Citrus Sinensis ID: 005292
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 704 | 2.2.26 [Sep-21-2011] | |||||||
| Q9M2S6 | 273 | E3 ubiquitin-protein liga | no | no | 0.130 | 0.336 | 0.328 | 4e-14 | |
| Q6IRP0 | 312 | RING finger protein 126-B | N/A | no | 0.204 | 0.461 | 0.277 | 5e-11 | |
| Q9NVW2 | 624 | E3 ubiquitin-protein liga | yes | no | 0.113 | 0.128 | 0.312 | 6e-11 | |
| Q9WTV7 | 600 | E3 ubiquitin-protein liga | yes | no | 0.113 | 0.133 | 0.312 | 1e-10 | |
| Q3U2C5 | 394 | E3 ubiquitin-protein liga | no | no | 0.083 | 0.149 | 0.484 | 2e-10 | |
| Q0VD51 | 380 | E3 ubiquitin-protein liga | no | no | 0.092 | 0.171 | 0.409 | 2e-10 | |
| Q6DIP3 | 311 | RING finger protein 126 O | yes | no | 0.113 | 0.257 | 0.365 | 2e-10 | |
| Q90972 | 381 | E3 ubiquitin-protein liga | yes | no | 0.092 | 0.170 | 0.409 | 2e-10 | |
| Q5RCV8 | 381 | E3 ubiquitin-protein liga | no | no | 0.092 | 0.170 | 0.409 | 3e-10 | |
| O43567 | 381 | E3 ubiquitin-protein liga | no | no | 0.092 | 0.170 | 0.409 | 3e-10 |
| >sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 80.5 bits (197), Expect = 4e-14, Method: Compositional matrix adjust.
Identities = 41/125 (32%), Positives = 63/125 (50%), Gaps = 33/125 (26%)
Query: 609 HVSQLQREFNENDYEMLLALDENN-HQSGASANQINSLPLSTVQTDNFEEACA------- 660
++ L REF++ DYE L ALD +N + S +IN+LP+ + + E C+
Sbjct: 128 QLALLDREFDDLDYETLRALDSDNVSTTSMSEEEINALPVHKYKVLDPENGCSLAKQAST 187
Query: 661 -------------------------ICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPS 695
+CL+ ++G+ +R LPCLH+FH CIDPWL ++ +
Sbjct: 188 SSSAEKMLDSANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDPWLRQQGT 247
Query: 696 CPVCK 700
CPVCK
Sbjct: 248 CPVCK 252
|
E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction. Arabidopsis thaliana (taxid: 3702) EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: - |
| >sp|Q6IRP0|R126B_XENLA RING finger protein 126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q6DIP3|RN126_XENTR RING finger protein 126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 704 | ||||||
| 224075605 | 740 | predicted protein [Populus trichocarpa] | 0.977 | 0.929 | 0.460 | 1e-146 | |
| 255554186 | 791 | hypothetical protein RCOM_1020610 [Ricin | 0.950 | 0.845 | 0.425 | 1e-133 | |
| 449433191 | 803 | PREDICTED: uncharacterized protein LOC10 | 0.974 | 0.854 | 0.388 | 1e-117 | |
| 356533336 | 735 | PREDICTED: uncharacterized protein LOC10 | 0.901 | 0.863 | 0.375 | 1e-104 | |
| 359477850 | 363 | PREDICTED: uncharacterized protein LOC10 | 0.436 | 0.845 | 0.598 | 2e-92 | |
| 18390437 | 634 | RING/U-box domain-containing protein [Ar | 0.846 | 0.940 | 0.365 | 4e-85 | |
| 297843286 | 634 | zinc finger family protein [Arabidopsis | 0.862 | 0.957 | 0.348 | 6e-83 | |
| 7211986 | 716 | Contains similarity to the regulatory pr | 0.829 | 0.815 | 0.347 | 4e-73 | |
| 147853050 | 625 | hypothetical protein VITISV_037878 [Viti | 0.734 | 0.827 | 0.370 | 2e-72 | |
| 356577550 | 470 | PREDICTED: uncharacterized protein LOC10 | 0.501 | 0.751 | 0.420 | 3e-68 |
| >gi|224075605|ref|XP_002304703.1| predicted protein [Populus trichocarpa] gi|222842135|gb|EEE79682.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 525 bits (1351), Expect = e-146, Method: Compositional matrix adjust.
