54
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 96.47
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.42
PF1343134 TPR_17: Tetratricopeptide repeat 96.36
KOG1538 1081 consensus Uncharacterized conserved protein WDR10, 96.29
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 96.28
COG3118304 Thioredoxin domain-containing protein [Posttransla 96.28
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 96.27
KOG1258577 consensus mRNA processing protein [RNA processing 96.19
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 96.15
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 96.11
COG0790292 FOG: TPR repeat, SEL1 subfamily [General function 95.99
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 95.97
KOG2581493 consensus 26S proteasome regulatory complex, subun 95.76
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.74
KOG1258577 consensus mRNA processing protein [RNA processing 95.71
COG3118304 Thioredoxin domain-containing protein [Posttransla 95.6
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 95.43
PF04910360 Tcf25: Transcriptional repressor TCF25; InterPro: 95.34
KOG0687393 consensus 26S proteasome regulatory complex, subun 95.28
KOG2581493 consensus 26S proteasome regulatory complex, subun 95.27
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 95.12
KOG4322482 consensus Anaphase-promoting complex (APC), subuni 95.01
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 95.0
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 94.98
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.9
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.78
KOG4814872 consensus Uncharacterized conserved protein [Funct 94.67
KOG0376 476 consensus Serine-threonine phosphatase 2A, catalyt 94.6
PF12739414 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 94.53
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.52
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 94.22
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.22
COG5187412 RPN7 26S proteasome regulatory complex component, 94.18
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 94.17
COG5187412 RPN7 26S proteasome regulatory complex component, 94.02
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 93.96
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.92
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.8
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 93.62
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 93.6
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.54
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 93.43
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 93.41
KOG0687393 consensus 26S proteasome regulatory complex, subun 93.11
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 93.11
COG4649221 Uncharacterized protein conserved in bacteria [Fun 93.04
KOG4507886 consensus Uncharacterized conserved protein, conta 92.99
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 92.85
PF04190260 DUF410: Protein of unknown function (DUF410) ; Int 92.73
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 92.6
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.47
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 92.44
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 92.4
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.35
PF08626 1185 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC 92.24
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 92.2
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 92.08
PRK14707 2710 hypothetical protein; Provisional 91.95
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 91.82
PRK14707 2710 hypothetical protein; Provisional 91.75
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 91.65
KOG4014248 consensus Uncharacterized conserved protein (conta 91.34
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.07
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 90.9
KOG4014248 consensus Uncharacterized conserved protein (conta 90.78
KOG0686466 consensus COP9 signalosome, subunit CSN1 [Posttran 90.72
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 89.76
PF11207203 DUF2989: Protein of unknown function (DUF2989); In 89.48
KOG2422665 consensus Uncharacterized conserved protein [Funct 89.34
KOG1497 399 consensus COP9 signalosome, subunit CSN4 [Posttran 88.89
KOG2908 380 consensus 26S proteasome regulatory complex, subun 88.5
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 88.49
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 88.35
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 88.17
PF05053618 Menin: Menin; InterPro: IPR007747 MEN1, the gene r 87.96
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.93
KOG3364149 consensus Membrane protein involved in organellar 87.92
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 87.83
PF15015569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 87.75
KOG2422665 consensus Uncharacterized conserved protein [Funct 87.69
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 87.68
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 87.29
KOG4814872 consensus Uncharacterized conserved protein [Funct 87.1
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 87.08
KOG4521 1480 consensus Nuclear pore complex, Nup160 component [ 86.99
KOG2561 568 consensus Adaptor protein NUB1, contains UBA domai 86.93
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 86.4
KOG1497399 consensus COP9 signalosome, subunit CSN4 [Posttran 86.23
PRK10941269 hypothetical protein; Provisional 86.21
PF09670379 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02 86.21
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 85.87
KOG3364149 consensus Membrane protein involved in organellar 85.81
COG3629280 DnrI DNA-binding transcriptional activator of the 85.8
KOG2114 933 consensus Vacuolar assembly/sorting protein PEP5/V 85.79
PRK13184932 pknD serine/threonine-protein kinase; Reviewed 85.69
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 85.27
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 85.27
KOG19201265 consensus IkappaB kinase complex, IKAP component [ 85.16
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 85.02
COG3947361 Response regulator containing CheY-like receiver a 84.94
PRK10941269 hypothetical protein; Provisional 84.69
KOG3807556 consensus Predicted membrane protein ST7 (tumor su 84.44
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 84.1
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 83.86
smart00101244 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat 83.78
PF04097613 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic9 83.63
KOG2908380 consensus 26S proteasome regulatory complex, subun 83.55
COG3629280 DnrI DNA-binding transcriptional activator of the 83.13
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 82.67
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 81.69
KOG3807 556 consensus Predicted membrane protein ST7 (tumor su 81.52
PF10952140 DUF2753: Protein of unknown function (DUF2753); In 81.4
KOG2561568 consensus Adaptor protein NUB1, contains UBA domai 81.25
KOG4422625 consensus Uncharacterized conserved protein [Funct 80.71
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 80.64
KOG0276794 consensus Vesicle coat complex COPI, beta' subunit 80.06
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
Probab=100.00  E-value=3.9e-43  Score=350.95  Aligned_cols=429  Identities=19%  Similarity=0.261  Sum_probs=285.5

