Citrus Sinensis ID: 005175

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710
MNNNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTASASGSPPSPSRLVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSNGSVVPSPRSSVSGASVMDMAAALLLPGSPSSMSGMSPNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNLPGSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNSVSLSRSCRPKTLTPSNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASFRVGSPGRMSPRSVEPISPMGPRLAAFAQREKQQQQLHSLSSRDPISNNPIPNIGSPRNVNSSWSKWGSPSGKLDWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQLDQLVV
cccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccccccccccccccHHccccccHHHHHHHHHHHHccccccHHHHccccccccccccccccccccHHHHccccccccccccccccHHHccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcc
cccccccccHHHHHHHHHHHHccHHHHHHHHHHHccccccccccEEcccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccccHHHHHHHccHHHHHHHHHHHHHccccccccccccccccEEEEEcccccHHHHHHHHHHccccccHccccccccccEEEEccccccccccccccHHccccHHHcccccccccccccccccccccccccccccccccccccccEccccEEEEEEccccccccccccccccccccccccHcccccccccEcccccccccccccccccccHHHcccEHEcccHHHHcccccccccccccEEEEEEcccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHcccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccc
mnnnstaeteDSFTSMLELASNNDVEGFKRMlerdpssvdevglwygrvngskqmvsehRTPLMVAATYGSVDVLKLILLHSSadvnvscgsdrttalhcaasggsanVVDVVRLLLSagadpdcvdanghhpidvivlppklDSMRAILEEVFGSKNSSVVVASGaehnltvsigssnsdyssplltasasgsppspsrlvsspmalkfndvsfgtgaekreypidpslpdiknsiyatdefrmfsfkirpcsrayshdwtecpfvhpgenarrrdprkfhyscvpcpdfrkgacrrgdmceyahgvfecwlhpaQYRTRLckdgtscdrrvCFFAHtaeelrplyvsngsvvpsprssvsgaSVMDMAAALllpgspssmsgmspnpfsqpmspsgngnlqssmmwpqpnvptlnlpgsniqssrlrsslsardilpddfsslsdfdsqqhILNDLTCfsqarnnsvslsrscrpktltpsnldelfsaeisssprfsdqavfspthkssvlnqfqqphsmlspiktnvfspknvehpllqasfrvgspgrmsprsvepispmgprLAAFAQREKQQQQLHslssrdpisnnpipnigsprnvnsswskwgspsgkldwsikgdeLELLRRssscdlrnnnheepdlswIHSIvkesppemmkektanpvvttassgealnsnsqadsfdHSVIGAWLEQMQLDQLVV
mnnnstaetedsfTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTASASGSPPSPSRLVSSPMALKFNDVSFgtgaekreypidpslpdiKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPfvhpgenarrrdprKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHtaeelrplyvsngsvvpsPRSSVSGASVMDMAAALLLPGSPSSMSGMSPNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNLPGSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNsvslsrscrpktltpsNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASfrvgspgrmsPRSVEPISPMGPRLAAFAQREKQQQQLhslssrdpisnnpipnigsprnvNSSWSKWGSPSGKLDWSIKGDELELLRRssscdlrnnnheepdlswihSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQLDQLVV
MNNNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYssplltasasgsppspsrlvsspMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYvsngsvvpsprssvsgasvMDmaaalllpgspssmsgmspNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNLPGSNIQssrlrsslsARDILPddfsslsdfdsQQHILNDLTCFSQARNNSVSLSRSCRPKTLTPSNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASFRVGSPGRMSPRSVEPISPMGPRLAAFAQREKQQQQLHSLSSRDPISNNPIPNIGSPRNVNsswskwgspsgkLDWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQLDQLVV
***************************************DEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVA*****************************************************************LPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENAR*RDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSN******************************************************************************************************HILNDLTCF**********************************************************************************************************************************************************************************************I*****************************************SVIGAWLE*********
**NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTAS*********RLVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEEL***************************************************************************************************************************************************************************************************************************************************************************************IKGDELEL*****************DLSWIHSIVK*************************************VIGAWLEQMQLDQLV*
*************TSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSP****************VSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSNGSVVPSPRSSVSGASVMDMAAALLLPGSPSSMSGMSPNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNLPGSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARN**********PKTLTPSNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASFRVGS**********PISPMGPRLAAF**************SRDPISNNPIPNIGSPRN*************KLDWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQLDQLVV
*****TAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTASAS******************************EYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLY***************************************************************PNVPTLNL***NIQS*RLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCF********************PSNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASFRV*SPG**SPRSVEPISPMGPRLAAFAQREKQQQQLHSL********************************KLDW*IKGDELELLRRSSSC******HEEPDLSWIHSIVK*********************************FDHSVIGAWLEQMQLDQLV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNNNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTASASGSPPSPSRLVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSNGSVVPSPRSSVSGASVMDMAAALLLPGSPSSMSGMSPNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNLPGSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNSVSLSRSCRPKTLTPSNLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPHSMLSPIKTNVFSPKNVEHPLLQASFRVGSPGRMSPRSVEPISPMGPRLAAFAQREKQQQQLHSLSSRDPISNNPIPNIGSPRNVNSSWSKWGSPSGKLDWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQLDQLVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query710 2.2.26 [Sep-21-2011]
P93755716 Zinc finger CCCH domain-c yes no 0.922 0.914 0.584 0.0
Q10EL1764 Zinc finger CCCH domain-c yes no 0.952 0.884 0.579 0.0
Q9LXV4706 Zinc finger CCCH domain-c no no 0.925 0.930 0.537 0.0
Q84SL2657 Zinc finger CCCH domain-c no no 0.854 0.923 0.423 1e-131
Q2QPW2619 Zinc finger CCCH domain-c no no 0.605 0.694 0.520 1e-126
Q9LUZ4607 Zinc finger CCCH domain-c no no 0.785 0.919 0.418 1e-123
Q9XEE6597 Zinc finger CCCH domain-c no no 0.777 0.924 0.380 1e-118
Q93ZS9580 Zinc finger CCCH domain-c no no 0.716 0.877 0.371 1e-103
Q9FU27386 Zinc finger CCCH domain-c no no 0.149 0.274 0.764 1e-50
Q6L4N4402 Zinc finger CCCH domain-c no no 0.170 0.300 0.694 2e-49
>sp|P93755|C3H30_ARATH Zinc finger CCCH domain-containing protein 30 OS=Arabidopsis thaliana GN=At2g41900 PE=1 SV=2 Back     alignment and function desciption
 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/732 (58%), Positives = 508/732 (69%), Gaps = 77/732 (10%)

Query: 3   NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP 62
           N+ T ETED+F S+LELA+NNDVEG +  +ERDPS VDE GLWYGR  GSK MV+++RTP
Sbjct: 35  NHLTVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGSKAMVNDYRTP 94

Query: 63  LMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGAD 122
           LMVAATYGS+DV+KLI+  + ADVN +CG+D+TTALHCAASGG+ N + VV+LLL+AGAD
Sbjct: 95  LMVAATYGSIDVIKLIVSLTDADVNRACGNDQTTALHCAASGGAVNAIQVVKLLLAAGAD 154

Query: 123 PDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDY 182
            + +DA G    DVIV+PPKL+ ++ +L+E+  +  SS      AE NL V     N   
Sbjct: 155 LNLLDAEGQRAGDVIVVPPKLEGVKLMLQELLSADGSST-----AERNLRVVTNVPNRS- 208

Query: 183 SSPLLTASASGSPPSPSRLVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDE 242
           SSP    S +G               K     F     K+EYP+DPSLPDIKNSIYATDE
Sbjct: 209 SSP--CHSPTGENGGSGSGSPLGSPFKLKSTEF-----KKEYPVDPSLPDIKNSIYATDE 261

Query: 243 FRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC 302
           FRM+SFK+RPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC
Sbjct: 262 FRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC 321