Identities = 348/755 (46%), Positives = 451/755 (59%), Gaps = 67/755 (8%)
Query: 1 MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRY-R 59
MEDM+ D+V EIPDTP+R AAR +N F KE V GCLR S +DE+ +N R R
Sbjct: 1 MEDMNSDQVFEIPDTPERAAARSINGAQFR-KESISSVPGCLRKSGFVDEKSFNPPRTSR 59
Query: 60 GLLVNENRHHRRLNNHHLKNSSNFNKSKQFSDSVSFNPEDNPYASQNASLFRRSAIDKNS 119
G + +EN + RL+ H K+ N ++ S+S + + QNA LFRR AI NS
Sbjct: 60 GRIFSENGLNGRLHLHPQKSPINVDEYDSPSNSAL-----DSHPHQNAPLFRRPAIVNNS 114
Query: 120 KHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKD 179
+ E R++ GA +M++ K + K E +L+EM+ ++ + +KD
Sbjct: 115 RPENRHSKGAQYMEKSKAGRATSSSKKPFCMEGDDLFDLTEMSEPDRLLDFVFPHSASKD 174
Query: 180 LPAKDIREGQTATNSCTSYWPQNFP-KMSGSSSKGKEKIGCDTSKGPDSFLGHGNVIDLS 238
L AK+ REGQ ++N +S P ++SGS+SKGKEKI +T G S + ID +
Sbjct: 175 LQAKETREGQLSSNGGSSVQLAPLPSRISGSTSKGKEKIDVNTCNGSGSASNNVKEIDHA 234
Query: 239 GGSQHKNDKQMSASHHSLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQ 298
G QHK +KQ+ A H S+ PRV +KRLVRNGCISPHNI ++A++LAE SQ+GS E+
Sbjct: 235 SGHQHKIEKQLPACHLSVTSPRVGGKKRLVRNGCISPHNIATRAQKLAESSQDGSPGDER 294
Query: 299 NHSMDVVSSGPFTVDISDIVAEDNDHCKSKG---IIHLSSSSASNDGEVNGNGN----AG 351
NH+ + +S GP +D+ +IVAEDND ++KG I+H S+S +D + +G G
Sbjct: 295 NHARNKLSDGPPNIDLREIVAEDNDCYRAKGKKAIVH-PSASKEHDANMTRDGCRDALFG 353
Query: 352 EWRSTSNYSKKVDHRL--------------RDSTGIHSRRNDDLDQIS--KPCQVANTAT 395
WRST SK D L R ST H R + D S K V N
Sbjct: 354 GWRSTHKRSKTQDQPLSYMEQGILGRDDHARCSTNEHDDRLVERDSSSGGKLHHVGNLVA 413
Query: 396 KRQKKQESTSSNRGQCSQTISDDTDIVFLDSSGESSRSRPSRIRSQRHQG----ILDIAD 451
TS N+G+CS + DDT+++FL SS ESS SR SR+ + +H G I +I +
Sbjct: 414 TYGL----TSRNQGECSTIVPDDTEVLFLGSSRESSSSRSSRVHNHQHDGNLEPIYEIDE 469
Query: 452 LSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLAR 511
L E+RN D Q + +N+DSD ARQ+E D+MLA ELQE+LYHE P F GEIDEN+A
Sbjct: 470 LLTEVRNNDPQLIGFRSNEDSDVTARQVEADEMLARELQERLYHEEPTFGGGEIDENIAW 529
Query: 512 MLQQEEDAL-RFSNRNHHLLHPRTS--SSTYRQPQSRLLQNASNRRGAPTQ--------L 560
+LQQEEDAL S NH + H R S + + RQ R N SNRRG Q L
Sbjct: 530 VLQQEEDALPATSGHNHPVPHLRNSLVAHSSRQRLPRSSHNPSNRRGNQVQVTTTRASGL 589
Query: 561 RSRFLNRSRAAPSRRRN-----------FPFPLDMDLDMRLDILEALESAVDFGDLETRH 609
RSR NR+ SR RN F FP MDL+MRL+ILE LE+++ TR
Sbjct: 590 RSRLSNRTPVRISRERNPFPTVFPGGLNFQFPSGMDLEMRLNILENLEASM----TATRM 645
Query: 610 VSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIG 669
+ +QR+FNENDYEMLLALDENN Q GASANQIN LP S VQTDNF E CA+CL+ P+IG
Sbjct: 646 L-HVQRDFNENDYEMLLALDENNSQHGASANQINCLPESVVQTDNFGETCAVCLEAPTIG 704
Query: 670 DSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 704
+ IRHLPCLHKFHKDCIDPWLSR+ SCP+CKSSIT
Sbjct: 705 EKIRHLPCLHKFHKDCIDPWLSRKTSCPICKSSIT 739
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255554186|ref|XP_002518133.1| hypothetical protein RCOM_1020610 [Ricinus communis] gi|223542729|gb|EEF44266.1| hypothetical protein RCOM_1020610 [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449433191|ref|XP_004134381.1| PREDICTED: uncharacterized protein LOC101205482 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356533336|ref|XP_003535221.1| PREDICTED: uncharacterized protein LOC100789823 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359477850|ref|XP_002283247.2| PREDICTED: uncharacterized protein LOC100247656 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|18390437|ref|NP_563717.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|15450836|gb|AAK96689.1| Unknown protein [Arabidopsis thaliana] gi|30725482|gb|AAP37763.1| At1g04790 [Arabidopsis thaliana] gi|332189623|gb|AEE27744.1| RING/U-box domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297843286|ref|XP_002889524.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297335366|gb|EFH65783.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|7211986|gb|AAF40457.1|AC004809_15 Contains similarity to the regulatory protein (G1) gb|M97204 goliath from D. melanogaster. EST gb|T76547 comes from this gene [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|147853050|emb|CAN82765.1| hypothetical protein VITISV_037878 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356577550|ref|XP_003556887.1| PREDICTED: uncharacterized protein LOC100796218 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 704 | ||||||
| TAIR|locus:2010582 | 634 | AT1G04790 [Arabidopsis thalian | 0.661 | 0.735 | 0.363 | 4.8e-75 | |
| DICTYBASE|DDB_G0282479 | 320 | DDB_G0282479 "E3 ubiquitin-pro | 0.127 | 0.281 | 0.431 | 5.4e-18 | |
| UNIPROTKB|K7GLM9 | 238 | LOC100519887 "Uncharacterized | 0.109 | 0.323 | 0.409 | 8.4e-11 | |
| RGD|1359698 | 165 | Rnf181 "ring finger protein 18 | 0.123 | 0.527 | 0.340 | 9.7e-11 | |