Q ss_pred             cCCCcccccccccccCccccccCCCCCChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHH
Q 005139          192 AGATPMKKRKGKLHKGQDVSEAGLDKPGLGPLLLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVI  271 (712)
Q Consensus       192 ~~~~~~~~~~~~~~a~~~~~~~~~~~p~~~~~l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~l~~l  271 (712)
                      ..+..+...|+|.+|.+........+|.....++.++..++...+ +++....-..+++..         |..+++|.++
T Consensus        53 ~lah~~yq~gd~~~a~~h~nmv~~~d~t~~~~llll~ai~~q~~r-~d~s~a~~~~a~r~~---------~q~ae~ysn~  122 (966)
T KOG4626|consen   53 ELAHRLYQGGDYKQAEKHCNMVGQEDPTNTERLLLLSAIFFQGSR-LDKSSAGSLLAIRKN---------PQGAEAYSNL  122 (966)
T ss_pred             HHHHHHHhccCHHHHHHHHhHhhccCCCcccceeeehhhhhcccc-hhhhhhhhhhhhhcc---------chHHHHHHHH
Confidence            344455556666666655556666666666666666666666654 666666655555443         4456667777


Q ss_pred             HHHHHHcCCHhHHHHHHHHhhchhhhhhcccchHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCChhHHH
Q 005139          272 AAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGE  351 (712)
Q Consensus       272 a~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~  351 (712)
                      |.++...|++++|+.+|+.++++.     ++    .+.+|.++|.++...|+.+.|..+|..++++        +|....
T Consensus       123 aN~~kerg~~~~al~~y~~aiel~-----p~----fida~inla~al~~~~~~~~a~~~~~~alql--------nP~l~c  185 (966)
T KOG4626|consen  123 ANILKERGQLQDALALYRAAIELK-----PK----FIDAYINLAAALVTQGDLELAVQCFFEALQL--------NPDLYC  185 (966)
T ss_pred             HHHHHHhchHHHHHHHHHHHHhcC-----ch----hhHHHhhHHHHHHhcCCCcccHHHHHHHHhc--------Ccchhh
Confidence            777777777777777777776664     22    2345667777777777777777777777766        566666


Q ss_pred             HHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCChhH
Q 005139          352 TCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEV  431 (712)
Q Consensus       352 ~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~a~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~  431 (712)
                      +...+|.++...|+..+|..+|.+|++..+..        +.+|.+||.++..+|+.-.|+.+|++|+      ..+|..
T Consensus       186 a~s~lgnLlka~Grl~ea~~cYlkAi~~qp~f--------AiawsnLg~~f~~~Gei~~aiq~y~eAv------kldP~f  251 (966)
T KOG4626|consen  186 ARSDLGNLLKAEGRLEEAKACYLKAIETQPCF--------AIAWSNLGCVFNAQGEIWLAIQHYEEAV------KLDPNF  251 (966)
T ss_pred             hhcchhHHHHhhcccchhHHHHHHHHhhCCce--------eeeehhcchHHhhcchHHHHHHHHHHhh------cCCCcc
Confidence            66677777777777777777777776655422        3356677777777777777777777666      456666


Q ss_pred             HHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCC
Q 005139          432 ASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGV  511 (712)
Q Consensus       432 ~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~  511 (712)
                      ..+|.+||.+|-..+.|+.|+.+|.+|+.+        .|..+.++.++|.+|+.+|..+-|+..|++++++        
T Consensus       252 ~dAYiNLGnV~ke~~~~d~Avs~Y~rAl~l--------rpn~A~a~gNla~iYyeqG~ldlAI~~Ykral~~--------  315 (966)
T KOG4626|consen  252 LDAYINLGNVYKEARIFDRAVSCYLRALNL--------RPNHAVAHGNLACIYYEQGLLDLAIDTYKRALEL--------  315 (966)
T ss_pred             hHHHhhHHHHHHHHhcchHHHHHHHHHHhc--------CCcchhhccceEEEEeccccHHHHHHHHHHHHhc--------
Confidence            667777777777777777777777777666        6666667777777777777777777777777666        


Q ss_pred             CChhHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Q 005139          512 PPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAI  591 (712)
Q Consensus       512 ~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  591 (712)
                       .|....++++||..+...|+..+|..+|.+|+.+.+..       +.+.++||.+|..+|.+++|..+|.++++++   
T Consensus       316 -~P~F~~Ay~NlanALkd~G~V~ea~~cYnkaL~l~p~h-------adam~NLgni~~E~~~~e~A~~ly~~al~v~---  384 (966)
T KOG4626|consen  316 -QPNFPDAYNNLANALKDKGSVTEAVDCYNKALRLCPNH-------ADAMNNLGNIYREQGKIEEATRLYLKALEVF---  384 (966)
T ss_pred             -CCCchHHHhHHHHHHHhccchHHHHHHHHHHHHhCCcc-------HHHHHHHHHHHHHhccchHHHHHHHHHHhhC---
Confidence             44456667777777777777777777777777665544       3566677777777777777777777776652   


Q ss_pred             CCCCChHHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHhcCCCChhhHHHHHHHHHHHHHccc-------hhhhCCC
Q 005139          592 GERKSAFFGVALNQMGLACVQRYSINEAVELFEEARSILEQECGPYHPDTLGVYSNLAGTYDAIGR-------EEKLGTA  664 (712)
Q Consensus       592 ~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~p~~~~~~~~La~~~~~~g~-------~~~l~~~  664 (712)
                           +.++.++.+||.+|.++|++++|+.+|++|+.+        .|..++++.|+|.+|..+|+       +......
T Consensus       385 -----p~~aaa~nNLa~i~kqqgnl~~Ai~~YkealrI--------~P~fAda~~NmGnt~ke~g~v~~A~q~y~rAI~~  451 (966)
T KOG4626|consen  385 -----PEFAAAHNNLASIYKQQGNLDDAIMCYKEALRI--------KPTFADALSNMGNTYKEMGDVSAAIQCYTRAIQI  451 (966)
T ss_pred             -----hhhhhhhhhHHHHHHhcccHHHHHHHHHHHHhc--------CchHHHHHHhcchHHHHhhhHHHHHHHHHHHHhc
Confidence                 345566677777777777777777777777776        67777777777777777776       4444456