Query: 303 EYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSNGSVVPSPRSSVS 362
           EYAHGVFECWLHPAQYRTRLCKDGT C RRVCFFAHT EELRPLY S GS VPSPRS+  
Sbjct: 322 EYAHGVFECWLHPAQYRTRLCKDGTGCARRVCFFAHTPEELRPLYASTGSAVPSPRSNA- 380

Query: 363 GASVMDMAAAL-LLPGSPSSMSGMSPNPFSQPMSPS--GNGNLQSSMMWPQPNVPTLNLP 419
                D AAAL LLPGSPS +S MS      P+SPS  GNG   S+M WPQPNVP L+LP
Sbjct: 381 -----DYAAALSLLPGSPSGVSVMS------PLSPSAAGNGMSHSNMAWPQPNVPALHLP 429

Query: 420 GSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNSVSLSRSCRPKT 479
           GSN+QSSRLRSSL+ARDI  D+F+ L+D++ QQ +LN+          S +LSRS R K+
Sbjct: 430 GSNLQSSRLRSSLNARDIPTDEFNMLADYE-QQQLLNEY---------SNALSRSGRMKS 479

Query: 480 LTPSNLDELFSAEISSSPRFSD----QAVFSPTHKSSVLN----QFQQPHSMLSPIKTNV 531
           + PSNL++LFSAE SSSPRF+D     AVFSPTHKS+V N    Q QQ  SMLSPI T+ 
Sbjct: 480 MPPSNLEDLFSAEGSSSPRFTDSALASAVFSPTHKSAVFNQFQQQQQQQQSMLSPINTSF 539

Query: 532 FSPKNVEHPLLQASFRVGSPGRMSPRS-VEPISPMGPRLAAFAQREK----------QQQ 580
            SPK+V+H L          GRMSPR+ VEPISPM  R++  AQ  K          QQ 
Sbjct: 540 SSPKSVDHSLFSGG------GRMSPRNVVEPISPMSARVSMLAQCVKQQQQQQQQQQQQH 593

Query: 581 QLHSLSSRDPISNNPIPNIGSPRNVNSSWSKWGSPSGKLDWSIKGDELELLRRSSSCDLR 640
           Q  SLSSR+ +  N  P +GSP N N+  SKWGS +G+ DW +  + L  LR SSS D  
Sbjct: 594 QFRSLSSRE-LRTNSSPIVGSPVNNNTWSSKWGSSNGQPDWGMSSEALGKLRSSSSFD-- 650

Query: 641 NNNHEEPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEAL--NSNSQADSFDHSVIGA 698
               +EPD+SW+ S+VKE+P E  KEK A     T+SSGE +    N      DH+ + A
Sbjct: 651 ---GDEPDVSWVQSLVKETPAE-AKEKAA-----TSSSGEHVMKQPNPVEPVMDHAGLEA 701

Query: 699 WLEQMQLDQLVV 710
           W+EQMQLDQLV 
Sbjct: 702 WIEQMQLDQLVA 713

Arabidopsis thaliana (taxid: 3702)
>sp|Q10EL1|C3H24_ORYSJ Zinc finger CCCH domain-containing protein 24 OS=Oryza sativa subsp. japonica GN=Os03g0698800 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXV4|C3H56_ARATH Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana GN=At5g12850 PE=2 SV=1 Back     alignment and function description
>sp|Q84SL2|C3H50_ORYSJ Zinc finger CCCH domain-containing protein 50 OS=Oryza sativa subsp. japonica GN=Os07g0568300 PE=2 SV=1 Back     alignment and function description
>sp|Q2QPW2|C3H67_ORYSJ Zinc finger CCCH domain-containing protein 67 OS=Oryza sativa subsp. japonica GN=Os12g0515500 PE=2 SV=1 Back     alignment and function description
>sp|Q9LUZ4|C3H66_ARATH Zinc finger CCCH domain-containing protein 66 OS=Arabidopsis thaliana GN=At5g58620 PE=2 SV=1 Back     alignment and function description
>sp|Q9XEE6|C3H29_ARATH Zinc finger CCCH domain-containing protein 29 OS=Arabidopsis thaliana GN=At2g40140 PE=2 SV=1 Back     alignment and function description
>sp|Q93ZS9|C3H47_ARATH Zinc finger CCCH domain-containing protein 47 OS=Arabidopsis thaliana GN=At3g55980 PE=2 SV=1 Back     alignment and function description
>sp|Q9FU27|C3H2_ORYSJ Zinc finger CCCH domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=Os01g0192000 PE=2 SV=1 Back     alignment and function description
>sp|Q6L4N4|C3H35_ORYSJ Zinc finger CCCH domain-containing protein 35 OS=Oryza sativa subsp. japonica GN=Os05g0195200 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
294440421740 unknown [Vitis vinifera] 0.983 0.943 0.738 0.0
359487288740 PREDICTED: zinc finger CCCH domain-conta 0.985 0.945 0.738 0.0
224055208710 predicted protein [Populus trichocarpa] 0.966 0.966 0.708 0.0
224106079728 predicted protein [Populus trichocarpa] 0.953 0.929 0.708 0.0
356548929701 PREDICTED: zinc finger CCCH domain-conta 0.973 0.985 0.701 0.0
255571544728 nucleic acid binding protein, putative [ 0.963 0.939 0.686 0.0
356530657701 PREDICTED: zinc finger CCCH domain-conta 0.974 0.987 0.687 0.0
356544173704 PREDICTED: zinc finger CCCH domain-conta 0.973 0.981 0.701 0.0
302398727731 C3HL domain class transcription factor [ 0.967 0.939 0.662 0.0
302398721736 C3HL domain class transcription factor [ 0.967 0.933 0.652 0.0
>gi|294440421|gb|ADE74631.1| unknown [Vitis vinifera] Back     alignment and taxonomy information
 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/722 (73%), Positives = 595/722 (82%), Gaps = 24/722 (3%)

Query: 3   NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP 62
           N+ T ETEDSF+S+ ELA+NNDV+GFKR LERD S+++EVGLWYGR  GSKQMV EHRTP
Sbjct: 29  NHLTVETEDSFSSLHELAANNDVDGFKRSLERDASAINEVGLWYGRQKGSKQMVLEHRTP 88

Query: 63  LMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGAD 122
           +MVAATYGSV+VLKLIL  S ADVN+SCG D++TALHCAASGGS N VDVV+LLLSAGAD
Sbjct: 89  MMVAATYGSVEVLKLILSRSDADVNISCGPDKSTALHCAASGGSVNAVDVVKLLLSAGAD 148

Query: 123 PDCVDANGHHPIDVIVLPPKLDSMRAILEEVF--GSKNSSVVVASGAEHNLTVSIGSSNS 180
           P+ +DANGH P+DVIV+PPKL SMR  LEE+   G+ + SV      E NL +SI SSNS
Sbjct: 149 PNSMDANGHFPVDVIVVPPKLPSMRVALEELLVNGASDGSV-----GERNLRISITSSNS 203

Query: 181 DYSSPLLTASASGSPPSPSRLVSSPMAL-KFNDVSFGTGAEKREYPIDPSLPDIKNSIYA 239
           + +SP L++S     P  S  VSSPMAL KF+D      +EK+EYPIDPSLPDIKNSIYA
Sbjct: 204 NSNSPPLSSSPENGSPFASDSVSSPMALSKFSDQPVTLASEKKEYPIDPSLPDIKNSIYA 263

Query: 240 TDEFRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRG 299
           TDEFRMFSFK+RPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRG
Sbjct: 264 TDEFRMFSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRG 323

Query: 300 DMCEYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYVSNGSVVPSPRS 359
           D+CEYAHGVFECWLHPAQYRTRLCKDGT+C RRVCFFAHT+EELRPLY+S GS VPSPR+
Sbjct: 324 DLCEYAHGVFECWLHPAQYRTRLCKDGTNCARRVCFFAHTSEELRPLYLSTGSAVPSPRA 383

Query: 360 SVSGASVMDMAAAL-LLPGSPSSMSGMSPNPFSQPMSPSGNGNLQSSMMWPQPNVPTLNL 418
           S   A+ MDMAAAL LLPGSPSS+S MSP+PF+QPMSPS NG   SS  WPQPNVPTLNL
Sbjct: 384 S-GPANAMDMAAALSLLPGSPSSVSVMSPSPFAQPMSPSANGISHSSGAWPQPNVPTLNL 442