| UNIPROTKB|Q6AXU4 | 165 | Rnf181 "E3 ubiquitin-protein l | 0.123 | 0.527 | 0.340 | 9.7e-11 | |
| ZFIN|ZDB-GENE-060503-608 | 301 | si:ch211-81a5.1 "si:ch211-81a5 | 0.112 | 0.262 | 0.395 | 1.2e-10 | |
| UNIPROTKB|Q3T0W3 | 153 | RNF181 "E3 ubiquitin-protein l | 0.142 | 0.653 | 0.330 | 1.6e-10 | |
| UNIPROTKB|E2QUN1 | 153 | RNF181 "Uncharacterized protei | 0.142 | 0.653 | 0.320 | 1.6e-10 | |
| TAIR|locus:2050522 | 180 | AT2G44330 [Arabidopsis thalian | 0.085 | 0.333 | 0.45 | 1.6e-10 | |
| UNIPROTKB|F1SVB7 | 153 | RNF181 "Uncharacterized protei | 0.142 | 0.653 | 0.330 | 2e-10 |
| TAIR|locus:2010582 AT1G04790 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 683 (245.5 bits), Expect = 4.8e-75, Sum P(3) = 4.8e-75
Identities = 187/515 (36%), Positives = 268/515 (52%)
Query: 221 TSKGPDSFLGHGNVIDLSGGSQHKNDKQMSAS--HH-SLDL----PRVNRQKRLVRNGCI 273
TS G G N L G S +K S S H ++DL P+ KRLVR+GCI
Sbjct: 138 TSNGCSPLRGDHNSFVLPGNSNKGKEKADSGSVPHRETIDLSSGKPQNRGTKRLVRHGCI 197
Query: 274 SPHNIESKAKQLAEGSQNGSKDVEQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGII-H 332
SPH I ++A+Q A+ + + VEQ + + SS + I +IV E + H +++G
Sbjct: 198 SPHEIAARARQAADTNSYDTLSVEQELASETASS----IGIREIVPESDIHGRARGKRPE 253
Query: 333 LSSSS-ASNDGEVNGNGNAGEWRSTSNYSKKVDHRL--RDSTGIHSRRNDDLDQISKPCQ 389
+SSS AS DG + G W ST N + ++H + RD + + +
Sbjct: 254 ISSSRVASRDG-LEG------WVSTRNRNLNMEHEMNHRDESNTRGICSSVTRLDVRETG 306
Query: 390 VANTATKRQKKQES---TSSNRGQCSQTISDDTDIVFLDXXXXXXXXXXXXXXXXXHQGI 446
V +++Q+++++ TS+ + T++ + + +
Sbjct: 307 VVERESRQQRRRKNGFTTSTASNEPEVTVNRSSG----EPSSSRPPRIQNHLRHWHGTQV 362
Query: 447 LDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEID 506
L+I D SPE+R +G ND SD RQ+E D++LA ELQEQLY E L +ID
Sbjct: 363 LEIEDSSPEVRVF--RGPRRVENDVSDVNIRQIEADEILARELQEQLYREESLIRHEQID 420
Query: 507 ENLARMLQQEEDALRFSNRNHHLLHPRTSSSTYRQP------QSRLLQNASNRRGAPTQL 560
E +AR ++QEE++LR S+ R+S++ P ++RL Q++S RR P Q
Sbjct: 421 EIIARSMEQEENSLRASSSRASTRITRSSNTIAANPRGRSRLEARLQQHSSRRRFNPPQA 480
Query: 561 RSRF----------LXXXXXXXXXXXXXXXPXXXXXXXXXXXXEALESAVDFGDLETRHV 610
R+ L P E LE+A+ + + ++
Sbjct: 481 RAPVRAPARGRGYRLGGASASLRTALNFSFPIDMGLDSRMDILEELENAIGHS-ITSSNL 539
Query: 611 SQLQREFNENDYEMLLALDENNHQ-SGASANQINSLPLSTVQTDNFEEACAICLDNPSIG 669
+ R+F E+DYE+LLALDENNH+ GASAN+IN+LP STVQTDNF+E C ICL+ P IG
Sbjct: 540 LHMDRDFTEDDYELLLALDENNHRHGGASANRINNLPESTVQTDNFQETCVICLETPKIG 599
Query: 670 DSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 704
D+IRHLPCLHKFHKDCIDPWL R SCPVCKSS+T
Sbjct: 600 DTIRHLPCLHKFHKDCIDPWLGRSKSCPVCKSSVT 634
|
|
| DICTYBASE|DDB_G0282479 DDB_G0282479 "E3 ubiquitin-protein ligase DMA2" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GLM9 LOC100519887 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1359698 Rnf181 "ring finger protein 181" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6AXU4 Rnf181 "E3 ubiquitin-protein ligase RNF181" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-608 si:ch211-81a5.1 "si:ch211-81a5.1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0W3 RNF181 "E3 ubiquitin-protein ligase RNF181" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QUN1 RNF181 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2050522 AT2G44330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SVB7 RNF181 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 704 | |||
| pfam13639 | 46 | pfam13639, zf-RING_2, Ring finger domain | 3e-16 | |
| cd00162 | 45 | cd00162, RING, RING-finger (Really Interesting New | 5e-13 | |
| pfam13923 | 45 | pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI | 9e-10 | |
| smart00184 | 40 | smart00184, RING, Ring finger | 9e-10 | |
| pfam00097 | 40 | pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING | 1e-09 | |
| COG5540 | 374 | COG5540, COG5540, RING-finger-containing ubiquitin | 1e-08 | |
| pfam12678 | 73 | pfam12678, zf-rbx1, RING-H2 zinc finger | 4e-08 | |
| COG5243 | 491 | COG5243, HRD1, HRD ubiquitin ligase complex, ER me | 2e-05 | |
| pfam13920 | 49 | pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI | 4e-05 | |
| COG5219 | 1525 | COG5219, COG5219, Uncharacterized conserved protei | 4e-04 | |
| smart00744 | 49 | smart00744, RINGv, The RING-variant domain is a C4 | 0.001 |
| >gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain | Back alignment and domain information |
|---|
Score = 72.8 bits (179), Expect = 3e-16
Identities = 20/44 (45%), Positives = 28/44 (63%)
Query: 659 CAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSS 702
C ICLD G+ + LPC H FHK+C+D WL +CP+C++
Sbjct: 3 CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46
|
Length = 46 |
| >gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|214546 smart00184, RING, Ring finger | Back alignment and domain information |
|---|
| >gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) | Back alignment and domain information |
|---|
| >gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 704 | |||
| KOG4628 | 348 | consensus Predicted E3 ubiquitin ligase [Posttrans | 99.56 | |
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 99.44 | |
| COG5540 | 374 | RING-finger-containing ubiquitin ligase [Posttrans | 99.19 | |
| PF12678 | 73 | zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 | 99.16 | |
| PHA02929 | 238 | N1R/p28-like protein; Provisional | 99.14 | |
| COG5243 | 491 | HRD1 HRD ubiquitin ligase complex, ER membrane com | 98.99 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 98.91 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 98.84 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 98.83 | |
| KOG0317 | 293 | consensus Predicted E3 ubiquitin ligase, integral | 98.78 | |
| PF13923 | 39 | zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); | 98.77 | |
| KOG0823 | 230 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.76 | |
| KOG0802 | 543 | consensus E3 ubiquitin ligase [Posttranslational m | 98.75 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 98.65 | |
| smart00184 | 39 | RING Ring finger. E3 ubiquitin-protein ligase acti | 98.62 | |
| KOG0320 | 187 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.62 | |
| PHA02926 | 242 | zinc finger-like protein; Provisional | 98.61 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 98.58 | |
| PF00097 | 41 | zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I | 98.51 | |
| PF14634 | 44 | zf-RING_5: zinc-RING finger domain | 98.51 | |
| PF15227 | 42 | zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: | 98.5 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 98.45 | |
| COG5194 | 88 | APC11 Component of SCF ubiquitin ligase and anapha | 98.26 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.18 | |
| PF13445 | 43 | zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. | 98.13 | |
| KOG1734 | 328 | consensus Predicted RING-containing E3 ubiquitin l | 98.11 | |
| COG5574 | 271 | PEX10 RING-finger-containing E3 ubiquitin ligase [ | 98.1 | |
| KOG0828 | 636 | consensus Predicted E3 ubiquitin ligase [Posttrans | 98.09 | |
| smart00744 | 49 | RINGv The RING-variant domain is a C4HC3 zinc-fing | 98.07 | |
| KOG1493 | 84 | consensus Anaphase-promoting complex (APC), subuni | 98.07 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 98.01 | |
| COG5219 | 1525 | Uncharacterized conserved protein, contains RING Z | 97.96 | |
| KOG0287 | 442 | consensus Postreplication repair protein RAD18 [Re | 97.94 | |
| KOG2930 | 114 | consensus SCF ubiquitin ligase, Rbx1 component [Po | 97.8 | |
| COG5432 | 391 | RAD18 RING-finger-containing E3 ubiquitin ligase [ | 97.79 | |
| KOG4445 | 368 | consensus Uncharacterized conserved protein, conta | 97.78 | |
| KOG0804 | 493 | consensus Cytoplasmic Zn-finger protein BRAP2 (BRC | 97.76 | |
| PF11793 | 70 | FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. | 97.68 | |
| KOG1039 | 344 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.57 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 97.44 | |
| KOG4265 | 349 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.34 | |
| KOG0311 | 381 | consensus Predicted E3 ubiquitin ligase [Posttrans | 97.22 | |
| KOG0978 | 698 | consensus E3 ubiquitin ligase involved in syntaxin | 97.01 | |
| KOG4172 | 62 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.94 | |
| KOG4159 | 398 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.74 | |
| KOG1428 | 3738 | consensus Inhibitor of type V adenylyl cyclases/Ne | 96.63 | |
| KOG1941 | 518 | consensus Acetylcholine receptor-associated protei | 96.54 | |
| KOG1785 | 563 | consensus Tyrosine kinase negative regulator CBL [ | 96.52 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 96.47 | |
| KOG0297 | 391 | consensus TNF receptor-associated factor [Signal t | 96.45 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 96.32 | |
| KOG2660 | 331 | consensus Locus-specific chromosome binding protei | 96.26 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 96.22 | |
| KOG2879 | 298 | consensus Predicted E3 ubiquitin ligase [Posttrans | 96.2 | |
| KOG3970 | 299 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.87 | |
| PF05883 | 134 | Baculo_RING: Baculovirus U-box/Ring-like domain; I | 95.76 | |
| KOG1814 | 445 | consensus Predicted E3 ubiquitin ligase [Posttrans | 95.66 | |
| PHA03096 | 284 | p28-like protein; Provisional | 95.27 | |
| KOG3039 | 303 | consensus Uncharacterized conserved protein [Funct | 95.07 | |
| COG5152 | 259 | Uncharacterized conserved protein, contains RING a | 94.99 | |
| PF12906 | 47 | RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. | 94.87 | |
| KOG1571 | 355 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.8 | |
| KOG0801 | 205 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.76 | |
| PF15295 | 132 | CCDC50_N: Coiled-coil domain-containing protein 50 | 94.55 | |
| KOG4692 | 489 | consensus Predicted E3 ubiquitin ligase [Posttrans | 94.54 | |
| KOG1002 | 791 | consensus Nucleotide excision repair protein RAD16 | 94.27 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 94.06 | |
| KOG0827 | 465 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.95 | |
| KOG0826 | 357 | consensus Predicted E3 ubiquitin ligase involved i | 93.74 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 93.61 | |
| KOG1813 | 313 | consensus Predicted E3 ubiquitin ligase [Posttrans | 93.57 | |
| KOG1952 | 950 | consensus Transcription factor NF-X1, contains NFX | 93.34 | |
| PF14570 | 48 | zf-RING_4: RING/Ubox like zinc-binding domain; PDB | 92.98 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 92.79 | |
| KOG1001 | 674 | consensus Helicase-like transcription factor HLTF/ | 92.56 | |
| PHA02825 | 162 | LAP/PHD finger-like protein; Provisional | 92.55 | |
| KOG4275 | 350 | consensus Predicted E3 ubiquitin ligase [Posttrans | 92.08 | |
| KOG2932 | 389 | consensus E3 ubiquitin ligase involved in ubiquiti | 90.79 | |
| KOG1940 | 276 | consensus Zn-finger protein [General function pred | 89.94 | |
| KOG2114 | 933 | consensus Vacuolar assembly/sorting protein PEP5/V | 89.83 | |
| PF08746 | 43 | zf-RING-like: RING-like domain; InterPro: IPR01485 | 89.67 | |
| KOG3268 | 234 | consensus Predicted E3 ubiquitin ligase [Posttrans | 89.59 | |
| KOG2034 | 911 | consensus Vacuolar sorting protein PEP3/VPS18 [Int | 89.44 | |
| KOG0298 | 1394 | consensus DEAD box-containing helicase-like transc | 88.69 | |
| PF14447 | 55 | Prok-RING_4: Prokaryotic RING finger family 4 | 88.34 | |
| KOG3002 | 299 | consensus Zn finger protein [General function pred | 86.96 | |
| KOG1100 | 207 | consensus Predicted E3 ubiquitin ligase [Posttrans | 85.51 | |
| COG5175 | 480 | MOT2 Transcriptional repressor [Transcription] | 85.36 | |
| KOG1609 | 323 | consensus Protein involved in mRNA turnover and st | 84.38 | |
| PF10272 | 358 | Tmpp129: Putative transmembrane protein precursor; | 83.88 | |
| KOG0309 | 1081 | consensus Conserved WD40 repeat-containing protein | 83.46 | |
| KOG0825 | 1134 | consensus PHD Zn-finger protein [General function | 82.75 | |
| KOG2817 | 394 | consensus Predicted E3 ubiquitin ligase [Posttrans | 82.39 | |
| KOG3053 | 293 | consensus Uncharacterized conserved protein [Funct | 81.81 |
| >KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=99.56 E-value=1.3e-15 Score=162.26 Aligned_cols=70 Identities=44% Similarity=0.963 Sum_probs=61.6
Q ss_pred CCCCCHHHHhcCCcceeecCCCCC---cccccCCCCCCCCccEEeccCCccchhhHHHHHhcC-CCCCccCCCC
Q 005292 634 QSGASANQINSLPLSTVQTDNFEE---ACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRR-PSCPVCKSSI 703 (704)
Q Consensus 634 ~~GaS~e~I~sLP~sti~~d~~ee---tCsICLEeF~~Gd~VrvLPCgHvFH~dCI~~WLk~k-~SCPVCR~eI 703 (704)
...+.+..+.++|..++.....+. +|+||||+|..|+++++|||+|.||..||++||.+. ..||+||.++
T Consensus 204 ~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di 277 (348)
T KOG4628|consen 204 RNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDI 277 (348)
T ss_pred hhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcC
Confidence 347788899999999988665443 999999999999999999999999999999999987 5599999875
|
|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PHA02929 N1R/p28-like protein; Provisional | Back alignment and domain information |
|---|
| >COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A | Back alignment and domain information |
|---|
| >KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >smart00184 RING Ring finger | Back alignment and domain information |
|---|
| >KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA02926 zinc finger-like protein; Provisional | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14634 zf-RING_5: zinc-RING finger domain | Back alignment and domain information |
|---|
| >PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A | Back alignment and domain information |
|---|
| >KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins | Back alignment and domain information |
|---|
| >KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] | Back alignment and domain information |
|---|
| >KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] | Back alignment and domain information |
|---|
| >PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A | Back alignment and domain information |
|---|
| >KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] | Back alignment and domain information |
|---|
| >KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length | Back alignment and domain information |
|---|
| >KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PHA03096 p28-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG3039 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] | Back alignment and domain information |
|---|
| >PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A | Back alignment and domain information |
|---|
| >KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF15295 CCDC50_N: Coiled-coil domain-containing protein 50 N-terminus | Back alignment and domain information |
|---|
| >KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] | Back alignment and domain information |
|---|
| >PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PHA02825 LAP/PHD finger-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1940 consensus Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) | Back alignment and domain information |
|---|
| >KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF14447 Prok-RING_4: Prokaryotic RING finger family 4 | Back alignment and domain information |
|---|
| >KOG3002 consensus Zn finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5175 MOT2 Transcriptional repressor [Transcription] | Back alignment and domain information |
|---|
| >KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans | Back alignment and domain information |
|---|
| >KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0825 consensus PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3053 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 704 | ||||
| 2ect_A | 78 | Solution Structure Of The Zinc Finger, C3hc4 Type ( | 3e-09 | ||
| 2l0b_A | 91 | Solution Nmr Structure Of Zinc Finger Domain Of E3 | 1e-07 | ||
| 2kiz_A | 69 | Solution Structure Of Arkadia Ring-H2 Finger Domain | 2e-07 | ||
| 1iym_A | 55 | Ring-H2 Finger Domain Of El5 Length = 55 | 2e-06 | ||
| 1chc_A | 68 | Structure Of The C3hc4 Domain By 1h-Nuclear Magneti | 3e-06 | ||
| 2ep4_A | 74 | Solution Structure Of Ring Finger From Human Ring F | 3e-06 | ||
| 1x4j_A | 75 | Solution Structure Of Ring Finger In Ring Finger Pr | 1e-04 | ||
| 2ecn_A | 70 | Solution Structure Of The Ring Domain Of The Human | 2e-04 |
| >pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 | Back alignment and structure |
|
| >pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 | Back alignment and structure |
| >pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 | Back alignment and structure |
| >pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 | Back alignment and structure |
| >pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 | Back alignment and structure |
| >pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 | Back alignment and structure |
| >pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 | Back alignment and structure |
| >pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
Score = 94.3 bits (235), Expect = 1e-23
Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 4/72 (5%)
Query: 636 GASANQINSLPLSTVQTDNF----EEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLS 691
AS I++LP V D+ E C IC GD LPC H FHK C+ WL
Sbjct: 16 PASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQ 75
Query: 692 RRPSCPVCKSSI 703
+ +CPVC+
Sbjct: 76 KSGTCPVCRCMF 87
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 704 | |||
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 99.59 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 99.53 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 99.47 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 99.46 | |
| 2kiz_A | 69 | E3 ubiquitin-protein ligase arkadia; ring-H2 finge | 99.45 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 99.43 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 99.39 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 99.39 | |
| 2ea6_A | 69 | Ring finger protein 4; RNF4, RES4-26, ring domain, | 99.32 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 99.32 | |
| 3dpl_R | 106 | Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST | 99.3 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 99.29 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 99.26 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 99.26 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 99.23 | |
| 2ecn_A | 70 | Ring finger protein 141; RNF141, ring domain, zinc | 99.23 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 99.21 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 99.21 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 99.19 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 99.18 | |
| 4a0k_B | 117 | E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi | 99.17 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 99.16 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 99.15 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 99.15 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 99.14 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 99.11 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 99.1 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 99.08 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 99.08 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 99.07 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 99.05 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 99.05 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 99.04 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 99.03 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 99.03 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 99.0 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 98.99 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 98.98 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 98.98 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 98.97 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 98.96 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 98.94 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 98.93 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 98.9 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 98.89 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 98.87 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 98.84 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 98.8 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 98.79 | |
| 2vje_A | 64 | E3 ubiquitin-protein ligase MDM2; proto-oncogene, | 98.79 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 98.77 | |
| 2y1n_A | 389 | E3 ubiquitin-protein ligase; ligase-transferase co | 98.76 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 98.74 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.73 | |
| 1e4u_A | 78 | Transcriptional repressor NOT4; gene regulation, t | 98.73 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 98.7 | |
| 2vje_B | 63 | MDM4 protein; proto-oncogene, phosphorylation, alt | 98.69 | |
| 4ic3_A | 74 | E3 ubiquitin-protein ligase XIAP; ring domain, zin | 98.65 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 98.61 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 98.59 | |
| 3k1l_B | 381 | Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A | 98.52 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 98.45 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 98.45 | |
| 1vyx_A | 60 | ORF K3, K3RING; zinc-binding protein, ring domain, | 98.44 | |
| 1wim_A | 94 | KIAA0161 protein; ring finger domain, UBCM4-intera | 98.35 | |
| 2ea5_A | 68 | Cell growth regulator with ring finger domain prot | 98.33 | |
| 2yho_A | 79 | E3 ubiquitin-protein ligase mylip; ligase, E2 liga | 98.31 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 98.27 | |
| 3t6p_A | 345 | Baculoviral IAP repeat-containing protein 2; ring, | 98.23 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.11 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 97.79 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 97.3 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 92.2 | |
| 2ko5_A | 99 | Ring finger protein Z; lassa fever virus-Z, negati | 91.31 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 85.53 |
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.59 E-value=6.8e-16 Score=132.65 Aligned_cols=73 Identities=37% Similarity=0.752 Sum_probs=63.8
Q ss_pred cCCCCCCHHHHhcCCcceeecCC----CCCcccccCCCCCCCCccEEeccCCccchhhHHHHHhcCCCCCccCCCCC
Q 005292 632 NHQSGASANQINSLPLSTVQTDN----FEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 704 (704)
Q Consensus 632 ~~~~GaS~e~I~sLP~sti~~d~----~eetCsICLEeF~~Gd~VrvLPCgHvFH~dCI~~WLk~k~SCPVCR~eIS 704 (704)
....+++++.|..||...+.... .+..|+||++.|..++.++.|||+|.||..||.+||..+.+||+||..|.
T Consensus 12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~Cr~~~~ 88 (91)
T 2l0b_A 12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFP 88 (91)
T ss_dssp SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTTTCCBSS
T ss_pred cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcCcCccCC
Confidence 34568999999999988766433 35789999999999999999999999999999999999999999999873
|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* | Back alignment and structure |
|---|
| >4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 704 | ||||
| d1iyma_ | 55 | g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati | 2e-16 | |
| d1chca_ | 68 | g.44.1.1 (A:) Immediate early protein, IEEHV {Equi | 4e-14 | |
| d1fbva4 | 79 | g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta | 5e-12 | |
| d3dplr1 | 88 | g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S | 4e-11 | |
| d1g25a_ | 65 | g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi | 2e-10 | |
| d1bora_ | 56 | g.44.1.1 (A:) Acute promyelocytic leukaemia proto- | 6e-09 | |
| d1ur6b_ | 52 | g.44.1.1 (B:) Not-4 N-terminal RING finger domain | 7e-09 | |
| d1vyxa_ | 60 | g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do | 4e-08 | |
| d1v87a_ | 114 | g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou | 2e-06 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 2e-06 | |
| d1rmda2 | 86 | g.44.1.1 (A:1-86) V(D)J recombination activating p | 6e-06 | |
| d1wima_ | 94 | g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 | 2e-05 | |
| d2baya1 | 56 | g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { | 7e-05 | |
| d1jm7b_ | 97 | g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie | 4e-04 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Score = 71.8 bits (176), Expect = 2e-16
Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)
Query: 659 CAICLDNPSIGDSIRHLP-CLHKFHKDCIDPWLSRRPSCPVCKSSIT 704
CA+CL G+ R LP C H FH +C+D WL +CP+C+ ++
Sbjct: 8 CAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 704 | |||
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 99.56 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 99.39 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 99.33 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 99.32 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 99.24 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 99.23 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 99.09 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 99.05 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 98.99 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 98.97 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 98.89 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 98.83 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 98.8 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 98.78 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 98.6 | |
| d1wima_ | 94 | UbcM4-interacting protein 4 (KIAA0161) {Human (Hom | 98.27 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 84.58 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 80.27 |
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
class: Small proteins fold: RING/U-box superfamily: RING/U-box family: RING finger domain, C3HC4 domain: EL5 RING-H2 domain species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.56 E-value=6.8e-16 Score=121.76 Aligned_cols=48 Identities=40% Similarity=1.055 Sum_probs=45.1
Q ss_pred CCcccccCCCCCCCCccEEec-cCCccchhhHHHHHhcCCCCCccCCCC
Q 005292 656 EEACAICLDNPSIGDSIRHLP-CLHKFHKDCIDPWLSRRPSCPVCKSSI 703 (704)
Q Consensus 656 eetCsICLEeF~~Gd~VrvLP-CgHvFH~dCI~~WLk~k~SCPVCR~eI 703 (704)
+.+|+|||++|..++.+..++ |+|.||..||.+||+.+.+||+||.+|
T Consensus 5 ~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i 53 (55)
T d1iyma_ 5 GVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV 53 (55)
T ss_dssp SCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred CCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEe
Confidence 567999999999999998886 999999999999999999999999987
|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|