Citrus Sinensis ID: 005277


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700----
MDELQVVEFVATYLKKKGFSEAENALQAEIQRNKSSNNTNPIDILNDPELSKFFRTFSESEDGPARYQDEYSKLRSWTYSSLDLYKHELLHVLYPVFIHCFMDLVAKGHIQEARTFFNNFREDHEMMHLRDLQKLEGVLSPSHLEEMEFAHSLRHSKVNIKICQYSYELLLQYLHKTQSTKMLGIINERINFQVSPGQPSSISDDAEIVTLIGSNQDAANQINQKEVHWGLLEDSLENRLEKTGLISDSEKAEGENKEAEIDENKKRPVEGGKQGASIKKLKKDKAINATAKTSRLEANTVSTAPRVKPDLALPVMPTEVEQSILEDLRNRVHLSSAALPSVSFYTFINTHNGLNCASISQDGSLVAGGFSDSSLKVWDMAKLGQQAVSSGLQGENDTTPREDIIGPNGRKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYRFLLLVTNAYLKISDKVSTGFLFYSLTIIYFGCASCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS
ccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcHHHHHHHccccEEEEcccHHHHHHHHHHHccccHHHHHHHHHEEEEEccccccccccHHHHHHHHcccHHHHHHHccccccccccHHHHHHHHHccccccccHHHcccccHHHccccccccccccccccHHHHHccccccccHcccccccccccccccccccccccccccccHHHHHHccccccEEEcccccccCEEEEEccccccEEEEEEcccccEEEEECccccEEEEEccccccccccccccccccccccccEEEcccccccEEEEEcccccEEEEEEcccccEEEEEcccccEEEEccccccccEEcccccccEEEEEEcccccEEEEEEccccEEEEccccccEEEccccccccccEEEEcccccEEEEEEccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEEEEccccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEccccccEEEEEcccccccccccccccccccccccccccccccEEEEEEcccccEEEEccccccc
***LQVVEFVATYLKKKGFSEAE**************************************DGPARYQDEYSKLRSWTYSSLDLYKHELLHVLYPVFIHCFMDLVAKGHIQEARTFFNNFREDHEMMHLRDLQKLEGVLSPSHLEEMEFAHSLRHSKVNIKICQYSYELLLQYLHKTQSTKMLGIINERINFQVS***********EIVTLIGS*******INQKEVHWGLLEDSLENR**********************************************************************DLALPVMPTEVEQSILEDLRNRVHLSSAALPSVSFYTFINTHNGLNCASISQDGSLVAGGFSDSSLKVWDMAKLGQQ*********NDTTPREDIIGPNGRKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYRFLLLVTNAYLKISDKVSTGFLFYSLTIIYFGCASCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDELQVVEFVATYLKKKGFSEAENALQAEIQRNKSSNNTNPIDILNDPELSKFFRTFSESEDGPARYQDEYSKLRSWTYSSLDLYKHELLHVLYPVFIHCFMDLVAKGHIQEARTFFNNFREDHEMMHLRDLQKLEGVLSPSHLEEMEFAHSLRHSKVNIKICQYSYELLLQYLHKTQSTKMLGIINERINFQVSPGQPSSISDDAEIVTLIGSNQDAANQINQKEVHWGLLEDSLENRLEKTGLISDSEKAEGENKEAEIDENKKRPVEGGKQGASIKKLKKDKAINATAKTSRLEANTVSTAPRVKPDLALPVMPTEVEQSILEDLRNRVHLSSAALPSVSFYTFINTHNGLNCASISQDGSLVAGGFSDSSLKVWDMAKLGQQAVSSGLQGENDTTPREDIIGPNGRKRSYTLYQGHSGPVYSASFSPLGDFILSSSADTTIRLWSTKLNANLVCYKGHNYPVWDVQFNPQGHYFASSSHDRTARIWSMDRIQPLRIMAGHLSDVDCVRWHINCNYIATGSSDKTVRLWDVSSGECVRIFIGHRSMILSLAMSPDGRYMASGDEDGTIMMWDLASGRCVTPLMGHTSCVWTLAYRFLLLVTNAYLKISDKVSTGFLFYSLTIIYFGCASCEGSLLASGSADCTVKLWDVTTSTKVLKTEEKSGTNRLRSLKTLPTKSTPVYSLQFSRRNLLFAAGALSKTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription initiation factor TFIID subunit 5 Functions as a component of the DNA-binding general transcription factor complex TFIID and the transcription regulatory histone acetylation (HAT) complexes SAGA, SALSA and SLIK. Binding of TFIID to a promoter (with or without TATA element) is the initial step in preinitiation complex (PIC) formation. TFIID plays a key role in the regulation of gene expression by RNA polymerase II through different activities such as transcription activator interaction, core promoter recognition and selectivity, TFIIA and TFIIB interaction, chromatin modification (histone acetylation by TAF1), facilitation of DNA opening and initiation of transcription. SAGA is involved in RNA polymerase II-dependent transcriptional regulation of approximately 10% of yeast genes. At the promoters, SAGA is required for recruitment of the basal transcription machinery. It influences RNA polymerase II transcriptional activity through different activities such as TBP interaction (SPT3, SPT8 and SPT20) and promoter selectivity, interaction with transcription activators (GCN5, ADA2, ADA3 and TRA1), and chromatin modification through histone acetylation (GCN5) and deubiquitination (UBP8). SAGA acetylates nucleosomal histone H3 to some extent (to form H3K9ac, H3K14ac, H3K18ac and H3K23ac). SAGA interacts with DNA via upstream activating sequences (UASs). SALSA, an altered form of SAGA, may be involved in positive transcriptional regulation. SLIK is proposed to have partly overlapping functions with SAGA. It preferentially acetylates methylated histone H3, at least after activation at the GAL1-10 locus.probableP38129
Transcription initiation factor TFIID subunit 5 TAFs are components of the transcription factor IID (TFIID) complex that are essential for mediating regulation of RNA polymerase transcription. Regulates the genes involved in ubiquitin-dependent proteolysis during the progression of M-phase of mitosis.probableO13282
Transcription initiation factor TFIID subunit 5 TFIID is a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors. May play a role in helping to anchor Taf4 within the TFIID complex. May be involved in transducing signals from various transcriptional regulators to the RNA polymerase II transcription machinery.probableP49846

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AOW, chain A
Confidence level:very confident
Coverage over the Query: 345-385,409-597,632-664,678-703
View the alignment between query and template
View the model in PyMOL
Template: 3MKQ, chain A
Confidence level:very confident
Coverage over the Query: 330-382,411-597,632-699
View the alignment between query and template
View the model in PyMOL
Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 329-657,671-703
View the alignment between query and template
View the model in PyMOL
Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 295-382,411-597,632-657
View the alignment between query and template
View the model in PyMOL
Template: 2NXP, chain A
Confidence level:very confident
Coverage over the Query: 47-196
View the alignment between query and template
View the model in PyMOL
Template: 1UUJ, chain A
Confidence level:probable
Coverage over the Query: 3-32
View the alignment between query and template
View the model in PyMOL