Query: 419 PGSNIQSSRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNSVSLSRSCRPK 478
           PGSN QSSRLRSSL+ARDI P+DF+ L DFD+QQ +LNDL+CFSQ R N+ SLSRS R K
Sbjct: 443 PGSNFQSSRLRSSLNARDIPPEDFNMLLDFDAQQQLLNDLSCFSQPRTNAASLSRSARSK 502

Query: 479 TLTPSNLDELFSAEI-SSSPRFSDQAVFSPTHKSSVLN-QFQQPHSMLSPIKTNVFSPKN 536
           TLTPSNL+ELFSAEI SS       AVFSP+HKS++LN   QQ  SMLSPI TNVFSPKN
Sbjct: 503 TLTPSNLEELFSAEISSSPRYSDSSAVFSPSHKSAILNQFQQQQQSMLSPINTNVFSPKN 562

Query: 537 VEHPLLQASFRVGSPGRMSPRSVEPISPMGPRLAAFAQREKQQQQLHSLSSRDPISNNPI 596
           VEHPLLQASF + SPGRMSPRS+EPISPMGPRL+A AQREKQ QQL SLSSRD  SNNP 
Sbjct: 563 VEHPLLQASFGISSPGRMSPRSMEPISPMGPRLSAIAQREKQHQQLRSLSSRDLGSNNPA 622

Query: 597 PNIGSPRNVNSSWSKWGSPSGKLDWSIKGDELELLRRSSSCDLRNNNHEEPDLSWIHSIV 656
             +GSP N   SWSKWGSP+GKLDWS+ GDE+  L+RSSS +L  NN EEPDLSW+ S+V
Sbjct: 623 SVVGSPVN---SWSKWGSPTGKLDWSVNGDEMGRLKRSSSFEL-GNNGEEPDLSWVQSLV 678

Query: 657 KESPPEMMKEKTANPVVTTASSGEAL--------NSNSQADSFDHSVIGAWLEQMQLDQL 708
           KESPPEMMKEK A PV  +ASSGE L        NSNSQ DS DHSVIGAWLEQMQLDQL
Sbjct: 679 KESPPEMMKEKLAAPVSASASSGEGLNSNSQIESNSNSQIDSVDHSVIGAWLEQMQLDQL 738

Query: 709 VV 710
           VV
Sbjct: 739 VV 740

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359487288|ref|XP_002279202.2| PREDICTED: zinc finger CCCH domain-containing protein 30 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224055208|ref|XP_002298434.1| predicted protein [Populus trichocarpa] gi|118482842|gb|ABK93336.1| unknown [Populus trichocarpa] gi|222845692|gb|EEE83239.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224106079|ref|XP_002314035.1| predicted protein [Populus trichocarpa] gi|222850443|gb|EEE87990.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356548929|ref|XP_003542851.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 1 [Glycine max] gi|356548931|ref|XP_003542852.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255571544|ref|XP_002526718.1| nucleic acid binding protein, putative [Ricinus communis] gi|223533907|gb|EEF35632.1| nucleic acid binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|356530657|ref|XP_003533897.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] Back     alignment and taxonomy information
>gi|356544173|ref|XP_003540529.1| PREDICTED: zinc finger CCCH domain-containing protein 30-like [Glycine max] Back     alignment and taxonomy information
>gi|302398727|gb|ADL36658.1| C3HL domain class transcription factor [Malus x domestica] gi|302398729|gb|ADL36659.1| C3HL domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information
>gi|302398721|gb|ADL36655.1| C3HL domain class transcription factor [Malus x domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query710
TAIR|locus:2064647716 OXS2 "OXIDATIVE STRESS 2" [Ara 0.930 0.923 0.5 6.6e-168
TAIR|locus:2182250706 AT5G12850 [Arabidopsis thalian 0.939 0.944 0.463 4.4e-155
TAIR|locus:2178843607 AT5G58620 [Arabidopsis thalian 0.292 0.342 0.583 5.7e-111
TAIR|locus:2065058597 CZF1 [Arabidopsis thaliana (ta 0.174 0.207 0.782 3.5e-107
TAIR|locus:2082068580 SZF1 "salt-inducible zinc fing 0.174 0.213 0.75 1.2e-99
TAIR|locus:2118209356 OZF2 "oxidation-related zinc f 0.178 0.356 0.617 9.8e-50
UNIPROTKB|Q9FU27386 LOC_Os01g09620 "Zinc finger CC 0.188 0.347 0.654 2.5e-49
TAIR|locus:2024112393 SOM "SOMNUS" [Arabidopsis thal 0.173 0.312 0.625 7.7e-48
TAIR|locus:2043565315 ATCTH [Arabidopsis thaliana (t 0.166 0.374 0.7 9.8e-48
TAIR|locus:2052005359 OZF1 "Oxidation-related Zinc F 0.169 0.334 0.655 3e-46
TAIR|locus:2064647 OXS2 "OXIDATIVE STRESS 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1633 (579.9 bits), Expect = 6.6e-168, P = 6.6e-168
 Identities = 362/724 (50%), Positives = 437/724 (60%)

Query:     3 NNSTAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTP 62
             N+ T ETED+F S+LELA+NNDVEG +  +ERDPS VDE GLWYGR  GSK MV+++RTP
Sbjct:    35 NHLTVETEDTFASLLELAANNDVEGVRLSIERDPSCVDEAGLWYGRQKGSKAMVNDYRTP 94

Query:    63 LMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGAD 122
             LMVAATYGS+DV+KLI+  + ADVN +CG+D+TTALHCAASGG+ N + VV+LLL+AGAD
Sbjct:    95 LMVAATYGSIDVIKLIVSLTDADVNRACGNDQTTALHCAASGGAVNAIQVVKLLLAAGAD 154

Query:   123 PDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDY 182
              + +DA G    DVIV+PPKL+ ++ +L+E+  +  SS      AE NL V     N   
Sbjct:   155 LNLLDAEGQRAGDVIVVPPKLEGVKLMLQELLSADGSST-----AERNLRVVTNVPNRS- 208

Query:   183 XXXXXXXXXXXXXXXXXXXXXXXMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDE 242
                                       K     F     K+EYP+DPSLPDIKNSIYATDE
Sbjct:   209 --SSPCHSPTGENGGSGSGSPLGSPFKLKSTEF-----KKEYPVDPSLPDIKNSIYATDE 261

Query:   243 FRMFSFKIRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC 302
             FRM+SFK+RPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC
Sbjct:   262 FRMYSFKVRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMC 321

Query:   303 EYAHGVFECWLHPAQYRTRLCKDGTSCDRRVCFFAHTAEELRPLYXXXXXXXXXXXXXXX 362
             EYAHGVFECWLHPAQYRTRLCKDGT C RRVCFFAHT EELRPLY               
Sbjct:   322 EYAHGVFECWLHPAQYRTRLCKDGTGCARRVCFFAHTPEELRPLYASTGSAVPSPRSNAD 381

Query:   363 XXXXMDXXXXXXXXXXXXXXXXXXXNPFSQPMSPS--GNGNLQSSMMWPQPNVPTLNLPG 420
                 +                         P+SPS  GNG   S+M WPQPNVP L+LPG
Sbjct:   382 YAAALSLLPGSPSGVSVMS-----------PLSPSAAGNGMSHSNMAWPQPNVPALHLPG 430

Query:   421 SNIQXXXXXXXXXARDILPXXXXXXXXXXXQQHILNDLTCFSQARNNSVSLSRSCRPKTL 480
             SN+Q         ARDI P           QQ +LN+   +S A + S  + +S  P  L
Sbjct:   431 SNLQSSRLRSSLNARDI-PTDEFNMLADYEQQQLLNE---YSNALSRSGRM-KSMPPSNL 485