Q ss_pred             ChhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhccc
Q 005139          665 NPDVDDEKRRLAELLKEAGRVRSRKAQSLETLLDANSR  702 (712)
Q Consensus       665 ~p~~~~~~~~la~~~~~~g~~~~A~~~~l~~~l~~~p~  702 (712)
                      +|..+++..+||.+|...|+..+|+ ..|+++|++.|+
T Consensus       452 nPt~AeAhsNLasi~kDsGni~~AI-~sY~~aLklkPD  488 (966)
T KOG4626|consen  452 NPTFAEAHSNLASIYKDSGNIPEAI-QSYRTALKLKPD  488 (966)
T ss_pred             CcHHHHHHhhHHHHhhccCCcHHHH-HHHHHHHccCCC
Confidence            6777777777777777777777777 777777777666



>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG1130 consensus Predicted G-alpha GTPase interaction protein, contains GoLoco domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG2300 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4340 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG3616 consensus Selective LIM binding factor [Transcription] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>KOG1585 consensus Protein required for fusion of vesicles in vesicular transport, gamma-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1586 consensus Protein required for fusion of vesicles in vesicular transport, alpha-SNAP [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2471 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG1839 consensus Uncharacterized protein CLU1/cluA/TIF31 involved in mitochondrial morphology/distribution, also found associated with eIF-3 [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>COG3898 Uncharacterized membrane-bound protein [Function unknown] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2796 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG0985 consensus Vesicle coat protein clathrin, heavy chain [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>KOG2610 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1550 consensus Extracellular protein SEL-1 and related proteins [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG2041 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0890 consensus Protein kinase of the PI-3 kinase family involved in mitotic growth, DNA repair and meiotic recombination [Signal transduction mechanisms; Chromatin structure and dynamics; Replication, recombination and repair; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>KOG0545 consensus Aryl-hydrocarbon receptor-interacting protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG0551 consensus Hsp90 co-chaperone CNS1 (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3783 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1538 consensus Uncharacterized conserved protein WDR10, contains WD40 repeats [General function prediction only] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>COG0790 FOG: TPR repeat, SEL1 subfamily [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>KOG4322 consensus Anaphase-promoting complex (APC), subunit 5 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF12739 TRAPPC-Trs85: ER-Golgi trafficking TRAPP I complex 85 kDa subunit; InterPro: IPR024420 This entry represents Trs85, a subunit of the TRAPP III complex [] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4507 consensus Uncharacterized conserved protein, contains TPR repeats [Function unknown] Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PF04190 DUF410: Protein of unknown function (DUF410) ; InterPro: IPR007317 This is a family of conserved eukaryotic proteins with undetermined function Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF08626 TRAPPC9-Trs120: Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit; InterPro: IPR013935 The trafficking protein particle complex TRAPP is a multi-protein complex needed in the early stages of the secretory pathway Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG4014 consensus Uncharacterized conserved protein (contains TPR repeat) [Function unknown] Back     alignment and domain information
>KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>PF05053 Menin: Menin; InterPro: IPR007747 MEN1, the gene responsible for multiple endocrine neoplasia type 1, is a tumour suppressor gene that encodes a protein called Menin which may be an atypical GTPase stimulated by nm23 [] Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG2422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4814 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG4521 consensus Nuclear pore complex, Nup160 component [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF09670 Cas_Cas02710: CRISPR-associated protein (Cas_Cas02710) Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>KOG3364 consensus Membrane protein involved in organellar division [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG1920 consensus IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>smart00101 14_3_3 14-3-3 homologues Back     alignment and domain information
>PF04097 Nic96: Nup93/Nic96; InterPro: IPR007231 Nup93/Nic96 is a component of the nuclear pore complex Back     alignment and domain information
>KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG3807 consensus Predicted membrane protein ST7 (tumor suppressor in humans) [General function prediction only] Back     alignment and domain information
>PF10952 DUF2753: Protein of unknown function (DUF2753); InterPro: IPR020206 This entry represents a group of uncharacterised proteins Back     alignment and domain information
>KOG2561 consensus Adaptor protein NUB1, contains UBA domain [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4422 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG0276 consensus Vesicle coat complex COPI, beta' subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query712
3ceq_A283 The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc 6e-10
3edt_B283 Crystal Structure Of The Mutated S328n Hklc2 Tpr Do 8e-10
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-08
3nf1_A311 Crystal Structure Of The Tpr Domain Of Kinesin Ligh 1e-05
2wqh_A125 Crystal Structure Of Ctpr3y3 Length = 125 7e-05
>pdb|3CEQ|A Chain A, The Tpr Domain Of Human Kinesin Light Chain 2 (Hklc2) Length = 283 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 6e-10, Method: Compositional matrix adjust. Identities = 42/159 (26%), Positives = 80/159 (50%), Gaps = 2/159 (1%) Query: 430 EVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGK 489 +VA++ + Y ++Y EA AL + G++HPAVA+ LA +Y + GK Sbjct: 41 DVATMLNILALVYRDQNKYKEAAHLLNDALAIREKTLGKDHPAVAATLNNLAVLYGKRGK 100 Query: 490 LRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYND 549 +E++ C+ AL I EK + P ++A L++++ + ++ + E+ ++AL+IY Sbjct: 101 YKEAEPLCKRALEIREKVLGKFHP-DVAKQLSNLALLCQNQGKAEEVEYYYRRALEIYAT 159 Query: 550 APG-QQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISK 587 G VA + + Y G Y D+ +K +++ Sbjct: 160 RLGPDDPNVAKTKNNLASCYLKQGKYQDAETLYKEILTR 198
>pdb|3EDT|B Chain B, Crystal Structure Of The Mutated S328n Hklc2 Tpr Domain Length = 283 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|3NF1|A Chain A, Crystal Structure Of The Tpr Domain Of Kinesin Light Chain 1 Length = 311 Back     alignment and structure
>pdb|2WQH|A Chain A, Crystal Structure Of Ctpr3y3 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query712
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 6e-40
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 9e-25
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 4e-23
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 2e-19
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 3e-15
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 5e-35
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 4e-17
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 1e-36
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 5e-30
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-28
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 6e-23
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 8e-15
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 2e-09
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 1e-32
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 6e-31
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 5e-28
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 8e-25
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 8e-23
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 4e-32
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 1e-29
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 3e-24
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 8e-24
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 9e-09
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 4e-29
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 1e-21
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 3e-26
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 1e-24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-23
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 4e-18
3q15_A378 PSP28, response regulator aspartate phosphatase H; 4e-26
3q15_A378 PSP28, response regulator aspartate phosphatase H; 9e-25
3q15_A378 PSP28, response regulator aspartate phosphatase H; 2e-24
3q15_A378 PSP28, response regulator aspartate phosphatase H; 1e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 5e-20
3q15_A378 PSP28, response regulator aspartate phosphatase H; 9e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-24
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 2e-23
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-19
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 1e-18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 1e-21
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 4e-20
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-21
4g1t_A 472 Interferon-induced protein with tetratricopeptide 2e-15
4g1t_A472 Interferon-induced protein with tetratricopeptide 8e-13
4g1t_A472 Interferon-induced protein with tetratricopeptide 3e-10
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 1e-20
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-20
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-18
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-20
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 2e-17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 1e-12
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 9e-07
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 7e-20
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-19
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 8e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-19
2gw1_A514 Mitochondrial precursor proteins import receptor; 6e-17
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-15
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-18
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 8e-16
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-04
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-18
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 1e-16
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 2e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 5e-15
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 7e-13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 4e-09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 3e-08
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 5e-18
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 8e-17
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 2e-16
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 1e-12
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 2e-10
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 9e-08
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 2e-15
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 7e-14
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 8e-09
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 3e-08
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 3e-15
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 4e-11
3v6t_A 499 DHAX3; tandem repeats, DNA specific binding protei 9e-06
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 4e-15
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 1e-12
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 2e-10
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 3e-06
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-14
3u4t_A272 TPR repeat-containing protein; structural genomics 1e-12
3u4t_A272 TPR repeat-containing protein; structural genomics 2e-05
4eqf_A365 PEX5-related protein; accessory protein, tetratric 8e-13
4eqf_A365 PEX5-related protein; accessory protein, tetratric 4e-11
4eqf_A365 PEX5-related protein; accessory protein, tetratric 3e-08
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 2e-12
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 8e-11
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 7e-09
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-11
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 7e-10
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 9e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-10
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 1e-07
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 2e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 4e-10
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 5e-07
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 3e-06
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 1e-05
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 8e-10
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 5e-06
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 9e-06
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 1e-09
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 2e-07
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-09
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 2e-08
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 3e-08
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-09
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 2e-07
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 6e-09
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 2e-08
3tax_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 8e-09
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 1e-07
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 2e-06
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 9e-09
3ugm_A1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
3ugm_A 1047 TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xan 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 1e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 2e-08
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-07
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-08
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-07
3k9i_A117 BH0479 protein; putative protein binding protein, 3e-05
3k9i_A117 BH0479 protein; putative protein binding protein, 9e-05
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 3e-08
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 4e-05
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-07
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 3e-04
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 8e-04
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 4e-07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 6e-04
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 5e-07
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 8e-06
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 3e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 8e-07
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 1e-06
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 4e-05
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 2e-06
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 9e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 5e-06
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 4e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 9e-06
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 6e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 7e-04
2kat_A115 Uncharacterized protein; NESG, structure, structur 3e-05
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 3e-05
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 5e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 7e-05
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 4e-04
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 8e-05
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 2e-04
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 9e-05
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 4e-04
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 7e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 7e-04
3qww_A433 SET and MYND domain-containing protein 2; methyltr 8e-04
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 8e-04
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
 Score =  150 bits (382), Expect = 6e-40
 Identities = 66/392 (16%), Positives = 125/392 (31%), Gaps = 39/392 (9%)

