Citrus Sinensis ID: 005321


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700--
MADVHMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQPELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKEDQCEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEVSDDEEEETKEEEEGDVEDVDEDKEKKGKKKKVKEVTHEWQLINKQKPIWLRKPEEVTKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLGFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYAKFYDAFSKNIKLGIHEDSQNRAKLADLLRFHSTKSGDEMTSLKDYVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGLKLEEDDEEKKKREEKKKSFENLCKTIKEILGDNVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEDETAGDDAEMPPLEDEGNEESKMEEVD
ccccccccccEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHcHHHHHHHHHHcccccccccccccccCEEEEEcccccEEEEEEccccccHHHHHHcccccccccHHHHHHHHHccccccccccccccccccEEEccEEEEEEcccccccEEEEEcccccEEEEEcccccccccccEEEEEEcccHHHHHcHHHHHHHHHHHcccccccEEEEEEEECcccccccHHHHHccccccccccccHHHHccccccccEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHccccccccEEEEEECcCEEEEEEEECccccccccccccccccccEEEEEEEEEEcccccccccccccccCECccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccHHHHHHHHcccccccccccccHHHHHHccccccccEEEEEcccHHHHHccHHHHHHHHcccEEEEccccHHHHHHHccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccEEEEEccccccHHHHHHHHHccccccccccccccccEEEEccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
*********ETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQPELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKEDQCEYLEERRIKDLVKKHSEFISYPIYLWTEKT***************************************VTHEWQLINKQKPIWLRKPEEVTKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLGFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYAKFYDAFSKNIKLGIHEDSQNRAKLADLLRFHSTKSGDEMTSLKDYVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATKEGL********************NLCKTIKEILGDNVEKVVVSDRIVDSPCCLVTGEYGWSANMERI*******************TMEINPDNGIMEELRKRAE**KNDKSVKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSI*****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADVHMGETETFAFQAEINQLLSLIINTFYSNKEIFLRELISNSSDALDKIRFEGLTDKSKLDAQPELFIRIVPDKANKTLSIIDSGVGMTKADLVNNLGTIARSGTKEFMEALQAGADVSMIGQFGVGFYSAYLVAEKVIVTTKHNDDEQYVWESQAGGSFTVTRDVSGEPLGRGTKITLFLKEDQCEYLEERRIKDLVKKHSEFISYPIYLWTEKTTEKEVSDDEEEETKEEEEGDVEDVDEDKEKKGKKKKVKEVTHEWQLINKQKPIWLRKPEEVTKEEYASFYKSLTNDWEDHLAVKHFSVEGQLEFKAILFVPRRAPFDLFDTRKKLNNIKLYVRRVFIMDNCEELIPEYLGFVKGVVDSDDLPLNISRETLQQNKILKVIRKNLVKKCIEMFNEIAENKEDYAKFYDAFSKNIKLGIHEDSQNRAKLADLLRFHSTKSGDEMTSLKDYVTRMKEGQKDIYYITGESRKAVENSPFLERLKKKGYEVLFMVDAIDEYAVGQLKEYDGKKLVSATxxxxxxxxxxxxxxxxxxxxxxxxxxCKTIKEILGDNVEKVVVSDRIVDSPCCLVTGEYGWSANMERIMKAQALRDSSMSSYMSSKKTMEINPDNGIMEELRKRAEVDKNDKSVKDLVLLLYETALLTSGFSLDDPNTFAARIHRMLKLGLSIEEDETAGDDAEMPPLEDEGNEESKMEEVD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heat shock protein 83 Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.confidentQ7PT10
Heat shock protein 81-2 Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.confidentQ69QQ6
Heat shock protein 81-1 Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.confidentQ0J4P2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CG9, chain A
Confidence level:very confident
Coverage over the Query: 265-593,607-672
View the alignment between query and template
View the model in PyMOL
Template: 3Q6M, chain A
Confidence level:very confident
Coverage over the Query: 269-590,605-672
View the alignment between query and template
View the model in PyMOL