Query:   481 TPS-NLDELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQPH----SMLSPIKTNVFSPK 535
                 + +   S   + S   S  AVFSPTHKS+V NQFQQ      SMLSPI T+  SPK
Sbjct:   486 EDLFSAEGSSSPRFTDSALAS--AVFSPTHKSAVFNQFQQQQQQQQSMLSPINTSFSSPK 543

Query:   536 NVEHPLLQASFRVGSPGRMSPRSVEPISPMGPRLAAFAQ-------REKQQQQLH---SL 585
             +V+H L     R+ SP  +    VEPISPM  R++  AQ       +++QQQQ H   SL
Sbjct:   544 SVDHSLFSGGGRM-SPRNV----VEPISPMSARVSMLAQCVKQQQQQQQQQQQQHQFRSL 598

Query:   586 SSRDPISNNPIPNIGSPRNVNXXXXXXXXXXXXLDWSIKGDELELLRRSSSCDLRNNNHE 645
             SSR+ +  N  P +GSP N N             DW +  + L  LR SSS D      +
Sbjct:   599 SSRE-LRTNSSPIVGSPVNNNTWSSKWGSSNGQPDWGMSSEALGKLRSSSSFD-----GD 652

Query:   646 EPDLSWIHSIVKESPPEMMKEKTANPVVTTASSGEALNSNSQADSFDHSVIGAWLEQMQL 705
             EPD+SW+ S+VKE+P E  KEK A    +++        N      DH+ + AW+EQMQL
Sbjct:   653 EPDVSWVQSLVKETPAEA-KEKAAT---SSSGEHVMKQPNPVEPVMDHAGLEAWIEQMQL 708

Query:   706 DQLV 709
             DQLV
Sbjct:   709 DQLV 712
GO:0003676 "nucleic acid binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=RCA;TAS
GO:0005737 "cytoplasm" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
TAIR|locus:2182250 AT5G12850 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2178843 AT5G58620 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2065058 CZF1 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2082068 SZF1 "salt-inducible zinc finger 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2118209 OZF2 "oxidation-related zinc finger 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9FU27 LOC_Os01g09620 "Zinc finger CCCH domain-containing protein 2" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2024112 SOM "SOMNUS" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043565 ATCTH [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2052005 OZF1 "Oxidation-related Zinc Finger 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q10EL1C3H24_ORYSJNo assigned EC number0.57960.95210.8848yesno
P93755C3H30_ARATHNo assigned EC number0.58460.92250.9148yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00028802001
SubName- Full=Chromosome chr13 scaffold_45, whole genome shotgun sequence; (713 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-09
smart0035627 smart00356, ZnF_C3H1, zinc finger 5e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-05
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 1e-04
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-04
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-04
smart0024830 smart00248, ANK, ankyrin repeats 6e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-04
smart0024830 smart00248, ANK, ankyrin repeats 0.001
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
pfam0064227 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H t 0.003
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information 
 Score = 79.3 bits (196), Expect = 1e-17
 Identities = 50/146 (34%), Positives = 71/146 (48%), Gaps = 23/146 (15%)

Query: 7   AETEDSFTSMLELASNNDVEGFKRMLER--DPSSVDEVGLWYGRVNGSKQMVSEHRTPLM 64
           A  ED  T +   ASN  +E  K +LE   D ++ D  G                RTPL 
Sbjct: 2   ARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDG----------------RTPLH 45

Query: 65  VAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPD 124
           +AA  G ++++KL LL   ADVN     D  T LH AA  G+   +DVV+LLL  GAD +
Sbjct: 46  LAAKNGHLEIVKL-LLEKGADVNA-RDKDGNTPLHLAARNGN---LDVVKLLLKHGADVN 100

Query: 125 CVDANGHHPIDVIVLPPKLDSMRAIL 150
             D +G  P+ +      L+ ++ +L
Sbjct: 101 ARDKDGRTPLHLAAKNGHLEVVKLLL 126

The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|214632 smart00356, ZnF_C3H1, zinc finger Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|144294 pfam00642, zf-CCCH, Zinc finger C-x8-C-x5-C-x3-H type (and similar) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 710
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.97
PHA02791284 ankyrin-like protein; Provisional 99.96
KOG4412226 consensus 26S proteasome regulatory complex, subun 99.96
PHA03095471 ankyrin-like protein; Provisional 99.96
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.95
PHA02874434 ankyrin repeat protein; Provisional 99.95
KOG0510929 consensus Ankyrin repeat protein [General function 99.95
PHA02875413 ankyrin repeat protein; Provisional 99.95
KOG0509600 consensus Ankyrin repeat and DHHC-type Zn-finger d 99.94
PHA02878477 ankyrin repeat protein; Provisional 99.94
PHA02946446 ankyin-like protein; Provisional 99.94
PHA03100480 ankyrin repeat protein; Provisional 99.94
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.94
PHA02798489 ankyrin-like protein; Provisional 99.94
PHA03095471 ankyrin-like protein; Provisional 99.94
PHA03100480 ankyrin repeat protein; Provisional 99.94
PHA02874434 ankyrin repeat protein; Provisional 99.94
PHA02946446 ankyin-like protein; Provisional 99.93
PHA02989494 ankyrin repeat protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02716764 CPXV016; CPX019; EVM010; Provisional 99.93
PHA02875413 ankyrin repeat protein; Provisional 99.93
PHA02989494 ankyrin repeat protein; Provisional 99.93
PHA02876682 ankyrin repeat protein; Provisional 99.93
PHA02878477 ankyrin repeat protein; Provisional 99.92
PHA02791284 ankyrin-like protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
KOG0508615 consensus Ankyrin repeat protein [General function 99.91
PHA02798489 ankyrin-like protein; Provisional 99.91
KOG0510 929 consensus Ankyrin repeat protein [General function 99.9
PHA02917661 ankyrin-like protein; Provisional 99.89
PHA02859209 ankyrin repeat protein; Provisional 99.89
KOG0508615 consensus Ankyrin repeat protein [General function 99.87
PHA02917661 ankyrin-like protein; Provisional 99.87
PHA02795437 ankyrin-like protein; Provisional 99.87
PHA02795437 ankyrin-like protein; Provisional 99.86
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.85
KOG0514452 consensus Ankyrin repeat protein [General function 99.85
PLN03192823 Voltage-dependent potassium channel; Provisional 99.84
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.84
KOG41771143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PHA02792631 ankyrin-like protein; Provisional 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.83
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.82
PHA02743166 Viral ankyrin protein; Provisional 99.82
PHA02730672 ankyrin-like protein; Provisional 99.82
PHA02730672 ankyrin-like protein; Provisional 99.81
PLN03192823 Voltage-dependent potassium channel; Provisional 99.81
TIGR00870743 trp transient-receptor-potential calcium channel p 99.81
PHA02792631 ankyrin-like protein; Provisional 99.8
PHA02884300 ankyrin repeat protein; Provisional 99.79
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.78
PHA02736154 Viral ankyrin protein; Provisional 99.78
PHA02743166 Viral ankyrin protein; Provisional 99.76
TIGR00870743 trp transient-receptor-potential calcium channel p 99.76
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.76
PHA02741169 hypothetical protein; Provisional 99.76
KOG0505527 consensus Myosin phosphatase, regulatory subunit [ 99.75
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.73
PHA02884300 ankyrin repeat protein; Provisional 99.72
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.71
KOG0514452 consensus Ankyrin repeat protein [General function 99.71
PHA02736154 Viral ankyrin protein; Provisional 99.71
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.67
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.66
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.66
KOG0195448 consensus Integrin-linked kinase [Signal transduct 99.64
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.62
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.56
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.55
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.55
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.55
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.55
KOG3676782 consensus Ca2+-permeable cation channel OSM-9 and 99.5
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.46
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.42
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.4
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.34
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.29
PTZ00322664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.29
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.28
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.22
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.19
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.17
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.14
KOG1710396 consensus MYND Zn-finger and ankyrin repeat protei 99.04
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.76
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.71
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.68
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.64
KOG0818669 consensus GTPase-activating proteins of the GIT fa 98.54
PF1360630 Ank_3: Ankyrin repeat 98.47
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.43
PF1360630 Ank_3: Ankyrin repeat 98.43
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.43
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.34
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.32
KOG0522560 consensus Ankyrin repeat protein [General function 98.32
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.31
KOG1595528 consensus CCCH-type Zn-finger protein [General fun 98.26
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.19
KOG0522560 consensus Ankyrin repeat protein [General function 98.13
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.08
KOG0520975 consensus Uncharacterized conserved protein, conta 97.99
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.96
KOG0511516 consensus Ankyrin repeat protein [General function 97.96
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 97.93
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.86
KOG2384223 consensus Major histocompatibility complex protein 97.85
KOG0511516 consensus Ankyrin repeat protein [General function 97.82
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 97.78
KOG0520975 consensus Uncharacterized conserved protein, conta 97.71
KOG2384223 consensus Major histocompatibility complex protein 97.62
KOG0521785 consensus Putative GTPase activating proteins (GAP 97.46
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 96.8
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.27
KOG2505591 consensus Ankyrin repeat protein [General function 96.24
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.2
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 95.38
KOG2505591 consensus Ankyrin repeat protein [General function 94.57
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 93.88
smart0035627 ZnF_C3H1 zinc finger. 93.17
PF0064227 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and si 92.52
KOG1677332 consensus CCCH-type Zn-finger protein [General fun 92.19
COG5063351 CTH1 CCCH-type Zn-finger protein [General function 91.34
smart0035627 ZnF_C3H1 zinc finger. 88.78
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 87.42
KOG2333 614 consensus Uncharacterized conserved protein [Gener 85.28
PF1460819 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type 84.63
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 83.07
KOG2494331 consensus C3H1-type Zn-finger protein [Transcripti 80.05
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-81  Score=683.04  Aligned_cols=502  Identities=42%  Similarity=0.644  Sum_probs=386.4

