Citrus Sinensis ID: 005254

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700------

MASLPLKKSYGCEPVLQQFYGGGPLVVSSDGSFIACACGESINIVDLSNASIKSTIEGGSDTITALALSPDDKLLFSSGHSREIRVWDLSTLKCLRSWKGHDGPAIGMACHPSGGLLATAGADRKVLVWDVDGGFCTHYFKGHKGVVSSILFHPDTDKSLLFSGSDDATVRVWDLLAKKCVATLDKHFSRVTSMAITSDGSTLISAGRDKVVNLWDLRDYSCKLTVPTYEMVEAVCAIPPGSAFDSFLSSYNQQTIKKKRRSLEIHFITVGERGIVRMWNADSACLYEQKSSDVTISFEMDDSKRGFTAATVLPSNQGLLCVTADQQLLLYTTVEVPEKKMELILSKRLVGYNEEILDLKFLGEEEQYLAVATNIEQVQVYDLSSMSCSYVLAGHSEIVLCLDTCALSSGKILIVTGSKDNSVRLWDSESRCCVGVGTGHMGAVGAVAFSKKLQNFLVSGSSDHTIKVWSFDGLSDDAEQPMNLKAKAVVAAHGKDINSLAVAPNDSLVCTGSQDRTACVWRLPDLVSVVTFRGHKRGIWSVEFSPVDQVVITASGDKTIKIWSISDGSCLKTFEGHTSSVLRASFLTRGAQIVSCGADGLVKLWTVRTGECIATYDKHEDKIWALAVGKKTEMFATGGSDALVNLWHDSTAAEREEAFRKEEEAVLRGQELENAVLDADYTKAIQVAFELRRPHKLFELFASVCR

ccccccccCEEccEEECcCEEEEEEEEcccccEEEEECcccEEEEEccccCEEEEEEcccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEECccccEEEEEccccCEEEEEEcccccEEEEEECccccccEEEEECccccEEEEEccccEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEccccCEEEEECcccEEEEEEEccccccccccccccccccEEcccccccEEEEEEEcccEEEEEEcccccEEEEEcccCEEEEEcccccccEEEEEEcccccEEEEECccccEEEEEcccccccccccEEEEEEEcccccEEEEEEEcccccEEEEEcccccEEEEEccccccccccccccccEEEEEEEEEcccccEEEEECccccEEEEEccccCEEEEEEcccccEEEEEEccccccEEEEECccccEEEEEcccccccccccccccEEEEEEcccccEEEEEEcccccEEEEECccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEccccccEEEEEEEccccEEEEEEccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEccccEEEEEcccHHHHHHHHccccccEEcccEEEEEEEccccccEEEEEEEccccEEEEEccccccc

**SLPLKKSYGCEPVLQQFYGGGPLVVSSDGSFIACACGESINIVDLSNASIKSTIEGGSDTITALALSPDDKLLFSSGHSREIRVWDLSTLKCLRSWKGHDGPAIGMACHPSGGLLATAGADRKVLVWDVDGGFCTHYFKGHKGVVSSILFHPDTDKSLLFSGSDDATVRVWDLLAKKCVATLDKHFSRVTSMAITSDGSTLISAGRDKVVNLWDLRDYSCKLTVPTYEMVEAVCAIPPGSAFDSFLSSYNQQTIKKKRRSLEIHFITVGERGIVRMWNADSACLYEQKSSDVTISFEMDDSKRGFTAATVLPSNQGLLCVTADQQLLLYTTVEVPEKKMELILSKRLVGYNEEILDLKFLGEEEQYLAVATNIEQVQVYDLSSMSCSYVLAGHSEIVLCLDTCALSSGKILIVTGSKDNSVRLWDSESRCCVGVGTGHMGAVGAVAFSKKLQNFLVSGSSDHTIKVWSFDGLSDDAEQPMNLKAKAVVAAHGKDINSLAVAPNDSLVCTGSQDRTACVWRLPDLVSVVTFRGHKRGIWSVEFSPVDQVVITASGDKTIKIWSISDGSCLKTFEGHTSSVLRASFLTRGAQIVSCGADGLVKLWTVRTGECIATYDKHEDKIWALAVGKKTEMFATGGSDALVNLWHDSTAAEREEAFRKEEEAVLRGQELENAVLDADYTKAIQVAFELRRPHKLFELFASVC*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transducin beta-like protein 3		probable	Q8C4J7
Transducin beta-like protein 3		probable	Q2KJJ5
U3 small nucleolar RNA-associated protein 13	Involved in nucleolar processing of pre-18S ribosomal RNA.	probable	Q05946

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FM0, chain A
Confidence level:very confident
Coverage over the Query: 50-223,345-400,416-417,429-525
View the alignment between query and template
View the model in PyMOL

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 53-223,435-464,497-606
View the alignment between query and template
View the model in PyMOL

Template: 3DM0, chain A
Confidence level:very confident
Coverage over the Query: 344-649
View the alignment between query and template
View the model in PyMOL

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 24-242,266-288,300-474,486-648
View the alignment between query and template
View the model in PyMOL

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 2-242,266-472,486-650
View the alignment between query and template
View the model in PyMOL

Template: 4A0P, chain A
Confidence level:confident
Coverage over the Query: 24-278,304-475,486-576
View the alignment between query and template
View the model in PyMOL

Template: 1XI4, chain A
Confidence level:probable
Coverage over the Query: 376-693
View the alignment between query and template
View the model in PyMOL