Query: 266 MCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLE 325
           + L +     C  G     +   E ++++     G E      A + QLG+ Y  L    
Sbjct: 10  LELALEGERLCKSGDCRAGVSFFEAAVQV-----GTEDLKTLSAIYSQLGNAYFYLHDYA 64

Query: 326 NSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS 385
            +L  +   L + + +  +      +    L         F EA   CQ  LDI ++   
Sbjct: 65  KALEYHHHDLTLARTIGDQLG--EAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELND 122

Query: 386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSL 445
                EA     +G +   KG          +        D                   
Sbjct: 123 KVG--EARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDA------------------ 162

Query: 446 SRYDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYE 505
                A   Y++ L+        +  A    F  L + +   G  R++    E  L I +
Sbjct: 163 --LQAAVDFYEENLSLVT--ALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAK 218

Query: 506 KPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMG 565
           +   G    E     +++ + Y  + E E A +  +K L +       ++  A     +G
Sbjct: 219 E--FGDKAAE-RRAYSNLGNAYIFLGEFETASEYYKKTLLLARQL-KDRAVEAQSCYSLG 274

Query: 566 VMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE 625
             Y +L +Y  + D     ++  + + +R     G A   +G A     + ++A+   E+
Sbjct: 275 NTYTLLQDYEKAIDYHLKHLAIAQELNDRIGE--GRACWSLGNAYTALGNHDQAMHFAEK 332

Query: 626 ARSILEQECGPYHPDTLGVYSNLAGTYDAIGR 657
              I  +        T     NL+     +G 
Sbjct: 333 HLEISREVGDKSGELT--ARLNLSDLQMVLGL 362