Q ss_pred             hhHHHHHHHcCCHHHHHHHHhcCCCCccccccccccccCCcccCCCCChHHHHHHHcCCHHHHHHHHhcCCCCcccccCC
Q 005175           13 FTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGS   92 (710)
Q Consensus        13 ~TpLh~AA~~Gdle~Vk~LLe~~gadVn~~~L~~a~~~g~~~~d~~G~TPLH~AA~~G~~evVklLLe~~GADVN~~~d~   92 (710)
                      .|-|-+-++.++++-+|.++++.+..++..++||.+..+.+.+..+.+|||++|+.+|.++++.+++...-.++|..|..
T Consensus        12 ls~~~e~~~~~~~~~~k~~~~e~~~~~~~~~~~~r~~~~~k~~~~~qR~~~~v~~~~Gs~~~~~~i~~~~~~e~~~~C~~   91 (528)
T KOG1595|consen   12 LSCLSEFEAPNDYAYLKEFRVEQPLFLQHKCLQHRPFVCFKWHFLNQRRRRPVARRDGSFNYSPDIYCTKYDEVTGICPD   91 (528)
T ss_pred             hhcchhhccccHHHHHHHHHHhchhhhhhhhcccccchhhhhhhhccccccchhhhcCccccccceeecchhhccccCCC
Confidence            34455677789999999999988999999999999999999999999999999999999999999998867889988765


Q ss_pred             CCCcHHHHHHhCCCCCHHHHHHHHHHCCCCCCCCCCCCCcH---HHHHhcCCCHHHHHHHHHHHHhCCCCchhhhccccc
Q 005175           93 DRTTALHCAASGGSANVVDVVRLLLSAGADPDCVDANGHHP---IDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEH  169 (710)
Q Consensus        93 ~G~TPLH~Aa~~G~~~~~eiVklLLe~GAd~n~~D~~G~TP---LhlAa~~G~~eivk~LLe~Ll~~ga~~~~~aa~~~~  169 (710)
                      ++.   |+|+.+...+.++++..|+..++..+.+|..|+-+   ||.|...+-.+ .+..++.+++.+..          
T Consensus        92 ~~~---~C~~~g~s~~~~e~~~hL~~~k~~~~~tda~g~~~~~v~~~~~~~~~~~-~r~~~~~l~e~~~~----------  157 (528)
T KOG1595|consen   92 GDE---HCAVLGRSVGDTERTYHLRYYKTLPCVTDARGNCVKNVLHCAFAHGPND-LRPPVEDLLELQGG----------  157 (528)
T ss_pred             Ccc---cchhcccccCCcceeEeccccccccCccccCCCcccCcccccccCCccc-cccHHHHHHhcccc----------
Confidence            554   88888877777999999999999999999998855   45455443322 22333333322200          


Q ss_pred             cccccccCCCCCCCChhchhHhhCCCchhhhccCCCccccCCCCccccccccCCCCCCCCCCcccccccccccccccccc
Q 005175          170 NLTVSIGSSNSDYSSPLLTASASGSPPSPSRLVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFK  249 (710)
Q Consensus       170 ~l~~~in~~d~~G~TPLH~Aa~~G~~eile~l~d~n~~~~~g~TpLh~Aa~~g~~~i~~~L~d~ga~i~~~De~g~~~f~  249 (710)
                                            .|            ..+.........+  .-.++.++.+++++ ++|.+|+|+||.||
T Consensus       158 ----------------------~~------------~~~~e~~~~~~~~--~~~y~~Dp~~pdi~-~~ys~DeFrMy~fK  200 (528)
T KOG1595|consen  158 ----------------------SG------------LPDDEPEVESKLD--VTEYPEDPSWPDIN-GIYSSDEFRMYSFK  200 (528)
T ss_pred             ----------------------cC------------ccCCCcccccccc--cccccCCCCccccc-ccccccceEEEeee
Confidence                                  00            0000000000000  11788999999998 99999999999999


Q ss_pred             ccccccccCCCCCCCccccCCCCccCCCCCcCccccCCCCCCCCCCCCCCCCccccccceeccCCCCccccccCCCCCCC
Q 005175          250 IRPCSRAYSHDWTECPFVHPGENARRRDPRKFHYSCVPCPDFRKGACRRGDMCEYAHGVFECWLHPAQYRTRLCKDGTSC  329 (710)
Q Consensus       250 v~pCsr~~shdwteCpf~HpGe~arRRdpR~y~Ys~~~CP~~rkG~C~~GD~C~~aH~~~E~~~hP~~ykt~~C~~~~~C  329 (710)
                      |++|.|+++||||+|||+||||++|||+||+|+|++++||+|+||.|++||.|+|||+++|||+||++|||++|||+++|
T Consensus       201 ir~C~R~~shDwteCPf~HpgEkARRRDPRkyhYs~tpCPefrkG~C~rGD~CEyaHgvfEcwLHPa~YRT~~CkDg~~C  280 (528)
T KOG1595|consen  201 IRRCSRPRSHDWTECPFAHPGEKARRRDPRKYHYSSTPCPEFRKGSCERGDSCEYAHGVFECWLHPARYRTRKCKDGGYC  280 (528)
T ss_pred             ecccCCccCCCcccCCccCCCcccccCCcccccccCccCcccccCCCCCCCccccccceehhhcCHHHhccccccCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcccccCCccccccccccCCCCCCC-CCCCCCCCchhhHHHhhcCCCCCCCCCCCCCCCCCCCCCCCCCCCCC--CCC
Q 005175          330 DRRVCFFAHTAEELRPLYVSNGSVVPS-PRSSVSGASVMDMAAALLLPGSPSSMSGMSPNPFSQPMSPSGNGNLQ--SSM  406 (710)
Q Consensus       330 ~~~~C~faH~~~elr~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~  406 (710)
                      +|+||||||.++|||+++.++|+.+++ |+++.+    .+|.+.+ .+      .+.+|++.+||++|++++.++  ..+
T Consensus       281 ~RrvCfFAH~~eqLR~l~~s~~s~~~~sp~~s~~----sp~~~~~-~~------~~~s~~~~~~p~sp~~~~~~~~~~~~  349 (528)
T KOG1595|consen  281 PRRVCFFAHSPEQLRPLPPSTGSDRPSSPSSSSA----SPMMASL-RS------LPFSPSPGSPPLSPSANGVSSPIASG  349 (528)
T ss_pred             ccceEeeecChHHhcccCCCCCCCCCCCcccccC----CCCcccc-cc------CCCCCCCCCCCCCccccccccccccc
Confidence            999999999999999999999999888 665421    2332222 11      222334588999999888544  578


Q ss_pred             CCCCCCCCCcCCCCCCccc-hhhcccccccCCCccccccccchhhhhhhhhhccccccCcCCCccccccCCCCCCCCCch
Q 005175          407 MWPQPNVPTLNLPGSNIQS-SRLRSSLSARDILPDDFSSLSDFDSQQHILNDLTCFSQARNNSVSLSRSCRPKTLTPSNL  485 (710)
Q Consensus       407 ~~~~~~~~~~~~~~~~~~~-s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  485 (710)
                      .|.+++++++..|+.+|++ |||++.++||||...     ..+++                                -||
T Consensus       350 ~s~~~~~~~~~~p~~~~~~~Srl~s~~~a~~i~~~-----~~~~~--------------------------------~~l  392 (528)
T KOG1595|consen  350 GSRSLNSNSPSSPAAPLRSFSRLSSSLSAADISMS-----SPMNL--------------------------------GNL  392 (528)
T ss_pred             cccccCCCCCCCccccccccccccccccccccccc-----ccccc--------------------------------ccc
Confidence            9999999999999999998 999999999998431     11111                                089


Q ss_pred             hHhhhhccCCCCCCCCCcccccccccccccccccc-cccCCCCccccCC-CCCCCCccccccccCCCCCCCCCCCCCCCC
Q 005175          486 DELFSAEISSSPRFSDQAVFSPTHKSSVLNQFQQP-HSMLSPIKTNVFS-PKNVEHPLLQASFRVGSPGRMSPRSVEPIS  563 (710)
Q Consensus       486 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  563 (710)
                      +++|+++.++                ++.+|+|+. +.+++|++++.++ .++++           ++..|.-+    ..
T Consensus       393 ~~~f~s~~ss----------------sl~~~~~~~~~~~tsP~~~~~~~~~~~~e-----------~s~~~~~~----~~  441 (528)
T KOG1595|consen  393 SELFSSPDSS----------------SLNPQLQVLSSAPTSPVFTDTASFGSSVE-----------SSPAMEGR----SQ  441 (528)
T ss_pred             hhhhcCcccc----------------ccchhhhhcccCCcCCcCCcccccccccc-----------cchhhhcc----cc
Confidence            9999998875                445666654 5688888877222 23332           22223211    15


Q ss_pred             CcchhH-HHHHHHHHHHHhhhccccCCCCCCCCCCCCCCCCCCCCCCccCCCCCC-CCccccChhhhccccccccccCCC
Q 005175          564 PMGPRL-AAFAQREKQQQQLHSLSSRDPISNNPIPNIGSPRNVNSSWSKWGSPSG-KLDWSIKGDELELLRRSSSCDLRN  641 (710)
Q Consensus       564 ~~~~r~-~a~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~w~s~~g-k~dw~~~~~el~~~~~s~sf~~~~  641 (710)
                      +|++|. .+|++|+-+      ++. +.       ..+++...+...+|||+.+| |+||++|+|||+|+|++.||+.+.
T Consensus       442 ~~~~r~l~~~l~~~~~------~s~-~~-------~~~~~~~~~~~~~d~g~~~g~~~d~~~~~~~l~~~r~~~s~~~~~  507 (528)
T KOG1595|consen  442 VMSSRELRASLKRSST------LSD-KP-------AMNSSGQFSFNNSDWGPRAGELLDWGVQSDLLNKLRESTSFELGS  507 (528)
T ss_pred             cccchhhhhhhccccc------ccc-cc-------cccCccccccccCCcCcccCcccchhhhHHHHhhcccCcccccCC
Confidence            899998 677776421      222 11       11111111124489999999 999999999999999999999987


Q ss_pred             CCCCCCCccchhhcccCCC
Q 005175          642 NNHEEPDLSWIHSIVKESP  660 (710)
Q Consensus       642 ~~~~epd~swv~~~~~~~~  660 (710)
                        ..||||||||+||||.+
T Consensus       508 --~~~pd~swv~~ll~~~~  524 (528)
T KOG1595|consen  508 --AGEPDVSWVQSLLKEPA  524 (528)
T ss_pred             --CCCcCcchhhhhccccc
Confidence              44999999999999986

>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF00642 zf-CCCH: Zinc finger C-x8-C-x5-C-x3-H type (and similar); InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5063 CTH1 CCCH-type Zn-finger protein [General function prediction only] Back     alignment and domain information
>smart00356 ZnF_C3H1 zinc finger Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2333 consensus Uncharacterized conserved protein [General function prediction only] Back     alignment and domain information
>PF14608 zf-CCCH_2: Zinc finger C-x8-C-x5-C-x3-H type Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 3e-10
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 6e-09
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-09
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-08
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 1e-07
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 2e-06
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-06
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 7e-06
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 8e-06
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 8e-06
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-05
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-05
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-05
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-05
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 3e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 1e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-04
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-04
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 52/140 (37%), Positives = 73/140 (52%), Gaps = 24/140 (17%)
Query: 16  MLELASNNDVEGFKRMLER--DPSSVDEVG---LWYGRVNGSKQMV-------------- 56
           ++E A N + +  K +LE   DP++ D  G   L Y   NG K++V              
Sbjct: 8   LIEAAENGNKDRVKDLLENGADPNASDSDGRTPLHYAAENGHKEIVKLLLSKGADPNAKD 67
Query: 57  SEHRTPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLL 116
           S+ RTPL  AA  G  +++KL LL   AD N    SD  T LH AA  G     ++V+LL
Sbjct: 68  SDGRTPLHYAAENGHKEIVKL-LLSKGADPNAK-DSDGRTPLHYAAENGHK---EIVKLL 122
Query: 117 LSAGADPDCVDANGHHPIDV 136
           LS GADP+  D++G  P+D+
Sbjct: 123 LSKGADPNTSDSDGRTPLDL 142
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query710
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-19
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-09
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-07
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-19
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-18
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-04
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 3e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-11
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 9e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-16
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-13
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-09
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-16
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 8e-10
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 4e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-17
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-11
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-13
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-13
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-10
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 8e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-08
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-16
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-15
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-11
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-15
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-12
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-16
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 5e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-16
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-16
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-16
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-15
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-16
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-14
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-12
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-06
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-06
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 9e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-14
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-13
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-15
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-14
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-15
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-14
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-11
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-15
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 8e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-13
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-07
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-10
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 5e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-10
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 8e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-12
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-09
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-04
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-11
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-14
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-09
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-13
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-07
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-12
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-09
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-06
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 5e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-04
2rfa_A232 Transient receptor potential cation channel subfa 6e-13
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A232 Transient receptor potential cation channel subfa 4e-12
2rfa_A232 Transient receptor potential cation channel subfa 1e-11
2rfa_A232 Transient receptor potential cation channel subfa 6e-04
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 1e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-10
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-08
2etb_A256 Transient receptor potential cation channel subfam 2e-10
2etb_A256 Transient receptor potential cation channel subfam 6e-10
2etb_A256 Transient receptor potential cation channel subfam 4e-09
2etb_A256 Transient receptor potential cation channel subfam 1e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-06
2pnn_A273 Transient receptor potential cation channel subfa 5e-10
2pnn_A273 Transient receptor potential cation channel subfa 6e-10
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A273 Transient receptor potential cation channel subfa 9e-05
2pnn_A273 Transient receptor potential cation channel subfa 1e-04
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 9e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-08
1sw6_A327 Regulatory protein SWI6; transcription regulation, 7e-08
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 3e-09
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 4e-09
2rhk_C72 Cleavage and polyadenylation specificity factor su 1e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 8e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-07
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 5e-05
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 7e-04
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
 Score = 83.3 bits (207), Expect = 5e-19
 Identities = 36/129 (27%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 7   AETEDSFTSMLELASNNDVEGFKRMLER--DPSSVDEVGLWYGRVNGSKQMVSEHRTPLM 64
           +  E S   +   A+   VE  + +LE   +P++ +  G                R P+ 
Sbjct: 7   SSMEPSADWLATAAARGRVEEVRALLEAGANPNAPNSYG----------------RRPIQ 50

Query: 65  VAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGADPD 124
           V    GS  V +L+LLH  A+ N +  +  T  +H AA  G    +D + +L  AGA  D
Sbjct: 51  VMM-MGSARVAELLLLHG-AEPNCADPATLTRPVHDAAREGF---LDTLVVLHRAGARLD 105

Query: 125 CVDANGHHP 133
             DA G  P
Sbjct: 106 VRDAWGRLP 114
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Length = 70 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Length = 77 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Length = 83 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Length = 98 Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Length = 72 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Length = 80 Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.98
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.97
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.97
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.97
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.97
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.97
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.97
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.97
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.97
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.97
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.97
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.96
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.96
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
2pnn_A273 Transient receptor potential cation channel subfa 99.95
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
2etb_A256 Transient receptor potential cation channel subfam 99.94
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.91
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.9
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.9
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.9
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.9
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.89
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.87
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.87
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.87
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.86
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.86
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.86
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.85
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.83
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.82
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.82
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.82
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.8
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.78
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.74
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.74
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.67
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 98.59
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 98.29
2e5s_A98 Otthump00000018578; ZF-CCCHX2 domain, muscleblind- 97.6
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 97.51
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 97.26
2rhk_C72 Cleavage and polyadenylation specificity factor su 96.9
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.63
2d9m_A69 Zinc finger CCCH-type domain containing protein 7A 96.52
3d2n_A83 Muscleblind-like protein 1; tandem zinc finger dom 96.45
1m9o_A77 Tristetraproline; Cys3His type zinc finger, metal 96.11
2rpp_A89 Muscleblind-like protein 2; zinc finger domain, C3 95.63
2cqe_A98 KIAA1064 protein; CCCH zinc-finger, structural gen 90.04
2d9n_A77 Cleavage and polyadenylation specificity factor, 3 87.93
3d2q_A70 Muscleblind-like protein 1; tandem zinc finger dom 85.13
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 83.63
2lhn_A80 Nuclear polyadenylated RNA-binding protein NAB2; n 80.42
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
Probab=99.98  E-value=9.4e-33  Score=283.17  Aligned_cols=209  Identities=16%  Similarity=0.121  Sum_probs=179.0

Q ss_pred             CCCCCCCChhHHHHHHHcCCHHHHHHHHhcCCCC---ccccccccccccCCcccCCCCChHHHHHHHcCCHHHHHHHHhc
Q 005175            5 STAETEDSFTSMLELASNNDVEGFKRMLERDPSS---VDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLH   81 (710)
Q Consensus         5 in~~d~dG~TpLh~AA~~Gdle~Vk~LLe~~gad---Vn~~~L~~a~~~g~~~~d~~G~TPLH~AA~~G~~evVklLLe~   81 (710)
                      ++..|.+|.||||+||..|++++|++||+ .+++   ++..             +..|+||||+||..|+.++|++||++
T Consensus         2 ~~~~d~~g~t~L~~A~~~g~~~~v~~Ll~-~g~~~~~~~~~-------------~~~g~t~L~~A~~~g~~~~v~~Ll~~   67 (282)
T 1oy3_D            2 FGYVTEDGDTALHLAVIHQHEPFLDFLLG-FSAGHEYLDLQ-------------NDLGQTALHLAAILGEASTVEKLYAA   67 (282)
T ss_dssp             CCCCCTTCCCHHHHHHHTTCHHHHHHHHH-HHTTSGGGGCC-------------CTTSCCHHHHHHHHTCHHHHHHHHHT
T ss_pred             CCccCCCCCcHHHHHHHcCCHHHHHHHHh-cCCCccccccc-------------CCCCCCHHHHHHHcCCHHHHHHHHHc
Confidence            56789999999999999999999999999 5665   5554             58899999999999999999999999


Q ss_pred             CCCCcccccCCCCCcHHHHHHhCCCCCHHHHHHHHHHCCCC---------------------------------------
Q 005175           82 SSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGAD---------------------------------------  122 (710)
Q Consensus        82 ~GADVN~~~d~~G~TPLH~Aa~~G~~~~~eiVklLLe~GAd---------------------------------------  122 (710)
                       |++++.. +..|+||||+|+..|+   .+++++|+++|++                                       
T Consensus        68 -ga~~~~~-~~~g~tpL~~A~~~~~---~~~v~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  142 (282)
T 1oy3_D           68 -GAGVLVA-ERGGHTALHLACRVRA---HTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEP  142 (282)
T ss_dssp             -TCCSSCC-CTTSCCHHHHHTTTTC---HHHHHHHSSSCCSSCCCC----------------------------------
T ss_pred             -CCCCCCC-CCCCCCHHHHHHHcCC---cchhHhhhccCCCCchhhHHHHhhcccccCcchhcchhhhccccccchhhhh
Confidence             9999999 9999999999999999   9999999998865                                       


Q ss_pred             --------CCCCCCCCCcHHHHHhcCCCHHHHHHHHHHHHhCCCCchhhhccccccccccccCCCC-CCCChhchhHhhC
Q 005175          123 --------PDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNS-DYSSPLLTASASG  193 (710)
Q Consensus       123 --------~n~~D~~G~TPLhlAa~~G~~eivk~LLe~Ll~~ga~~~~~aa~~~~~l~~~in~~d~-~G~TPLH~Aa~~G  193 (710)
                              ++.+|..|.||||+|+..|+.++++.|++.    |+               +++..+. .|.||||+|+..|
T Consensus       143 ~~~~~~~~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~----g~---------------~~~~~~~~~g~tpL~~A~~~~  203 (282)
T 1oy3_D          143 RDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDA----GA---------------DLNKPEPTCGRTPLHLAVEAQ  203 (282)
T ss_dssp             -CCCGGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHH----TC---------------CTTCCCTTTCCCHHHHHHHTT
T ss_pred             hhhhhhhcCCCcCCCCcCHHHHHHHcCCHHHHHHHHHc----CC---------------CCCCCCCCCCcCHHHHHHHcC
Confidence                    778899999999999999999988888774    32               4455554 4999999999999


Q ss_pred             CCchhhhc----cCCCccccCCCCccccccccCCCCCCCCCCcccccccccccccccccccc
Q 005175          194 SPPSPSRL----VSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNSIYATDEFRMFSFKIR  251 (710)
Q Consensus       194 ~~eile~l----~d~n~~~~~g~TpLh~Aa~~g~~~i~~~L~d~ga~i~~~De~g~~~f~v~  251 (710)
                      +.+++++|    ++++.++..|.||||+|+..++..+++.|++.|++++..|..|.+++...
T Consensus       204 ~~~~v~~Ll~~gad~~~~d~~g~tpL~~A~~~~~~~~v~~Ll~~ga~~~~~~~~g~tpl~~a  265 (282)
T 1oy3_D          204 AASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAPEPEDGGDKLSPCSSS  265 (282)
T ss_dssp             CHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCCCCCCC----------
T ss_pred             CHHHHHHHHHcCCCCcccccCCCCHHHHHHHcCCcHHHHHHHHcCCCcCcCCCccccccccc
Confidence            99995554    57778999999999999999999999999999999999999999988766
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2e5s_A Otthump00000018578; ZF-CCCHX2 domain, muscleblind-like 2, isoform 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rhk_C Cleavage and polyadenylation specificity factor subunit 4; influenza A, nonstructural protein, viral protein: HOST complex, Zn finger; 1.95A {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9m_A Zinc finger CCCH-type domain containing protein 7A; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2n_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 2.70A {Homo sapiens} Back     alignment and structure
>1m9o_A Tristetraproline; Cys3His type zinc finger, metal binding protein; NMR {Mus musculus} SCOP: g.66.1.1 PDB: 1rgo_A Back     alignment and structure
>2rpp_A Muscleblind-like protein 2; zinc finger domain, C3H, alternative splicing, cytoplasm, metal-binding, nucleus, RNA-binding, zinc, zinc-finger; NMR {Homo sapiens} Back     alignment and structure
>2cqe_A KIAA1064 protein; CCCH zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.66.1.1 g.66.1.1 Back     alignment and structure
>2d9n_A Cleavage and polyadenylation specificity factor, 30 kDa subunit; CCCH zinc-finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3d2q_A Muscleblind-like protein 1; tandem zinc finger domain, alternative splicing, metal- binding, nucleus, RNA-binding, zinc, zinc-finger, metal binding; 1.50A {Homo sapiens} PDB: 3d2s_A Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2lhn_A Nuclear polyadenylated RNA-binding protein NAB2; nuclear protein; NMR {Saccharomyces cerevisiae S288C} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 710
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-09
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 9e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.001
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-12
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-08
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-10
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-07
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-09
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 7e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-06
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-05
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-05
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-04
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 3e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.002
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 2e-04
d1rgoa136 g.66.1.1 (A:151-186) Butyrate response factor 2 (T 7e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 8e-04
d1m9oa_40 g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 76.2 bits (186), Expect = 3e-15
 Identities = 25/91 (27%), Positives = 38/91 (41%), Gaps = 5/91 (5%)

