Citrus Sinensis ID: 005147

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710--

MNPRLLRGERFGVRGDDSNDFELRKHSDGVELTHGDHLRNQGGLSGVCENEAAIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIESASCSDSGSDSHEEGLNTQNMETKDLSSPLPLDMLQRRTRLRREDLQLVTAPTNDLSEASCMQSSSAYGTHVVLVEGMQEHKILDNRVNVEQVEEKKQPFPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAAIELREQIDEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLGSFAELANDDLSGLNIPSLNIIDNDCSATMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPSGRPLVRHSQLSSDGRTSKPLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQAILLLHLVDVSFETKRTTVI

cccccccccCEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEEcccccEEEEccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccEEEccccccccHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccHHHHHHcHHHHHHHHHHcccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccCECccccccccccccccccccccccccccccccccccccccccCEEECccccccCEECcccccEEEEccccccccccccccEEEEEEEECccccccCECcccccccccccccCEcccccccCECccccccccCEEEEEcccccEEEEEEcccEEEEEEEccccccccccccEEEEEEcccccEEEEEEccccEEEEEccccccccccccccEEEEccccccEEEEEccccccEEEEccccccEEEEEccccEEEEEcccccccEEEEECccccccEEEECcccccEEEEEcccccEEEEEEcEEEccccEEEc

****************************************************AIDPFVHAIEWGDVSLRQWLDKPKRSVDVYECLHIFRQIVEIVYAAHSQGIVVHNVRPSCFVMSSFNHVSFIE******************************************************************AYGTHVVLVE***********************FPMKQILLMETNWYASPEELAGAPVSCASDIYRLGVLLFELFCPFSTGEEKTRTMSSLRHRVLPPQLLLKFPKEASFCLWLLHPEPSGRPKMGELLQSEFLNEPRDSMEEREAA*******DEEELLLEFLLLVQQRKQESAKKLQDIVSFICSDIEEVSKQQAILRKKGGLG***************************TMGSRKRFRPELQLHHLEECDDNLDDNQKHNLTGNEERSLFKSSRLMKNFKKLESAYFLTRCRPVKPS******************PLVNERSSINNLGSKEGYSEGRRSGWINPFLEGLCKYLSFSKLRVKADLNQGDLLNSSNLVCSLSFDRDGELFAAAGVNKKIKVFECDAIINENRDIHYPVVEMASRSKLSSICWNSYIKSQIASSNFEGVVQVWDVSRSQVLTEMREHERRVWSIDFSSADPTLLASGSDDGSVKLWSINQAILLLHLVDVSFETKRTTVI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein SPA1-RELATED 3	Repressor of photomorphogenesis in the light. Probably part of the COP1/SPA E3 ubiquitin-protein ligase complex.	probable	Q9LJR3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G31, chain A
Confidence level:very confident
Coverage over the Query: 26-129,234-328
View the alignment between query and template
View the model in PyMOL

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 490-700
View the alignment between query and template
View the model in PyMOL

Template: 4F9C, chain A
Confidence level:confident
Coverage over the Query: 8-138,168-172,232-328
View the alignment between query and template
View the model in PyMOL

Template: 1WAK, chain A
Confidence level:confident
Coverage over the Query: 36-131,150-177,218-327
View the alignment between query and template
View the model in PyMOL

Template: 1P22, chain A
Confidence level:confident
Coverage over the Query: 469-700
View the alignment between query and template
View the model in PyMOL