Citrus Sinensis ID: 005155

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-

MRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMERVHRFLGLSVGLIQRGMIPEERRSNYRCDITYTNNSELGFDYLRDNLAANSEQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDVARYPVAAKVAELLVQGLHYTVELKNNSVELTEEGIALAEMALETNDLWDENDPWARFVMNALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQMPVIEVPTNLPNIRVDLPIQSFATARGKWEYARQEVESMFRLGRPVLVGSTSVENSEYLSDLLKQQGIPHNVLNARPKYAAREAETVAQAGRKYAITISTNMAGRGTDIILGGNPKMLAKKIIEDRLLLLLTREALNVEVDDKTSSPKVLSEIKLGSSSLALLAKAALLAKYVGKAEGKSWTYQEAKSFFSESVEMSQSMNLKELQKLIDKQSAMYPLGPTVALTYLSVLKDCEVHCSNEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEMFQKFSFDTSWAVDLISRITNDEDMPIEGDAIVRQLLGLQISAEKYYFGIRKSLVEFDEVLEVQRKHVYDLRQSILTGANESCSQQIFQYMQAVVDEIIFGNVDPLKILEFG

ccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccEEEEcccHHHHHcHHHHHHHHHHccccEEEEcccccHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEEccccHHHcccccccccccccccccccHHHHHHHHHHHccccccEEEccccEEEccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccEEEEccEEEEEEcccccccccccccccHHHHHHHHcccccccccEEHHHHHHHHHHcccccccccccccHHHHHHHHHHccccEEEcccccccccccccccEEccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccHHHHcccCEEEEcccHHHHHHHHHccccccccccccccEEEcccccHHHHHccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccc

MRHFDVQIIGGAVLHDGSIAEMKTGEGKTLVSTLAAYLNALTGEGVHVVTVNDYLAQRDAEWMERVHRFLGLSVGLIQRGMIPEERRSNYRCDITYTNNSELGFDYLRDNLAANSEQLVMRWPKPFHFAIVDEVDSVLIDEGRNPLLISGEASKDVARYPVAAKVAELLVQGLHYTVELKNNSVELTEEGIALAEMALETNDLWDENDPWARFVMNALKAKEFYRRDVQYIVRNGKALIINELTGRVEEKRRWSEGIHQAVEAKEGLKIQADSVVVAQITYQSLFKLYPKLSGMTGTAKTEEKEFLKMFQMPVIEVPTNLPNIRVDLPIQSFATARGKWEYARQEVESMFRLGRPVLVGSTSVENSEYLSDLLKQQGIPHNVLNARPKYAAREAETVAQAGRKYAITISTNMAGRGTDIILGGNPKMLAKKIIEDRLLLLLTREA*************VLS*IKLGSSSLALLAKAALLAKYVGKAEGKSWTYQEAKSFF**********NLKELQKLIDKQSAMYPLGPTVALTYLSVLKDCEVHCSNEGSEVKRLGGLHVIGTSLHESRRIDNQLRGRAGRQGDPGSTRFMVSLQDEMFQKFSFDTSWAVDLISRITNDEDMPIEGDAIVRQLLGLQISAEKYYFGIRKSLVEFDEVLEVQRKHVYDLRQSILTGANESCSQQIFQYMQAVVDEIIFGNVDP*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein translocase subunit SECA2, chloroplastic	Involved in protein export. Probably interacts with other proteins to allow the postimport or conservative sorting pathway for inner membrane proteins in plastids. May have a central role in coupling the hydrolysis of ATP to the transfer of proteins across the membrane.	probable	D8WUA4
Protein translocase subunit SecA	Probably participates in protein translocation into and across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.	probable	Q2JW99
Protein translocase subunit SecA	Probably participates in protein translocation into and across both the cytoplasmic and thylakoid membranes in cyanobacterial cells.	probable	Q8DHU4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NKT, chain A
Confidence level:very confident
Coverage over the Query: 1-451,505-512,530-701
View the alignment between query and template
View the model in PyMOL

Template: 2IPC, chain A
Confidence level:very confident
Coverage over the Query: 1-439,457-493,510-514,529-706
View the alignment between query and template
View the model in PyMOL