Query: 61  TPLMVAATYGSVDVLKLILLHSSADVNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAG 120
           TPL VA+  G + ++K  LL   A  NV       T LH AA  G     +V + LL   
Sbjct: 2   TPLHVASFMGHLPIVKN-LLQRGASPNV-SNVKVETPLHMAARAGH---TEVAKYLLQNK 56

Query: 121 ADPDCVDANGHHPIDVIVLPPKLDSMRAILE 151
           A  +    +   P+         + ++ +LE
Sbjct: 57  AKVNAKAKDDQTPLHCAARIGHTNMVKLLLE 87
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Length = 40 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query710
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.96
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.93
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.92
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.92
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.91
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.91
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.89
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.89
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.88
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.87
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.87
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.86
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.84
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.84
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.84
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.83
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.81
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.77
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.73
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 98.3
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 98.29
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 97.96
d1m9oa_40 Tristetraproline (ttp, tis11, nup475) {Mouse (Mus 97.13
d1rgoa136 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.9
d1rgoa234 Butyrate response factor 2 (Tis11D) {Human (Homo s 96.43
d2cqea229 Zinc finger CCCH domain-containing protein C19orf7 89.03
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.96  E-value=7.3e-30  Score=256.63  Aligned_cols=197  Identities=16%  Similarity=0.113  Sum_probs=167.2

Q ss_pred             CCCCCCChhHHHHHHHcCCHHHHHHHHhcCCCCccccccccccccCCcccCCCCChHHHHHHHcCCHHHHHHHHhcCCCC
Q 005175            6 TAETEDSFTSMLELASNNDVEGFKRMLERDPSSVDEVGLWYGRVNGSKQMVSEHRTPLMVAATYGSVDVLKLILLHSSAD   85 (710)
Q Consensus         6 n~~d~dG~TpLh~AA~~Gdle~Vk~LLe~~gadVn~~~L~~a~~~g~~~~d~~G~TPLH~AA~~G~~evVklLLe~~GAD   85 (710)
                      ...|++|.||||+||..|+.++|++||+ .+++++..+          ..+..|+||||+||..|+.++|++||++ |++
T Consensus         3 ~~i~~~G~t~Lh~A~~~~~~~~v~~Ll~-~~a~~~~i~----------~~~~~g~TpL~~A~~~g~~~iv~~Ll~~-ga~   70 (255)
T d1oy3d_           3 GYVTEDGDTALHLAVIHQHEPFLDFLLG-FSAGHEYLD----------LQNDLGQTALHLAAILGEASTVEKLYAA-GAG   70 (255)
T ss_dssp             CCCCTTCCCHHHHHHHTTCHHHHHHHHH-HHTTSGGGG----------CCCTTSCCHHHHHHHHTCHHHHHHHHHT-TCC
T ss_pred             ccCCcCCCCHHHHHHHcCCHHHHHHHHH-cCCCccccc----------CcCCCCCCccchHHhhcccccccccccc-ccc
Confidence            3568999999999999999999999999 666643321          1258899999999999999999999999 999


Q ss_pred             cccccCCCCCcHHHHHHhCCCCCHHHHHHHHHHCCC--------------------------------------------
Q 005175           86 VNVSCGSDRTTALHCAASGGSANVVDVVRLLLSAGA--------------------------------------------  121 (710)
Q Consensus        86 VN~~~d~~G~TPLH~Aa~~G~~~~~eiVklLLe~GA--------------------------------------------  121 (710)
                      ++.. |.+|.||||+|+..++   .+++++|++.+.                                            
T Consensus        71 i~~~-d~~g~tpL~~A~~~~~---~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  146 (255)
T d1oy3d_          71 VLVA-ERGGHTALHLACRVRA---HTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDED  146 (255)
T ss_dssp             SSCC-CTTSCCHHHHHTTTTC---HHHHHHHSSSCCSSCCCC-----------------------------------CCC
T ss_pred             cccc-ccccchhhhhhhccCc---hHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhh
Confidence            9999 9999999999999999   899998875432                                            


Q ss_pred             ---CCCCCCCCCCcHHHHHhcCCCHHHHHHHHHHHHhCCCCchhhhccccccccccccCCCCCCCChhchhHhhCCCchh
Q 005175          122 ---DPDCVDANGHHPIDVIVLPPKLDSMRAILEEVFGSKNSSVVVASGAEHNLTVSIGSSNSDYSSPLLTASASGSPPSP  198 (710)
Q Consensus       122 ---d~n~~D~~G~TPLhlAa~~G~~eivk~LLe~Ll~~ga~~~~~aa~~~~~l~~~in~~d~~G~TPLH~Aa~~G~~eil  198 (710)
                         +++.+|.+|.||||+|+..++.++++.|++.    +..              .....+..|.||||+|+..|+.+++
T Consensus       147 ~~~~in~~d~~g~TpLh~A~~~~~~~~v~~Ll~~----~~~--------------~~~~~~~~g~TpL~~A~~~~~~~~v  208 (255)
T d1oy3d_         147 WRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDA----GAD--------------LNKPEPTCGRTPLHLAVEAQAASVL  208 (255)
T ss_dssp             GGGGTTCCCTTSCCHHHHHHHTTCHHHHHHHHHH----TCC--------------TTCCCTTTCCCHHHHHHHTTCHHHH
T ss_pred             cCcccccccccCcccccccccccccccccchhcc----ccc--------------ccccccccccccccccccccHHHHH
Confidence               3355688899999999999999988877774    211              2234567899999999999999995


Q ss_pred             hh----ccCCCccccCCCCccccccccCCCCCCCCCCccccc
Q 005175          199 SR----LVSSPMALKFNDVSFGTGAEKREYPIDPSLPDIKNS  236 (710)
Q Consensus       199 e~----l~d~n~~~~~g~TpLh~Aa~~g~~~i~~~L~d~ga~  236 (710)
                      +.    +++++.++..|.||||+|+..++..+++.|++.|++
T Consensus       209 ~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~~~Ll~~Ga~  250 (255)
T d1oy3d_         209 ELLLKAGADPTARMYGGRTPLGSALLRPNPILARLLRAHGAP  250 (255)
T ss_dssp             HHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHHHHTTCC
T ss_pred             HHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHHHHcCCC
Confidence            55    467788999999999999999999999999999985
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rgoa1 g.66.1.1 (A:151-186) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgoa2 g.66.1.1 (A:187-220) Butyrate response factor 2 (Tis11D) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqea2 g.66.1.1 (A:429-457) Zinc finger CCCH domain-containing protein C19orf7 (KIAA1064) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure