Citrus Sinensis ID: 005339

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-
MASWLKAAEDLFEVVDRRAKLVVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPVDVTPNKDTATLAVEKETITTGKTQKNGEQQQTNERDAPSIPLTEQSKDMSKHDADRVEIPETFTDLDTATPNGEILNENDSDVHLNHPPSPLPPKEMGIVNEDRIDDAGQITKSADADAPLKIDSKIQAVDPPVNSESSLKDADVKVETLSNKRKQQALKADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVCAGLSSRLQEYKSENAQLEELLVAERELSRSYEARIKQLEQELSVYKSEVTKVESNLAEALAAKNSEIETLVSSIDALKKQAALSEGNLASLQMNMESIMRNRELTETRMIQALREELASVERRAEEERAAHNATKMAAMEREVELEHRAAEASMALARIQRIADERTAKAGELEQKVAMLEVECATLQQELQDMEARLKRGQKKSPEEANQAIQMQAWQDEVERARQGQRDAENKLSSLEAEVQKMRVEMAAMKRDAEHYSREEHMELEKRYRELTDLLYYKQTQLETMASEKAAAEFQLEKEMNRLQEVQSEAERSRVSRRSWSSWEEDAEMKSLEPLPLHHRHIAGASVQLQKAAKLLDSGAVRATRFLWRYPIARIILLFYLVFVHLFLMYLLHRLQEQADNFAAREVAESMGLTTSNLP
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccc
**SWLKAAEDLFEVVDRRAKLVVN************************************************************************************************************************************************************************************************************************************************************VCA********************************************************************************************************************************************************************************AMLEVECA**************************************************************************************YRELTDLLYYKQT**********************************************************HRHIAGASVQLQKAAKLLDSGAVRATRFLWRYPIARIILLFYLVFVHLFLMYLLHRLQEQA*************L******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASWLKAAEDLFEVVDRRAKLVVNELADEQSDFQTPASNGQGSQAKKIKSRIKAQRRHSADESLKINDTAREQANTQASPVDVTPNKDTATLAVEKETITTGKTQKNGEQQQTNERDAPSIPLTEQSKDMSKHDADRVEIPETFTDLDTATPNGEILNENDSDVHLNHPPSPLPPKEMGIVNEDRIDDAGQITKSADADAPLKIDSKIQAVDPPVNSESSLKDADVKVETLSNKRKQQALKADDPPTKEQDQLDEAQGLLKTTISTGQSKEARLARVxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAEAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMxxxxxxxxxxxxxxxxxxxxxHNATKMAAMEREVELEHRAAEASMALARIQRIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSPEEANQAIQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEHMELEKRYRELTDLLYYKQTQLETMASExxxxxxxxxxxxxxxxxxxxxxxxxxxxRRSWSSWEEDAEMKSLEPLPLHHRHIAGASVQLQKAAKLLDSGAVRATRFLWRYPIARIILLFYLVFVHLFLMYLLHRLQEQADNFAAREVAESMGLTTSNLP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgin-84 May be involved in maintaining Golgi structure and in intra-Golgi transport.probableQ5JLY8
Golgin candidate 1 Golgi matrix protein playing a role in tethering of vesicles to Golgi membranes and in maintaining the overall structure of the Golgi apparatus.probableQ8S8N9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 300-399
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 450-474
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 547-577
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:confident
Coverage over the Query: 248-266,278-411
View the alignment between query and template
View the model in PyMOL
Template: 4GKW, chain A
Confidence level:confident
Coverage over the Query: 455-575
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 405-478,492-559
View the alignment between query and template
View the model in PyMOL
Template: 1SJJ, chain A
Confidence level:probable
Coverage over the Query: 204-598
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1g8x, chain Aprobable Alignment | Template Structure