>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Length = 338 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Length = 311 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Length = 283 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Length = 472 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Length = 164 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Length = 330 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Length = 327 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Length = 307 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Length = 292 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Length = 252 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Length = 243 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Length = 186 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Length = 293 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Length = 225 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>3tax_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; thiocarbamate crosslink, covalent inhibitor, gylcosyltransfe inhibitor, O-GLCNAC transferase; HET: UDP; 1.88A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* Length = 723 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Length = 217 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>3ugm_A TAL effector avrbs3/PTHA; TAL effector; 3.00A {Xanthomonas oryzae} Length = 1047 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Length = 275 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Length = 213 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Length = 474 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Length = 151 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Length = 136 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Length = 142 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Length = 148 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Length = 115 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Length = 429 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Length = 490 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 291 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Length = 112 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Length = 177 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Length = 433 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query712
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 100.0
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 100.0
2gw1_A514 Mitochondrial precursor proteins import receptor; 100.0
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.98
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.98
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.97
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 99.97
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.97
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.97
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.97
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.96
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.96
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.96
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.96
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.95
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.95
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.94
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 99.94
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 99.93
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.93
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.93
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3q15_A378 PSP28, response regulator aspartate phosphatase H; 99.92
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.92
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.91
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 99.91
3u4t_A272 TPR repeat-containing protein; structural genomics 99.9
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.9
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 99.9
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.89
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.89
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.89
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.89
3u4t_A272 TPR repeat-containing protein; structural genomics 99.88
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.87
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.87
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.86
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.85
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.85
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.83
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.83
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.82
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 99.82
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.82
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.81
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.81
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.81
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.8
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.8
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.79
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.78
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.78
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.78
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 99.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.77
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.77
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.76
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.75
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.72
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.71
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.7
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.69
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.69
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.68
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.67
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 99.67
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.66
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.66
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.65
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.65
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.64
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.63
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.62
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 99.61
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.6
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.6
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 99.6
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.6
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.6
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.59
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.59
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.58
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 99.58
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.57
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.57
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.57
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.56
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.52
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.5
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.49
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.48
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.47
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.45
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.45
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.44
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.43
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.43
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.43
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.42
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 99.41
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.41
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.4
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.4
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.39
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.38
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.38
3qww_A433 SET and MYND domain-containing protein 2; methyltr 99.35
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.35
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 99.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.34
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.33
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.33
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.32
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.32
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.31
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.31
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.3
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.3
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.29
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.29
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.27
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.27
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.27
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.27
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.27
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.26
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.26
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.25
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.25
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.24
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.23
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.22
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.21
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.21
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.2
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.2
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.19
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.18
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.17
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.17
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.16
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.12
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.12
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.11
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.11
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.1
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.1
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.1
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.09
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.08
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.07
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 99.05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.05
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.04
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.03
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.03
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.02
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.99
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.97
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.96
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.96
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.94
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.94
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.89
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.86
3k9i_A117 BH0479 protein; putative protein binding protein, 98.86
3k9i_A117 BH0479 protein; putative protein binding protein, 98.86
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.83
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.79
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.77
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.73
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.68
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.65
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.65
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.64
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.58
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 98.54
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.52
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.44
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.44
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.42
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 98.37
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.37
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 98.29
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.23
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.08
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.08
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 98.06
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 97.98
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.98
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.98
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 97.78
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.75
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.71
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.68
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 97.67
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.67
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.52
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 97.48
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.43
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.85
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.7
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 96.69
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 96.41
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.02
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.73
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 95.72
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 95.71
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 95.64
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 95.27
3mkq_A814 Coatomer beta'-subunit; beta-propeller, alpha-sole 95.09
4b4t_S523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 94.66
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.52
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 94.34
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 94.16
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 93.88
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.61
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 93.56
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 93.56
4gns_B754 Protein CSD3, chitin biosynthesis protein CHS6; FN 93.46
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 93.12
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 92.87
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.86
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 92.85
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 92.79
3spa_A 1134 Mtrpol, DNA-directed RNA polymerase, mitochondrial 92.75
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 91.9
2wpv_A312 GET4, UPF0363 protein YOR164C; golgi-ER traffickin 91.68
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 91.43
3kae_A242 CDC27, possible protein of nuclear scaffold; tetra 91.37
3lpz_A336 GET4 (YOR164C homolog); protein targeting, tail-an 90.93
4fhn_B1139 Nucleoporin NUP120; protein complex,structural pro 89.7
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 89.36
1ya0_A497 SMG-7 transcript variant 2; alpha-helical repeat, 89.24
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 87.64
3re2_A472 Predicted protein; menin, multiple endocrine neopl 87.19
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 86.93
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 86.81
3uzd_A248 14-3-3 protein gamma; structural genomics, SGC, st 85.14
3u84_A550 Menin; MLL, JUND, ledgf, TPR, transglutaminase-lik 84.93
4gq4_A489 Menin; tumor suppressor, nucleus, transcription-tr 82.61
1o9d_A260 14-3-3-like protein C; protein-binding, fusicoccin 81.54
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 81.3
2qx5_A661 Nucleoporin NIC96; mRNA transport, nuclear pore co 80.73
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
Probab=100.00  E-value=3e-35  Score=311.87  Aligned_cols=378  Identities=19%  Similarity=0.203  Sum_probs=332.7

Q ss_pred             HHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHcCCHhHHHHHHHHhhchhhhhhcccchH
Q 005139          226 KQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHAL  305 (712)
Q Consensus       226 ~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~l~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~  305 (712)
                      .+|..++..|+ +++|+..+.++++..         |....++..+|.++...|++++|+.++++++...     +..+ 
T Consensus         4 ~~a~~~~~~g~-~~~A~~~~~~~~~~~---------p~~~~~~~~l~~~~~~~~~~~~a~~~~~~a~~~~-----p~~~-   67 (388)
T 1w3b_A            4 ELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLLA-   67 (388)
T ss_dssp             THHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTCH-
T ss_pred             hHHHHHHHCCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhcC-----CCch-
Confidence            46888999997 999999999988763         4446678889999999999999999999999875     4333 


Q ss_pred             HHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhcCC
Q 005139          306 AKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGS  385 (712)
Q Consensus       306 ~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~  385 (712)
                         .++..+|.++...|++++|+..|++++.+        +|....++..+|.++...|++++|+..|++++.+.+..  
T Consensus        68 ---~~~~~lg~~~~~~g~~~~A~~~~~~al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~p~~--  134 (388)
T 1w3b_A           68 ---EAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL--  134 (388)
T ss_dssp             ---HHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC--
T ss_pred             ---HHHHHHHHHHHHCCCHHHHHHHHHHHHHc--------CcchHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCc--
Confidence               35999999999999999999999999998        67888899999999999999999999999999886543  


Q ss_pred             CCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHh
Q 005139          386 PASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFKTN  465 (712)
Q Consensus       386 ~~~~~~a~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  465 (712)
                            ..++..+|.++...|++++|+.+|.+++..      .|....++..+|.++...|++++|+.+|++++.+    
T Consensus       135 ------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~----  198 (388)
T 1w3b_A          135 ------YCVRSDLGNLLKALGRLEEAKACYLKAIET------QPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL----  198 (388)
T ss_dssp             ------THHHHHHHHHHHTTSCHHHHHHHHHHHHHH------CTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH----
T ss_pred             ------HHHHHHHHHHHHHccCHHHHHHHHHHHHHh------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHhc----
Confidence                  236889999999999999999999999853      4566788999999999999999999999999998    


Q ss_pred             cCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCCChhHHHHHHHHHHHHHHcccHHHHHHHHHHHHH
Q 005139          466 KGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALK  545 (712)
Q Consensus       466 ~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~  545 (712)
                          .|....++..+|.++...|++++|+..|++++.+         .|....++..+|.++...|++++|+..|++++.
T Consensus       199 ----~p~~~~~~~~lg~~~~~~~~~~~A~~~~~~al~~---------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~  265 (388)
T 1w3b_A          199 ----DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSL---------SPNHAVVHGNLACVYYEQGLIDLAIDTYRRAIE  265 (388)
T ss_dssp             ----CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHH---------CTTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHH
T ss_pred             ----CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhh---------CcCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHh
Confidence                7888899999999999999999999999999998         344577899999999999999999999999998


Q ss_pred             HHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHhCCHHHHHHHHHH
Q 005139          546 IYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELFEE  625 (712)
Q Consensus       546 ~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~  625 (712)
                      +.+..       ..++..+|.++...|++++|+.+|++++.+.        +....++..+|.++...|++++|+.+|++
T Consensus       266 ~~p~~-------~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~--------p~~~~~~~~l~~~~~~~g~~~~A~~~~~~  330 (388)
T 1w3b_A          266 LQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLYRK  330 (388)
T ss_dssp             TCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHHHH
T ss_pred             hCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHHHHhhC--------cccHHHHHHHHHHHHHcCCHHHHHHHHHH
Confidence            64433       4578899999999999999999999999862        22347889999999999999999999999


Q ss_pred             HHHHHHHhcCCCChhhHHHHHHHHHHHHHccc-------hhhhCCCChhHHHHHHHHHHHHHHhcc
Q 005139          626 ARSILEQECGPYHPDTLGVYSNLAGTYDAIGR-------EEKLGTANPDVDDEKRRLAELLKEAGR  684 (712)
Q Consensus       626 al~~~~~~~~~~~p~~~~~~~~La~~~~~~g~-------~~~l~~~~p~~~~~~~~la~~~~~~g~  684 (712)
                      ++++        +|+...++.++|.+|...|+       .+.....+|+...++..+|.++..+|+
T Consensus       331 al~~--------~p~~~~~~~~l~~~~~~~g~~~~A~~~~~~a~~~~p~~~~a~~~lg~~~~~~~~  388 (388)
T 1w3b_A          331 ALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHhc--------CCCcHHHHHHHHHHHHHcCCHHHHHHHHHHHHhhCCCCHHHHHhHHHHHHHccC
Confidence            9987        88888999999999999998       444456789999999999999988774



>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3spa_A Mtrpol, DNA-directed RNA polymerase, mitochondrial; single-subunit DNA-dependent RNA polymerase in mitochondria, transferase; 2.50A {Homo sapiens} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>2wpv_A GET4, UPF0363 protein YOR164C; golgi-ER trafficking, tail-anchored protein, protein binding GET4; 1.99A {Saccharomyces cerevisiae} PDB: 3lku_A Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3kae_A CDC27, possible protein of nuclear scaffold; tetratricopeptide repeat protein, protein binding; 2.30A {Encephalitozoon cuniculi} Back     alignment and structure
>3lpz_A GET4 (YOR164C homolog); protein targeting, tail-anchored protein biogenesis, GET PAT GET5 binding, protein transport; 1.98A {Chaetomium thermophilum} Back     alignment and structure
>4fhn_B Nucleoporin NUP120; protein complex,structural protein,nuclear pore complex,mRNA transport,protein transport, WD repeat; 6.99A {Schizosaccharomyces pombe 972h-} Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3re2_A Predicted protein; menin, multiple endocrine neoplasia 1, tumor suppressor, MIX lineage leukemia, unknown function; 1.95A {Nematostella vectensis} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Back     alignment and structure
>3u84_A Menin; MLL, JUND, ledgf, TPR, transglutaminase-like, transcription, epigenetics, cancer; 2.50A {Homo sapiens} PDB: 3u85_A 3u86_A 3u88_A* Back     alignment and structure
>4gq4_A Menin; tumor suppressor, nucleus, transcription-transcription inhib complex; HET: 0RT EPE PE4; 1.27A {Homo sapiens} PDB: 4gq3_A* 4gpq_A* 4gq6_A* Back     alignment and structure
>1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>2qx5_A Nucleoporin NIC96; mRNA transport, nuclear pore complex, nucleus, protein transport, translocation, transport, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2rfo_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 712
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-21
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 4e-18
d1hz4a_366 a.118.8.2 (A:) Transcription factor MalT domain II 1e-06
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-20
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 4e-19
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 2e-15
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 3e-10
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 3e-09
d1qqea_290 a.118.8.1 (A:) Vesicular transport protein sec17 { 7e-05
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 6e-10
d1ya0a1 497 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [T 0.001
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-09
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 1e-07
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.001
d1fcha_323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 0.004
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 1e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 4e-06
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 3e-05
d1hh8a_192 a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF- 6e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 1e-04
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
d1xnfa_259 a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli 2e-04
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 0.001
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.001
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.001
d1zbpa1264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.004
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]
 Score = 95.0 bits (234), Expect = 1e-21
 Identities = 43/366 (11%), Positives = 109/366 (29%), Gaps = 17/366 (4%)

Query: 268 LHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEHALAKFAGHMQLGDTYAMLGQLENS 327
             + A +  + G  +EA  + + ++E           +A       LG+     G+L  S
Sbjct: 15  NALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVA----TSVLGEVLHCKGELTRS 70

Query: 328 LMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDNGSPA 387
           L       ++ +Q   +       +    +E          A +  + A  +  +     
Sbjct: 71  LALMQQTEQMARQ--HDVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQ 128

Query: 388 SLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSR 447
                   R+   +       + A      + + ++++ Q  +       +    L+   
Sbjct: 129 LPMHEFLVRIRAQLLWAWARLDEAEASA-RSGIEVLSSYQPQQQLQCLAMLIQCSLARGD 187

Query: 448 YDEAGFAYQKALTAFKTNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKP 507
            D A     +           +   +++        +  TG    + ++  +  +     
Sbjct: 188 LDNARSQLNRLENLLGNG-KYHSDWISNANKVRVIYWQMTGDKAAAANWLRHTAKPEFAN 246

Query: 508 VPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKALKIYNDAPGQQSTVAGIEAQMGVM 567
              +  +               + E E A  +L++  +    +    S +      +  +
Sbjct: 247 NHFLQGQWRNIAR-----AQILLGEFEPAEIVLEELNENAR-SLRLMSDLNRNLLLLNQL 300

Query: 568 YYMLGNYSDSYDSFKNAISKLRAIGERKS-AFFGVALNQMGLACVQRYSINEAVELFEEA 626
           Y+  G  SD+     +A+      G        G A+ Q     +Q  ++ E  +    A
Sbjct: 301 YWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQLIQLNTLPELEQ--HRA 358

Query: 627 RSILEQ 632
           + IL +
Sbjct: 359 QRILRE 364


>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 290 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Length = 192 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Length = 259 Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query712
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 100.0
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.98
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.91
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d1hz4a_366 Transcription factor MalT domain III {Escherichia 99.9
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.9
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.79
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.78
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.76
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.71
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 99.71
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.7
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.69
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.67
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.38
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.36
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.3
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.29
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.28
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.26
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.26
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.25
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.25
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 99.22
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.2
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.19
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.18
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.17
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.17
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.16
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.13
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.13
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.12
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.12
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.09
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.07
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.95
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.94
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.85
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.79
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.73
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.47
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.43
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.36
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.23
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.7
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.6
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.37
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 96.89
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 92.84
d1b89a_336 Clathrin heavy chain proximal leg segment {Cow (Bo 92.72
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 92.02
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 91.87
d1qsaa1450 70 KDa soluble lytic transglycosylase (SLT70), sup 88.92
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 84.89
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 84.34
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 84.07
d2o8pa1220 14-3-3 domain containing protein cgd7_2470 {Crypto 83.04
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 82.23
d1o9da_236 14-3-3-like protein C {Common tobacco (Nicotiana t 80.57
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.2e-31  Score=278.25  Aligned_cols=380  Identities=18%  Similarity=0.196  Sum_probs=227.5

Q ss_pred             HHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHcCCHhHHHHHHHHhhchhhhhhcccc
Q 005139          224 LLKQARELISSGDNPQKALELALRAAKSFEIGANGKPSLELVMCLHVIAAIYCSLGQYNEAIPVLEQSIEIPVIEEGQEH  303 (712)
Q Consensus       224 l~~~a~~~~~~g~~~~~A~~~~~~Al~~~~~~~~~~~~~~~~~~l~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~  303 (712)
                      ++.+|..++..|+ |++|+..|+++++..         |....++..+|.+|...|++++|+.+|++++++.     |.+
T Consensus         2 ll~la~~~~~~G~-~~~A~~~~~~~l~~~---------p~~~~~~~~la~~~~~~~~~~~A~~~~~~al~~~-----p~~   66 (388)
T d1w3ba_           2 PMELAHREYQAGD-FEAAERHCMQLWRQE---------PDNTGVLLLLSSIHFQCRRLDRSAHFSTLAIKQN-----PLL   66 (388)
T ss_dssp             CCTHHHHHHHHTC-HHHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHC-----TTC
T ss_pred             hHHHHHHHHHcCC-HHHHHHHHHHHHHhC---------CCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhC-----CCC
Confidence            3568899999997 999999999999763         4446788999999999999999999999999886     444


Q ss_pred             hHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHhc
Q 005139          304 ALAKFAGHMQLGDTYAMLGQLENSLMCYTTGLEVQKQVLGETDPRVGETCRYLAEAHVQALQFSEAQKFCQMALDIHKDN  383 (712)
Q Consensus       304 ~~~~~~~~~~lg~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  383 (712)
                      +    .++..+|.+|...|++++|+..+..++..        .+.........+......+.+..+..............
T Consensus        67 ~----~a~~~l~~~~~~~g~~~~A~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  134 (388)
T d1w3ba_          67 A----EAYSNLGNVYKERGQLQEAIEHYRHALRL--------KPDFIDGYINLAAALVAAGDMEGAVQAYVSALQYNPDL  134 (388)
T ss_dssp             H----HHHHHHHHHHHHHTCHHHHHHHHHHHHHH--------CTTCHHHHHHHHHHHHHHSCSSHHHHHHHHHHHHCTTC
T ss_pred             H----HHHHHHHHHhhhhcccccccccccccccc--------cccccccccccccccccccccccccccccccccccccc
Confidence            3    35899999999999999999999999887        34444445555555555555555554444433322111


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhCCCChhHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHH
Q 005139          384 GSPASLEEAADRRLMGLICETKGDHEAALEHLVLASMTMIANDQDAEVASVDCSIGDTYLSLSRYDEAGFAYQKALTAFK  463 (712)
Q Consensus       384 ~~~~~~~~a~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~  463 (712)
                      .        ......+......+....+...+.+.+.      ..+..+.++..+|.++...|++++|..++++++.+  
T Consensus       135 ~--------~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~l~~~~~~~~~~~~A~~~~~~al~~--  198 (388)
T d1w3ba_         135 Y--------CVRSDLGNLLKALGRLEEAKACYLKAIE------TQPNFAVAWSNLGCVFNAQGEIWLAIHHFEKAVTL--  198 (388)
T ss_dssp             T--------HHHHHHHHHHHTTSCHHHHHHHHHHHHH------HCTTCHHHHHHHHHHHHTTTCHHHHHHHHHHHHHH--
T ss_pred             c--------cccccccccccccchhhhhHHHHHHhhc------cCcchhHHHHhhcccccccCcHHHHHHHHHHHHHh--
Confidence            1        1233344444455555555555544442      22333445555555555555555555555555555  


Q ss_pred             HhcCCCCHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhcCCCCCCChhHHHHHHHHHHHHHHcccHHHHHHHHHHH
Q 005139          464 TNKGENHPAVASVFVRLADMYNRTGKLRESKSYCENALRIYEKPVPGVPPEEIASGLTDVSSIYESMNELEQAIKLLQKA  543 (712)
Q Consensus       464 ~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a  543 (712)
                            +|....++..+|.++...|++++|+..++++..+.         +.....+..+|.++...|++++|+.+|+++
T Consensus       199 ------~p~~~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~---------~~~~~~~~~l~~~~~~~~~~~~A~~~~~~a  263 (388)
T d1w3ba_         199 ------DPNFLDAYINLGNVLKEARIFDRAVAAYLRALSLS---------PNHAVVHGNLACVYYEQGLIDLAIDTYRRA  263 (388)
T ss_dssp             ------CTTCHHHHHHHHHHHHTTTCTTHHHHHHHHHHHHC---------TTCHHHHHHHHHHHHHTTCHHHHHHHHHHH
T ss_pred             ------CcccHHHHHHHhhhhhccccHHHHHHHHHHhHHHh---------hhHHHHHHHHHHHHHHCCCHHHHHHHHHHH
Confidence                  44445555555555555555555555555555541         122344555555555555555555555555


Q ss_pred             HHHHHhCCCCCCcHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhCCCCChHHHHHHHHHHHHHHHhCCHHHHHHHH
Q 005139          544 LKIYNDAPGQQSTVAGIEAQMGVMYYMLGNYSDSYDSFKNAISKLRAIGERKSAFFGVALNQMGLACVQRYSINEAVELF  623 (712)
Q Consensus       544 l~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~~~lg~~~~~~g~~~~A~~~~  623 (712)
                      +++.+..       ..++..+|.++...|++++|+..|++++...        +....++..+|.++...|++++|+.+|
T Consensus       264 l~~~p~~-------~~~~~~l~~~~~~~~~~~~A~~~~~~~~~~~--------~~~~~~~~~l~~~~~~~~~~~~A~~~~  328 (388)
T d1w3ba_         264 IELQPHF-------PDAYCNLANALKEKGSVAEAEDCYNTALRLC--------PTHADSLNNLANIKREQGNIEEAVRLY  328 (388)
T ss_dssp             HHTCSSC-------HHHHHHHHHHHHHHSCHHHHHHHHHHHHHHC--------TTCHHHHHHHHHHHHTTTCHHHHHHHH
T ss_pred             HHhCCCC-------HHHHHHHHHHHHHcCCHHHHHHHHHhhhccC--------CccchhhhHHHHHHHHCCCHHHHHHHH
Confidence            5543222       2345555555555555555555555554431        112244555555555555555555555


Q ss_pred             HHHHHHHHHhcCCCChhhHHHHHHHHHHHHHccc-------hhhhCCCChhHHHHHHHHHHHHHHhcc
Q 005139          624 EEARSILEQECGPYHPDTLGVYSNLAGTYDAIGR-------EEKLGTANPDVDDEKRRLAELLKEAGR  684 (712)
Q Consensus       624 ~~al~~~~~~~~~~~p~~~~~~~~La~~~~~~g~-------~~~l~~~~p~~~~~~~~la~~~~~~g~  684 (712)
                      ++++++        +|+...++.++|.+|..+|+       .+.....+|+++.++.+||.+|.++||
T Consensus       329 ~~al~~--------~p~~~~~~~~la~~~~~~g~~~~A~~~~~~al~l~P~~~~a~~~lg~~~~~~~D  388 (388)
T d1w3ba_         329 RKALEV--------FPEFAAAHSNLASVLQQQGKLQEALMHYKEAIRISPTFADAYSNMGNTLKEMQD  388 (388)
T ss_dssp             HHHTTS--------CTTCHHHHHHHHHHHHTTTCCHHHHHHHHHHHTTCTTCHHHHHHHHHHHHHTCC
T ss_pred             HHHHHh--------CCCCHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcCC
Confidence            555554        55555555555555555555       223334455555555555555555553



>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qsaa1 a.118.5.1 (A:1-450) 70 KDa soluble lytic transglycosylase (SLT70), superhelical domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure