Citrus Sinensis ID: 005350
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 701 | ||||||
| 255553747 | 743 | Voltage-dependent L-type calcium channel | 0.911 | 0.860 | 0.785 | 0.0 | |
| 302143292 | 732 | unnamed protein product [Vitis vinifera] | 0.908 | 0.870 | 0.757 | 0.0 | |
| 449438094 | 738 | PREDICTED: two pore calcium channel prot | 0.883 | 0.838 | 0.763 | 0.0 | |
| 18412295 | 733 | two pore calcium channel protein 1 [Arab | 0.881 | 0.843 | 0.75 | 0.0 | |
| 14041819 | 733 | two-pore calcium channel [Arabidopsis th | 0.881 | 0.843 | 0.745 | 0.0 | |
| 75326539 | 735 | RecName: Full=Two pore calcium channel p | 0.911 | 0.869 | 0.723 | 0.0 | |
| 224121708 | 726 | predicted protein [Populus trichocarpa] | 0.898 | 0.867 | 0.751 | 0.0 | |
| 297813953 | 732 | two-pore channel 1 [Arabidopsis lyrata s | 0.897 | 0.859 | 0.741 | 0.0 | |
| 75326538 | 735 | RecName: Full=Two pore calcium channel p | 0.911 | 0.869 | 0.723 | 0.0 | |
| 4206210 | 724 | putative calcium channel [Arabidopsis th | 0.857 | 0.830 | 0.719 | 0.0 |
| >gi|255553747|ref|XP_002517914.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] gi|223542896|gb|EEF44432.1| Voltage-dependent L-type calcium channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 1018 bits (2633), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 506/644 (78%), Positives = 564/644 (87%), Gaps = 5/644 (0%)
Query: 9 GEASGNNRNNDNNRRRRGPTALFRRRTDAITRGSPYQKAAALVDLAEDGIGLPEEILDRS 68
GE S +R+ + R TA F RR+DAITRGSPYQKAAALVDLAEDG+GLPE+ILD+S
Sbjct: 8 GETSSGDRSFSDTDR----TATFNRRSDAITRGSPYQKAAALVDLAEDGVGLPEQILDQS 63
Query: 69 SFESSAKFYFIFIKFDYIWSLNYFALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLGQLP 128
SFE AKFYFI+I+FD++W+LNYFA+IVLNFLEKPLWC+ G + C DREY+YLGQLP
Sbjct: 64 SFERDAKFYFIYIQFDFLWTLNYFAIIVLNFLEKPLWCSNNQSG-HPCTDREYFYLGQLP 122
Query: 129 YLTGWESLVYEGITLVILIIHTFFPITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLY 188
YLT ESL+YEGITLVILI H FFPI+YEGS IFW++ LKV+CL +L+AD LVY LY
Sbjct: 123 YLTTAESLIYEGITLVILIAHIFFPISYEGSRIFWRNPLNLLKVICLSLLIADLLVYTLY 182
Query: 189 LSPIAFNFLPLRIAPYIRVVFFILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWL 248
LSP+A ++LP+RIAPYIRVV FIL IR L+ + +L GMLGTYLNVLAL LLFLLFSSWL
Sbjct: 183 LSPMALDYLPVRIAPYIRVVLFILYIRDLQKGIVILTGMLGTYLNVLALWLLFLLFSSWL 242
Query: 249 AYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGV 308
AYV+FEDT QG +VFTS+G TLY+MFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVL+GV
Sbjct: 243 AYVMFEDTQQGKVVFTSYGKTLYEMFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLLGV 302
Query: 309 YFVTNLILAVVYDSFKSQLAKQVSEMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEE 368
YFVTNLILAVVYDSFK QLAKQVSE D MR+R L KAFNLID YNVG+LNKEQ I LF+E
Sbjct: 303 YFVTNLILAVVYDSFKGQLAKQVSEADSMRKRMLVKAFNLIDKYNVGYLNKEQSIHLFQE 362
Query: 369 LNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRFQKEDVPSCFENLPS 428
LN+YRTLP IS EEFELIF+ELDD DF+I+LDEFADLCNAIA+RFQKEDVPSCFE PS
Sbjct: 363 LNRYRTLPKISGEEFELIFNELDDIRDFRIDLDEFADLCNAIAVRFQKEDVPSCFEYCPS 422
Query: 429 IYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGW 488
IYHS FSE LK F+RS KFGY+IS +L+VNL+AVI+ETTLDI+ +S Q VWQEVEFVFGW
Sbjct: 423 IYHSAFSENLKVFVRSPKFGYIISFVLVVNLIAVIIETTLDIENNSGQKVWQEVEFVFGW 482
Query: 489 IYVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYL 548
IYVLEMALKIY++GFENYWRDGQNRFDF++TWVIVIGETIT ASPNG F SNGEWIRYL
Sbjct: 483 IYVLEMALKIYAFGFENYWRDGQNRFDFVITWVIVIGETITFASPNGLAFFSNGEWIRYL 542
Query: 549 LLARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNA 608
LLARMLRLIRLLMHV+ YR FVATFLTLIPSLMPYLGTIFCV CIYCSLG QIFGGIVNA
Sbjct: 543 LLARMLRLIRLLMHVRSYRAFVATFLTLIPSLMPYLGTIFCVLCIYCSLGEQIFGGIVNA 602
Query: 609 GNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 652
GN+ L TDLAD DYLLFNFNDYPNGMVTLFNLLVMGNWQ+WMQ
Sbjct: 603 GNSNLLGTDLADSDYLLFNFNDYPNGMVTLFNLLVMGNWQIWMQ 646
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|302143292|emb|CBI21853.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449438094|ref|XP_004136825.1| PREDICTED: two pore calcium channel protein 1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|18412295|ref|NP_567258.1| two pore calcium channel protein 1 [Arabidopsis thaliana] gi|75166464|sp|Q94KI8.1|TPC1_ARATH RecName: Full=Two pore calcium channel protein 1; AltName: Full=Calcium channel protein 1; Short=AtCCH1; AltName: Full=Fatty acid oxygenation up-regulated protein 2; AltName: Full=Voltage-dependent calcium channel protein TPC1; Short=AtTPC1 gi|13786069|gb|AAK39554.1|AF360372_1 putative calcium channel [Arabidopsis thaliana] gi|222422931|dbj|BAH19452.1| AT4G03560 [Arabidopsis thaliana] gi|332656937|gb|AEE82337.1| two pore calcium channel protein 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|14041819|dbj|BAB55460.1| two-pore calcium channel [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|75326539|sp|Q75VR1.1|TCP1A_TOBAC RecName: Full=Two pore calcium channel protein 1A; AltName: Full=Voltage-dependent calcium channel protein TPC1A; Short=NtTPC1A gi|46275792|dbj|BAD15099.1| two-pore calcium channel [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|224121708|ref|XP_002330633.1| predicted protein [Populus trichocarpa] gi|222872237|gb|EEF09368.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297813953|ref|XP_002874860.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] gi|297320697|gb|EFH51119.1| two-pore channel 1 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|75326538|sp|Q75VR0.1|TPC1B_TOBAC RecName: Full=Two pore calcium channel protein 1B; AltName: Full=Voltage-dependent calcium channel protein TPC1B; Short=NtTPC1B gi|46275794|dbj|BAD15100.1| two-pore calcium channel [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|4206210|gb|AAD11598.1| putative calcium channel [Arabidopsis thaliana] gi|4263043|gb|AAD15312.1| putative calcium channel [Arabidopsis thaliana] gi|7270679|emb|CAB77841.1| putative calcium channel [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 701 | ||||||
| TAIR|locus:2128716 | 733 | TPC1 "two-pore channel 1" [Ara | 0.881 | 0.843 | 0.666 | 1.2e-223 | |
| UNIPROTKB|J9JHA5 | 773 | TPC3 "Uncharacterized protein" | 0.686 | 0.622 | 0.245 | 1.9e-32 | |
| UNIPROTKB|C4IXV8 | 768 | TPC3 "Uncharacterized protein" | 0.683 | 0.623 | 0.237 | 4.1e-32 | |
| UNIPROTKB|E2QYG4 | 751 | TPCN2 "Uncharacterized protein | 0.777 | 0.725 | 0.244 | 4.4e-28 | |
| UNIPROTKB|Q8NHX9 | 752 | TPCN2 "Two pore calcium channe | 0.718 | 0.670 | 0.241 | 9.7e-26 | |
| UNIPROTKB|F1NSV9 | 742 | TPCN2 "Uncharacterized protein | 0.636 | 0.601 | 0.234 | 2e-25 | |
| UNIPROTKB|E1BIB9 | 751 | TPCN2 "Uncharacterized protein | 0.721 | 0.673 | 0.241 | 5.8e-25 | |
| UNIPROTKB|F1RY74 | 502 | TPCN2 "Uncharacterized protein | 0.539 | 0.752 | 0.268 | 4.3e-24 | |
| UNIPROTKB|F1MSJ0 | 793 | TPCN1 "Uncharacterized protein | 0.694 | 0.614 | 0.228 | 4.8e-22 | |
| UNIPROTKB|E1BXD3 | 587 | E1BXD3 "Uncharacterized protei | 0.278 | 0.332 | 0.289 | 1.1e-21 |
| TAIR|locus:2128716 TPC1 "two-pore channel 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 2159 (765.1 bits), Expect = 1.2e-223, P = 1.2e-223
Identities = 413/620 (66%), Positives = 473/620 (76%)
Query: 33 RRTDAITRGSPYQKAAALVDLAEDGIGLPEEILDRSSFESSAXXXXXXXXXXXXWSLNYF 92
RR++AIT G+P+QKAAALVDLAEDGIGLP EILD+SSF SA WSLNYF
Sbjct: 20 RRSEAITHGTPFQKAAALVDLAEDGIGLPVEILDQSSFGESARYYFIFTRLDLIWSLNYF 79
Query: 93 ALIVLNFLEKPLWCAKTGVGTYSCYDREYYYLGQLPYLTGWESLVYEGITLVILIIHTFF 152
AL+ LNF E+PLWC K SC DR+YYYLG+LPYLT ES++YE ITL IL++HTFF
Sbjct: 80 ALLFLNFFEQPLWCEKNPKP--SCKDRDYYYLGELPYLTNAESIIYEVITLAILLVHTFF 137
Query: 153 PITYEGSPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFIL 212
PI+YEGS IFW S +KV C++IL D LV LYLSP+AF+FLP RIAPY+RV+ FIL
Sbjct: 138 PISYEGSRIFWTSRLNLVKVACVVILFVDVLVDFLYLSPLAFDFLPFRIAPYVRVIIFIL 197
Query: 213 NIRQLRDTLFVLAGMLGTYLNVXXXXXXXXXXXXXXXYVIFEDTVQGNMVFTSFGTTLYQ 272
+IR+LRDTL +L+GMLGTYLN+ +V+FEDT QG VFTS+G TLYQ
Sbjct: 198 SIRELRDTLVLLSGMLGTYLNILALWMLFLLFASWIAFVMFEDTQQGLTVFTSYGATLYQ 257
Query: 273 MFVLFTTSNNPDVWIPAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVS 332
MF+LFTTSNNPDVWIPAYK+SRW +FFVLYVLIGVYFVTNLILAVVYDSFK QLAKQVS
Sbjct: 258 MFILFTTSNNPDVWIPAYKSSRWSSVFFVLYVLIGVYFVTNLILAVVYDSFKEQLAKQVS 317
Query: 333 EMDRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISRXXXXXXXXXXXX 392
MD+M+RR L KAF LID+ G ++K QCIKLFE+L YRTLP IS+
Sbjct: 318 GMDQMKRRMLEKAFGLIDSDKNGEIDKNQCIKLFEQLTNYRTLPKISKEEFGLIFDELDD 377
Query: 393 THDFKINLDEFADLCNAIALRFQKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMXX 452
T DFKIN DEFADLC AIALRFQKE+VPS FE+ P IYHS S++L+AF+RS FGY
Sbjct: 378 TRDFKINKDEFADLCQAIALRFQKEEVPSLFEHFPQIYHSALSQQLRAFVRSPNFGYAIS 437
Query: 453 XXXXXXXXXXXXETTLDIQESSLQSVWQEVEFVFGWIYVLEMALKIYSYGFENYWRDGQN 512
ETTLDI+ESS Q WQ EFVFGWIYVLEMALKIY+YGFENYWR+G N
Sbjct: 438 FILIINFIAVVVETTLDIEESSAQKPWQVAEFVFGWIYVLEMALKIYTYGFENYWREGAN 497
Query: 513 RFDFLVTWVIVIGETITLASPNGQTFLSNGEWIXXXXXXXXXXXXXXXMHVQQYRGFVAT 572
RFDFLVTWVIVIGET T +P+ TF SNGEWI M+VQ+YR F+AT
Sbjct: 498 RFDFLVTWVIVIGETATFITPDENTFFSNGEWIRYLLLARMLRLIRLLMNVQRYRAFIAT 557
Query: 573 FLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYP 632
F+TLIPSLMPYLGTIFCV CIYCS+GVQ+FGG+VNAGN KL ET+LA+DDYLLFNFNDYP
Sbjct: 558 FITLIPSLMPYLGTIFCVLCIYCSIGVQVFGGLVNAGNKKLFETELAEDDYLLFNFNDYP 617
Query: 633 NGMVTLFNLLVMGNWQVWMQ 652
NGMVTLFNLLVMGNWQVWM+
Sbjct: 618 NGMVTLFNLLVMGNWQVWME 637
|
|
| UNIPROTKB|J9JHA5 TPC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C4IXV8 TPC3 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QYG4 TPCN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8NHX9 TPCN2 "Two pore calcium channel protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NSV9 TPCN2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BIB9 TPCN2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RY74 TPCN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MSJ0 TPCN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BXD3 E1BXD3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 701 | |||
| pfam00520 | 194 | pfam00520, Ion_trans, Ion transport protein | 2e-16 | |
| pfam00520 | 194 | pfam00520, Ion_trans, Ion transport protein | 2e-11 | |
| pfam13499 | 60 | pfam13499, EF_hand_5, EF-hand domain pair | 6e-05 | |
| cd00051 | 63 | cd00051, EFh, EF-hand, calcium binding motif; A di | 0.001 |
| >gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein | Back alignment and domain information |
|---|
Score = 77.7 bits (192), Expect = 2e-16
Identities = 47/172 (27%), Positives = 74/172 (43%), Gaps = 13/172 (7%)
Query: 482 VEFVFGWIYVLEMALKIYSYGFE-NYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLS 540
+++VF I+ LEM LK + GF+ Y+R N DFLV ++ + L
Sbjct: 2 LDYVFTVIFTLEMLLKFIALGFKRKYFRSPWNILDFLVVLPSLVSLILFL-------LGE 54
Query: 541 NGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQ 600
+ +R L L R+LRL+RLL R + + + SL+ L + + I+ +GVQ
Sbjct: 55 DSGLLRVLRLLRLLRLLRLLRRFPGLRTLLQSLGRSLKSLLNLLLLLLLLLFIFAIIGVQ 114
Query: 601 IFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQ 652
+FG G + NF+ Y ++ LF L W M
Sbjct: 115 LFG-----GELDKCCDKNENPINGNSNFDSYGEALLWLFRTLTTEGWGDVMY 161
|
This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices. Length = 194 |
| >gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein | Back alignment and domain information |
|---|
| >gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair | Back alignment and domain information |
|---|
| >gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 701 | |||
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 100.0 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 100.0 | |
| KOG2301 | 1592 | consensus Voltage-gated Ca2+ channels, alpha1 subu | 100.0 | |
| KOG2302 | 1956 | consensus T-type voltage-gated Ca2+ channel, pore- | 100.0 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.93 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 99.88 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 99.85 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.84 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 99.75 | |
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 99.74 | |
| PF08016 | 425 | PKD_channel: Polycystin cation channel; InterPro: | 99.68 | |
| KOG3599 | 798 | consensus Ca2+-modulated nonselective cation chann | 99.64 | |
| KOG3713 | 477 | consensus Voltage-gated K+ channel KCNB/KCNC [Inor | 99.54 | |
| KOG1545 | 507 | consensus Voltage-gated shaker-like K+ channel KCN | 99.38 | |
| PLN03223 | 1634 | Polycystin cation channel protein; Provisional | 99.29 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.1 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 98.87 | |
| PF08016 | 425 | PKD_channel: Polycystin cation channel; InterPro: | 98.75 | |
| KOG3599 | 798 | consensus Ca2+-modulated nonselective cation chann | 98.65 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 98.5 | |
| KOG4390 | 632 | consensus Voltage-gated A-type K+ channel KCND [In | 98.49 | |
| KOG1419 | 654 | consensus Voltage-gated K+ channel KCNQ [Inorganic | 98.48 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 98.08 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 98.05 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 97.75 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 97.04 | |
| KOG3614 | 1381 | consensus Ca2+/Mg2+-permeable cation channels (LTR | 96.85 | |
| KOG3609 | 822 | consensus Receptor-activated Ca2+-permeable cation | 96.8 | |
| KOG3533 | 2706 | consensus Inositol 1,4,5-trisphosphate receptor [S | 96.49 | |
| KOG3676 | 782 | consensus Ca2+-permeable cation channel OSM-9 and | 96.45 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 96.43 | |
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 96.08 | |
| KOG3733 | 566 | consensus Mucolipidin and related proteins (TRML s | 95.84 | |
| KOG1420 | 1103 | consensus Ca2+-activated K+ channel Slowpoke, alph | 95.54 | |
| PF13499 | 66 | EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A | 94.83 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 93.6 | |
| cd05022 | 89 | S-100A13 S-100A13: S-100A13 domain found in protei | 93.22 | |
| cd00213 | 88 | S-100 S-100: S-100 domain, which represents the la | 92.62 | |
| smart00027 | 96 | EH Eps15 homology domain. Pair of EF hand motifs t | 92.0 | |
| COG5126 | 160 | FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S | 91.73 | |
| cd05027 | 88 | S-100B S-100B: S-100B domain found in proteins sim | 91.03 | |
| cd00052 | 67 | EH Eps15 homology domain; found in proteins implic | 90.83 | |
| cd05025 | 92 | S-100A1 S-100A1: S-100A1 domain found in proteins | 90.65 | |
| KOG0498 | 727 | consensus K+-channel ERG and related proteins, con | 90.2 | |
| cd05031 | 94 | S-100A10_like S-100A10_like: S-100A10 domain found | 89.26 | |
| cd05026 | 93 | S-100Z S-100Z: S-100Z domain found in proteins sim | 89.17 | |
| cd05023 | 89 | S-100A11 S-100A11: S-100A11 domain found in protei | 87.52 | |
| cd00051 | 63 | EFh EF-hand, calcium binding motif; A diverse supe | 87.01 | |
| KOG3684 | 489 | consensus Ca2+-activated K+ channel proteins (inte | 86.58 | |
| KOG3614 | 1381 | consensus Ca2+/Mg2+-permeable cation channels (LTR | 86.4 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 86.25 | |
| PF00036 | 29 | EF-hand_1: EF hand; InterPro: IPR018248 Many calci | 85.66 | |
| KOG0027 | 151 | consensus Calmodulin and related proteins (EF-Hand | 85.06 | |
| KOG0500 | 536 | consensus Cyclic nucleotide-gated cation channel C | 84.61 | |
| PTZ00183 | 158 | centrin; Provisional | 84.23 | |
| KOG0499 | 815 | consensus Cyclic nucleotide-gated cation channel C | 83.3 | |
| KOG0510 | 929 | consensus Ankyrin repeat protein [General function | 82.63 | |
| PTZ00184 | 149 | calmodulin; Provisional | 80.96 | |
| cd00252 | 116 | SPARC_EC SPARC_EC; extracellular Ca2+ binding doma | 80.62 | |
| PTZ00184 | 149 | calmodulin; Provisional | 80.33 | |
| PF13833 | 54 | EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A | 80.23 | |
| KOG0028 | 172 | consensus Ca2+-binding protein (centrin/caltractin | 80.1 | |
| cd05029 | 88 | S-100A6 S-100A6: S-100A6 domain found in proteins | 80.07 |
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-61 Score=523.69 Aligned_cols=465 Identities=21% Similarity=0.341 Sum_probs=386.1
Q ss_pred HHHHHHHHHHHHHHHHHhcCc----hhhhcccccceehhhHHHHHHHHHHHhhhcCCCCc----cchhhHHHHHHHHHHH
Q 005350 139 EGITLVILIIHTFFPITYEGS----PIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAF----NFLPLRIAPYIRVVFF 210 (701)
Q Consensus 139 e~v~~~if~~E~~lk~~~~g~----~~y~~~~wn~~D~~iiv~~~i~~i~~~~~~~~~~~----~~~~lr~~R~lR~lrl 210 (701)
+.+|+++|++|+.+|+++.|+ .+|+++.||.+|++++.++++|+++.... ..+. ..+++|.+|.|||+|.
T Consensus 1162 nyIFtaIfV~Em~lKVVALGl~fge~aYl~ssWN~LDgflv~vsviDilvs~as--a~g~kILgVlrvLRlLRtlRpLRv 1239 (1956)
T KOG2302|consen 1162 NYIFTAIFVVEMTLKVVALGLYFGEQAYLRSSWNVLDGFLVAVSVIDILVSQAS--AGGAKILGVLRVLRLLRTLRPLRV 1239 (1956)
T ss_pred chHHHHHHHHHHHHHHHhhhhccchHHHHHHHHHhhhHHHHHHHHHHHHHHHhh--hhhHHHHHHHHHHHHHHHhhHHHH
Confidence 699999999999999999884 67999999999999999999999988663 2222 2468888899999999
Q ss_pred HhccHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhcccc-------------------------cccccccc
Q 005350 211 ILNIRQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTV-------------------------QGNMVFTS 265 (701)
Q Consensus 211 i~~~~~lr~~~~~l~~~~~~i~~~~~l~~~~~~~fai~g~~lF~~~~-------------------------~~~~~F~~ 265 (701)
|.+.++++.++.++..|+|.|+++.++++.++++|+++|.++|+|+- ...+||||
T Consensus 1240 iSra~glklVveTL~sSLkpIgnIvliccaffiiFgilgvqLFkgkfy~c~g~dtrnitnKSdc~aa~yRwvrhkyNfdn 1319 (1956)
T KOG2302|consen 1240 ISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNKSDCMAAPYRWVRHKYNFDN 1319 (1956)
T ss_pred HhhcccHHHHHHHHHhccccHHHHHHHHHHHHHHHHHHHHHHhcccceeccccccccccchhhhcccchhhhhhhcccch
Confidence 99999999999999999999999999999999999999999999530 12578999
Q ss_pred HHHHHHHHHHHHhcCCCchhhH-----------hhhccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Q 005350 266 FGTTLYQMFVLFTTSNNPDVWI-----------PAYKASRWYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQLAKQVSEM 334 (701)
Q Consensus 266 ~~~s~~~lf~l~T~~~w~dv~~-----------p~~~~~~~~~ifFi~~~~l~~~~~lnLfiaVi~~~f~~~~~~~~~~~ 334 (701)
.+.++++||++.|-+||.++|+ |..++++|..+|||+|.+|..|+++|||++|+.+||.+..+++.+++
T Consensus 1320 lgqalmSLFvLaSkDgWv~ImyDgldavavdqqPI~nhnpwmllYfIsfllIvsffVlnmfVgvvvenfhKcrqhqe~Ee 1399 (1956)
T KOG2302|consen 1320 LGQALMSLFVLASKDGWVNIMYDGLDAVAVDQQPILNHNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEE 1399 (1956)
T ss_pred HHHHHHHHHHHhcccchhhhhccchhhceeeeeccccCCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999984 67789999999999999999999999999999999999888776665
Q ss_pred HHHHHHHHHHHHHhhccccCCCCCHHHHHHHHHHhhhccCCCCCChHHHHHHhhhhcccCCcccchhhhhhhHHHHHhhh
Q 005350 335 DRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTHDFKINLDEFADLCNAIALRF 414 (701)
Q Consensus 335 ~~~r~~~l~~af~~L~~~~~~~l~~~q~~~~~~~l~~~~~~~~~~~~~~~~l~~~~d~~~~~~i~~~ef~~~~~~i~~~~ 414 (701)
.++|+++.- +.+.+.+
T Consensus 1400 ArRreEKrL-----------------------rrlekkr----------------------------------------- 1415 (1956)
T KOG2302|consen 1400 ARRREEKRL-----------------------RRLEKKR----------------------------------------- 1415 (1956)
T ss_pred HHHHHHHHH-----------------------HHHHHHH-----------------------------------------
Confidence 554443211 1110000
Q ss_pred cccCCccccccCCcccccHHHHHHHhcccchhHHHHHHHHHHHHHHHHHHhhccccccchhhhHHHHHHHHHHHHHHHHH
Q 005350 415 QKEDVPSCFENLPSIYHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWIYVLEM 494 (701)
Q Consensus 415 ~k~~~~~~~~~~p~~~~s~~r~~~~~iv~~~~f~~~i~~~Illn~i~l~~~~~~~~~~~~~~~~~~~i~~~f~~iF~~E~ 494 (701)
.+..+.++... .+..|+.++....+.+.+.+++++|.+|++.+..|.+ .++......+.+.++.|+++|+.|+
T Consensus 1416 R~Aq~kpyyse-----yt~~rrlIh~~ctShyld~fit~ii~LnvVtms~ehy--qqp~sldealkycny~ft~vfV~Ea 1488 (1956)
T KOG2302|consen 1416 RAAQRKPYYSE-----YTMTRRLIHSKCTSHYLDQFITFIICLNVVTMSEEHY--QQPTSLDEALKYCNYRFTAVFVLEA 1488 (1956)
T ss_pred HhccCCccccc-----ccHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHH--hCcccHHHHhhhcceeeeehhHHHH
Confidence 00000011110 1567899999999999999999999999999999987 4566677889999999999999999
Q ss_pred HHHHhhcCcccccccCcCcchhHHHHHHHHHHHHHhcCCCCccccchhhHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHH
Q 005350 495 ALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFL 574 (701)
Q Consensus 495 ilKi~a~G~~~y~~~~wn~fD~ivv~~s~i~~i~~~~~~~~~~~~~~~~~l~~lr~~RvlRllrli~~~~~lr~l~~tl~ 574 (701)
++|.++.|.++||++.||.+|+.+++.++.+..+.-+..+ .....+++++|++|++|+.|++|+++...++|.++.|+.
T Consensus 1489 V~klvafG~rrFfkdrwnqldlaivlls~mgitleeie~n-aalpinptiirimrvlriarvlkllkmatgmralldtvv 1567 (1956)
T KOG2302|consen 1489 VLKLVAFGERRFFKDRWNQLDLAIVLLSVMGITLEEIEIN-AALPINPTIIRIMRVLRIARVLKLLKMATGMRALLDTVV 1567 (1956)
T ss_pred HHHHHHHhHHHHHhhhhhhhhHHHHHHHHhcccHhheeec-ccCCCChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 9999999999999999999999999999988877654422 123357899999999999999999999999999999999
Q ss_pred HHHhhHHHHHHHHHHHHHHHHHHHHHHhcccccccCCCCCCCccccccccccCCCCHHHHHHHHHHHHhccChHHHHHHh
Q 005350 575 TLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAGNAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWMQLQ 654 (701)
Q Consensus 575 ~~~~~l~~~~~l~~~~~~ifAiiG~~lF~g~~~~~n~~~~~~~~~~~~y~~~nF~~f~~al~tLf~i~t~e~W~~im~~~ 654 (701)
+++|.++++.++.++++++||.+|+++||... ||+.-+..+..++ ..|.||+.|++|||+++||+||+.||.|.
T Consensus 1568 qalpqvgnlgllfmllffiyaalgvelfg~le--c~e~npceglsrh----atf~nfgmafltlfrvstgdnwngimkdt 1641 (1956)
T KOG2302|consen 1568 QALPQVGNLGLLFMLLFFIYAALGVELFGKLE--CNEENPCEGLSRH----ATFENFGMAFLTLFRVSTGDNWNGIMKDT 1641 (1956)
T ss_pred HhcccccchhHHHHHHHHHHHHHHHHHhcccc--cCCCCCccccccc----cchhhhchHhhhheeeccCCcccchhhhh
Confidence 99999999999999999999999999999874 6665554455443 68999999999999999999999999997
Q ss_pred hhhcCCCCCccccccCCCCcce----eeehhhhhhccceeeec
Q 005350 655 RVDRNCLDSSIFRQLLPNNCFT----TIEFGHSFCLGGILCRN 693 (701)
Q Consensus 655 ~~~~~c~~~~~~~~~~~~~cg~----~~~y~~~~~~~~~~~~~ 693 (701)
. +.|+.. ..|-+ +++|..|+....+...|
T Consensus 1642 l--rdc~~e--------~~cls~~~sp~yfvsfvltaqfvlvn 1674 (1956)
T KOG2302|consen 1642 L--RDCTHE--------ESCLSQFVSPLYFVSFVLTAQFVLVN 1674 (1956)
T ss_pred H--hhcccc--------hhhhhhhccchhhhhhhhhhhhHHHH
Confidence 6 445432 23443 46676666655555544
|
|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2301 consensus Voltage-gated Ca2+ channels, alpha1 subunits [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2302 consensus T-type voltage-gated Ca2+ channel, pore-forming alpha1I subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys | Back alignment and domain information |
|---|
| >KOG3599 consensus Ca2+-modulated nonselective cation channel polycystin [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3713 consensus Voltage-gated K+ channel KCNB/KCNC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1545 consensus Voltage-gated shaker-like K+ channel KCNA [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03223 Polycystin cation channel protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys | Back alignment and domain information |
|---|
| >KOG3599 consensus Ca2+-modulated nonselective cation channel polycystin [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4390 consensus Voltage-gated A-type K+ channel KCND [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1419 consensus Voltage-gated K+ channel KCNQ [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG3614 consensus Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3533 consensus Inositol 1,4,5-trisphosphate receptor [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG3733 consensus Mucolipidin and related proteins (TRML subfamily of transient receptor potential proteins) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1420 consensus Ca2+-activated K+ channel Slowpoke, alpha subunit [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 | Back alignment and domain information |
|---|
| >cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif | Back alignment and domain information |
|---|
| >smart00027 EH Eps15 homology domain | Back alignment and domain information |
|---|
| >COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] | Back alignment and domain information |
|---|
| >cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B | Back alignment and domain information |
|---|
| >cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction | Back alignment and domain information |
|---|
| >cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 | Back alignment and domain information |
|---|
| >KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 | Back alignment and domain information |
|---|
| >cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z | Back alignment and domain information |
|---|
| >cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 | Back alignment and domain information |
|---|
| >cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands | Back alignment and domain information |
|---|
| >KOG3684 consensus Ca2+-activated K+ channel proteins (intermediate/small conductance classes) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3614 consensus Ca2+/Mg2+-permeable cation channels (LTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand | Back alignment and domain information |
|---|
| >KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00183 centrin; Provisional | Back alignment and domain information |
|---|
| >KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0510 consensus Ankyrin repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) | Back alignment and domain information |
|---|
| >PTZ00184 calmodulin; Provisional | Back alignment and domain information |
|---|
| >PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A | Back alignment and domain information |
|---|
| >KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 701 | |||
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 1e-22 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 7e-13 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 1e-20 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 6e-12 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-06 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 3e-06 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 3e-05 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 4e-04 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 6e-04 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 6e-04 | |
| 1ij5_A | 323 | Plasmodial specific LAV1-2 protein; fourty kDa cal | 8e-04 |
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 3rw0_A* Length = 285 | Back alignment and structure |
|---|
Score = 97.5 bits (243), Expect = 1e-22
Identities = 40/222 (18%), Positives = 86/222 (38%), Gaps = 35/222 (15%)
Query: 430 YHSPFSEKLKAFIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWI 489
S ++ + S+ F I ++++N + + +ET+ S + I
Sbjct: 15 RGSHMYLRITNIVESSFFTKFIIYLIVLNGITMGLETS-KTFMQSFGVYTTLFNQIVITI 73
Query: 490 YVLEMALKIYSYGFENYWRDGQNRFDFLVTWVIVIGETITLASPNGQTFLSNGEWIRYLL 549
+ +E+ L+IY + ++++D + FDF +V + + L
Sbjct: 74 FTIEIILRIYVHRI-SFFKDPWSLFDF----FVVAI-----------SLVPTSSGFEILR 117
Query: 550 LARMLRLIRLLMHVQQYRGFVATFLTLIPSLMPYLGTIFCVQCIYCSLGVQIFGGIVNAG 609
+ R+LRL RL+ V Q R V+ +++IP ++ + + I+ + Q+FG
Sbjct: 118 VLRVLRLFRLVTAVPQMRKIVSALISVIPGMLSVIALMTLFFYIFAIMATQLFGERFPE- 176
Query: 610 NAKLEETDLADDDYLLFNFNDYPNGMVTLFNLLVMGNWQVWM 651
F TLF ++ + +W + +
Sbjct: 177 -----------------WFGTLGESFYTLFQVMTLESWSMGI 201
|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 3rw0_A* Length = 285 | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Length = 229 | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Length = 229 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 | Back alignment and structure |
|---|
| >1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 701 | |||
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 99.97 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 99.97 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 99.96 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 99.94 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.87 | |
| 4f4l_A | 112 | ION transport protein; alpha helical membrane prot | 99.82 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.8 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.68 | |
| 1ors_C | 132 | Potassium channel; voltage-dependent, voltage sens | 99.58 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.5 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.47 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.39 | |
| 4f4l_A | 112 | ION transport protein; alpha helical membrane prot | 99.21 | |
| 2kyh_A | 147 | KVAP, voltage-gated potassium channel; ION channel | 99.13 | |
| 1ors_C | 132 | Potassium channel; voltage-dependent, voltage sens | 99.12 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 98.72 | |
| 2kyh_A | 147 | KVAP, voltage-gated potassium channel; ION channel | 98.33 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 98.21 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 97.67 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 97.48 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 97.24 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 96.56 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 96.56 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 96.22 | |
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 96.04 | |
| 2lv7_A | 100 | Calcium-binding protein 7; metal binding protein; | 96.01 | |
| 1fi6_A | 92 | EH domain protein REPS1; EPS15 homology domain, EF | 95.96 | |
| 1eh2_A | 106 | EPS15; calcium binding, signaling domain, NPF bind | 95.74 | |
| 1c07_A | 95 | Protein (epidermal growth factor receptor pathway | 95.66 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 95.52 | |
| 2kgr_A | 111 | Intersectin-1; structure, alternative splicing, ca | 95.33 | |
| 1qjt_A | 99 | EH1, epidermal growth factor receptor substrate su | 95.22 | |
| 3fia_A | 121 | Intersectin-1; EH 1 domain, NESG, structural genom | 95.05 | |
| 2kz2_A | 94 | Calmodulin, CAM; TR2C, metal binding protein; NMR | 95.0 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 94.9 | |
| 1wlz_A | 105 | DJBP, CAP-binding protein complex interacting prot | 94.74 | |
| 2jq6_A | 139 | EH domain-containing protein 1; metal binding prot | 94.72 | |
| 1tiz_A | 67 | Calmodulin-related protein, putative; helix-turn-h | 94.71 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 94.59 | |
| 2pmy_A | 91 | RAS and EF-hand domain-containing protein; rasef, | 94.55 | |
| 1avs_A | 90 | Troponin C; muscle contraction, calcium-activated, | 94.48 | |
| 1k2h_A | 93 | S100A1, S-100 protein, alpha chain; non-covalent h | 94.4 | |
| 2joj_A | 77 | Centrin protein; N-terminal domain, centrin soluti | 94.37 | |
| 1iq3_A | 110 | Ralbp1-interacting protein (partner of ralbp1); EF | 94.33 | |
| 2ktg_A | 85 | Calmodulin, putative; ehcam, Ca-binding protein, p | 94.33 | |
| 3rm1_A | 92 | Protein S100-B; alpha-helical, EF hand, metal bind | 94.12 | |
| 2opo_A | 86 | Polcalcin CHE A 3; calcium-binding protein, dimer, | 94.1 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 94.05 | |
| 2kn2_A | 92 | Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco | 93.93 | |
| 3li6_A | 66 | Calcium-binding protein; calcium signaling protein | 93.92 | |
| 1k9u_A | 78 | Polcalcin PHL P 7; pollen allergen, calcium-bindin | 93.85 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 93.79 | |
| 1yx7_A | 83 | Calsensin, LAN3-6 antigen; calcium-binding protein | 93.79 | |
| 5pal_A | 109 | Parvalbumin; calcium-binding protein; 1.54A {Triak | 93.77 | |
| 1qx2_A | 76 | Vitamin D-dependent calcium-binding protein, INTE; | 93.63 | |
| 2b1u_A | 71 | Calmodulin-like protein 5; CLSP, calmodulin-like S | 93.5 | |
| 1xk4_C | 113 | Calgranulin B; S100 family, heterotetramer, metal | 93.48 | |
| 3n22_A | 98 | Protein S100-A2; EF-hand, calcium-binding, zinc-bi | 93.44 | |
| 4eto_A | 93 | Protein S100-A4; calcium-binding protein, EF-hand, | 93.37 | |
| 1j7q_A | 86 | CAVP, calcium vector protein; EF-hand family, calc | 93.2 | |
| 3nso_A | 101 | Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta | 93.12 | |
| 3nxa_A | 100 | Protein S100-A16; S100 family, calcium binding pro | 93.07 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 93.05 | |
| 1rwy_A | 109 | Parvalbumin alpha; EF-hand, calcium-binding, calci | 93.05 | |
| 2lnk_A | 113 | Protein S100-A4; EF-hand, calcium binding, all alp | 92.87 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 92.86 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 92.81 | |
| 3zwh_A | 104 | Protein S100-A4; Ca-binding protein-motor protein | 92.78 | |
| 3fs7_A | 109 | Parvalbumin, thymic; calcium-binding protein, EF-h | 92.78 | |
| 1qg9_A | 26 | Protein (sodium channel protein, brain II alpha su | 92.76 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 92.66 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 92.64 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 92.55 | |
| 3h4s_E | 135 | KCBP interacting Ca2+-binding protein; kinesin, mo | 92.54 | |
| 2pvb_A | 108 | Protein (parvalbumin); calcium binding protein, me | 92.46 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 92.43 | |
| 1pva_A | 110 | Parvalbumin; calcium binding; 1.65A {Esox lucius} | 92.37 | |
| 1bu3_A | 109 | Calcium-binding protein; 1.65A {Merluccius bilinea | 92.31 | |
| 2lcm_A | 28 | Voltage-dependent N-type calcium channel subunit; | 92.25 | |
| 2d58_A | 107 | Allograft inflammatory factor 1; EF-hand, metal bi | 92.21 | |
| 1q80_A | 174 | SCP, sarcoplasmic calcium-binding protein; all-alp | 92.21 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 92.06 | |
| 1k8u_A | 90 | S100A6, calcyclin, CACY; calcium regulatory protei | 91.94 | |
| 2kax_A | 92 | Protein S100-A5; EF-hand, calcium binding protien, | 91.89 | |
| 3i5g_C | 159 | Myosin catalytic light chain LC-1, mantle muscle; | 91.73 | |
| 2y5i_A | 99 | S100Z, S100 calcium binding protein Z; metal-bindi | 91.67 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 91.62 | |
| 1uhk_A | 191 | Aequorin 2, aequorin; EF-hand motif, complex, lumi | 91.56 | |
| 1j55_A | 95 | S-100P protein; metal binding protein; 2.00A {Homo | 91.55 | |
| 1c7v_A | 81 | CAVP, calcium vector protein; EF-hand family, calc | 91.43 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 91.33 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 91.31 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 91.31 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 91.29 | |
| 2ovk_C | 159 | Myosin catalytic light chain LC-1, mantle muscle, | 91.23 | |
| 2lcm_A | 28 | Voltage-dependent N-type calcium channel subunit; | 91.16 | |
| 2jjz_A | 150 | Ionized calcium-binding adapter molecule 2; EF-han | 91.08 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 90.99 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 90.94 | |
| 1rro_A | 108 | RAT oncomodulin; calcium-binding protein; 1.30A {R | 90.92 | |
| 1cb1_A | 78 | Calbindin D9K; calcium-binding protein; NMR {Sus s | 90.86 | |
| 1ggw_A | 140 | Protein (CDC4P); light chain, cytokinesis, cell cy | 90.81 | |
| 2kav_A | 129 | Sodium channel protein type 2 subunit alpha; volta | 90.77 | |
| 2wcb_A | 95 | Protein S100-A12; calcium signalling, HOST-parasit | 90.76 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 90.73 | |
| 3j04_B | 143 | Myosin regulatory light chain 2, smooth muscle MA | 90.68 | |
| 1xk4_A | 93 | Calgranulin A; S100 family, heterotetramer, metal | 90.63 | |
| 1qls_A | 99 | S100C protein, calgizzarin; metal-binding protein/ | 90.61 | |
| 2hpk_A | 208 | Photoprotein berovin; structural genomics, PSI, pr | 90.6 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 90.59 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 90.52 | |
| 1m45_A | 148 | MLC1P, myosin light chain; protein-peptide complex | 90.41 | |
| 1w7j_B | 151 | Myosin light chain 1; motor protein, unconventiona | 90.29 | |
| 2mys_B | 166 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 90.28 | |
| 2bl0_B | 145 | Myosin regulatory light chain; muscle protein, sli | 90.27 | |
| 4drw_A | 121 | Protein S100-A10/annexin A2 chimeric protein; atyp | 90.22 | |
| 2l4h_A | 214 | Calcium and integrin-binding protein 1; metal bind | 90.15 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 90.09 | |
| 1wy9_A | 147 | Allograft inflammatory factor 1; EF-hand, calucium | 90.06 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 90.01 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 89.78 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 89.72 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 89.64 | |
| 3qrx_A | 169 | Centrin; calcium-binding, EF-hand, cell division, | 89.62 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 89.62 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 89.61 | |
| 1s6j_A | 87 | CDPK, calcium-dependent protein kinase SK5; EF-han | 89.6 | |
| 2bec_A | 202 | Calcineurin B homologous protein 2; calcineurin-ho | 89.54 | |
| 3ox6_A | 153 | Calcium-binding protein 1; EF-hand, calcium-sensor | 89.35 | |
| 3fwb_A | 161 | Cell division control protein 31; gene gating, com | 89.05 | |
| 3ll8_B | 155 | Calcineurin subunit B type 1; protein-peptide dock | 89.04 | |
| 3dd4_A | 229 | KV channel-interacting protein 4; EF-hands protein | 89.02 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 88.91 | |
| 2jnf_A | 158 | Troponin C; stretch activated muscle contraction, | 88.85 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 88.82 | |
| 2bl0_C | 142 | Myosin regulatory light chain; muscle protein, sli | 88.67 | |
| 3khe_A | 191 | Calmodulin-like domain protein kinase isoform 3; c | 88.65 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 88.63 | |
| 2h2k_A | 106 | Protein S100-A13; calcium binding protein, metal b | 88.55 | |
| 1a4p_A | 96 | S100A10; S100 family, EF-hand protein, ligand of a | 88.51 | |
| 2obh_A | 143 | Centrin-2; DNA repair complex EF hand superfamily | 88.49 | |
| 1psr_A | 100 | Psoriasin, S100A7; EF-hand protein, MAD phasing, p | 88.4 | |
| 1exr_A | 148 | Calmodulin; high resolution, disorder, metal trans | 88.3 | |
| 4ds7_A | 147 | Calmodulin, CAM; protein binding, metal binding, s | 88.2 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 88.14 | |
| 2ct9_A | 208 | Calcium-binding protein P22; EF-hand, metal bindin | 88.05 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 88.0 | |
| 2ovk_B | 153 | RLC, myosin regulatory light chain LC-2, mantle mu | 88.0 | |
| 3u0k_A | 440 | Rcamp; fluorescent protein, calcium binding, EF-ha | 87.97 | |
| 1top_A | 162 | Troponin C; contractIle system protein; 1.78A {Gal | 87.79 | |
| 2f2o_A | 179 | Calmodulin fused with calmodulin-binding domain of | 87.75 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 87.7 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 87.33 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 87.07 | |
| 3a8r_A | 179 | Putative uncharacterized protein; EF-hand, membran | 86.99 | |
| 2kyc_A | 108 | Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p | 86.84 | |
| 3mse_B | 180 | Calcium-dependent protein kinase, putative; CDPKS, | 86.55 | |
| 1dtl_A | 161 | Cardiac troponin C; helix-turn-helix, structural p | 86.37 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 86.33 | |
| 1k94_A | 165 | Grancalcin; penta-EF-hand protein, calcium binding | 86.33 | |
| 1wdc_B | 156 | Scallop myosin; calcium binding protein, muscle pr | 86.23 | |
| 1gjy_A | 167 | Sorcin, CP-22, V19; calcium binding, calcium-bindi | 86.1 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 86.08 | |
| 1s6c_A | 183 | KV4 potassium channel-interacting protein kchip1B; | 86.07 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 86.01 | |
| 1s1e_A | 224 | KV channel interacting protein 1; kchip, calcium-b | 85.98 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 85.67 | |
| 1dgu_A | 183 | Calcium-saturated CIB; helical, EF-hands, blood cl | 85.48 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 85.33 | |
| 3sjs_A | 220 | URE3-BP sequence specific DNA binding protein; EF- | 85.28 | |
| 2ggz_A | 211 | Guanylyl cyclase-activating protein 3; EF hand, gu | 85.24 | |
| 2l2e_A | 190 | Calcium-binding protein NCS-1; NCS1P, myristoylate | 84.72 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 84.63 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 84.53 | |
| 1qg9_A | 26 | Protein (sodium channel protein, brain II alpha su | 84.41 | |
| 2mys_C | 149 | Myosin; muscle protein, motor protein; HET: MLY; 2 | 84.15 | |
| 3pm8_A | 197 | PFCDPK2, calcium-dependent protein kinase 2; malar | 84.14 | |
| 3dtp_E | 196 | RLC, myosin regulatory light chain; muscle protein | 84.0 | |
| 1nya_A | 176 | Calerythrin; EF-hand, metal binding protein; NMR { | 84.0 | |
| 2sas_A | 185 | Sarcoplasmic calcium-binding protein; 2.40A {Branc | 83.88 | |
| 2ccm_A | 191 | Calexcitin; EF hand, calcium, signaling protein; 1 | 83.79 | |
| 3k21_A | 191 | PFCDPK3, calcium-dependent protein kinase 3; calci | 83.72 | |
| 1snl_A | 103 | Nucleobindin 1, calnuc; EF-hand, calcium-binding, | 83.39 | |
| 1jfj_A | 134 | Ehcabp, calcium-binding protein; EF-hand, helix-lo | 83.38 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 83.37 | |
| 2jul_A | 256 | Calsenilin; EF-hand, calcium, LXXLL, DNA binding p | 82.78 | |
| 3e3r_A | 204 | Calcyphosin, calcyphosine; human calcyphosine, EF- | 82.73 | |
| 1wdc_C | 156 | Scallop myosin; calcium binding protein, muscle pr | 82.71 | |
| 1g8i_A | 190 | Frequenin, neuronal calcium sensor 1; calcium bind | 82.54 | |
| 2be4_A | 272 | Hypothetical protein LOC449832; DR.36843, BC083168 | 82.32 | |
| 3cs1_A | 219 | Flagellar calcium-binding protein; myristoylated, | 82.3 | |
| 2lvv_A | 226 | Flagellar calcium-binding protein TB-24; EF-hand, | 82.26 | |
| 2lhi_A | 176 | Calmodulin, serine/threonine-protein phosphatase c | 82.0 | |
| 2i7a_A | 174 | Calpain 13; calcium-dependent cytoplasmic cysteine | 81.68 | |
| 1juo_A | 198 | Sorcin; calcium-binding proteins, penta-EF-hand, P | 81.68 | |
| 2qac_A | 146 | Myosin A tail domain interacting protein MTIP; mal | 81.4 | |
| 1h8b_A | 75 | ACT-EF34, alpha-actinin 2, skeletal muscle isoform | 81.38 | |
| 2lmt_A | 148 | Calmodulin-related protein 97A; spermatogenesis, m | 81.27 | |
| 3i5g_B | 153 | Myosin regulatory light chain LC-2, mantle muscle; | 81.26 | |
| 1alv_A | 173 | Calpain, S-camld; calcium binding, calmodulin like | 81.23 | |
| 2znd_A | 172 | Programmed cell death protein 6; penta-EF-hand pro | 81.23 | |
| 1qv0_A | 195 | Obelin, OBL; photoprotein, bioluminescence, atomic | 81.15 | |
| 1bjf_A | 193 | Neurocalcin delta; calcium-binding, myristoylation | 80.95 | |
| 3a4u_B | 143 | Multiple coagulation factor deficiency protein 2; | 80.9 | |
| 3akb_A | 166 | Putative calcium binding protein; EF-hand, metal b | 80.82 | |
| 2aao_A | 166 | CDPK, calcium-dependent protein kinase, isoform AK | 80.73 | |
| 1y1x_A | 191 | Leishmania major homolog of programmed cell death | 80.41 | |
| 2zfd_A | 226 | Calcineurin B-like protein 2; calcium binding prot | 80.34 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 80.04 |
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
Probab=99.97 E-value=5.9e-32 Score=273.65 Aligned_cols=182 Identities=18% Similarity=0.295 Sum_probs=157.2
Q ss_pred HHHHHHHHHHHHHHHHHHHHhcC-chhhhcccccceehhhHHHHHHHHHHHhhhcCCCCccchhhHHHHHHHHHHHHhcc
Q 005350 136 LVYEGITLVILIIHTFFPITYEG-SPIFWKSTYTRLKVLCLLILVADFLVYGLYLSPIAFNFLPLRIAPYIRVVFFILNI 214 (701)
Q Consensus 136 ~~~e~v~~~if~~E~~lk~~~~g-~~~y~~~~wn~~D~~iiv~~~i~~i~~~~~~~~~~~~~~~lr~~R~lR~lrli~~~ 214 (701)
..+|.+|+++|++|+++|+++.| +++|++++||++|++++++++++.... ...+.+|.+|++|++|+++++
T Consensus 45 ~~~e~~~~~iF~~E~~lri~~~~~~~~y~~~~wni~D~~~v~~~~i~~~~~--------~~~~~lr~~RilR~lrl~~~~ 116 (229)
T 4dxw_A 45 HLLDYGITIFFVIEILIRFIGEKQKADFFKSGWNIFDTVIVAISLIPIPNN--------SSFLVLRLLRIFRVLRLISVI 116 (229)
T ss_dssp HHHHHHHHHHHHHHHHHHHHC---------CHHHHHHHHHHHHTTCC----------------CCTTHHHHHHTTHHHHC
T ss_pred HHHHHHHHHHHHHHHHHHHHHcCchhHHhcCCcHHHHHHHHHHHHhhcCcc--------HHHHHHHHHHHHHHHHHHHHh
Confidence 45799999999999999999986 578999999999999998887654211 234578999999999999999
Q ss_pred HHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhccccccccccccHHHHHHHHHHHHhcCCCchhhHhhhccCc
Q 005350 215 RQLRDTLFVLAGMLGTYLNVLALGLLFLLFSSWLAYVIFEDTVQGNMVFTSFGTTLYQMFVLFTTSNNPDVWIPAYKASR 294 (701)
Q Consensus 215 ~~lr~~~~~l~~~~~~i~~~~~l~~~~~~~fai~g~~lF~~~~~~~~~F~~~~~s~~~lf~l~T~~~w~dv~~p~~~~~~ 294 (701)
+++|.+.+++.++.|+++++++++++++++||++|+++|++.. +.+|+|+++|++++|+++|+|||+|+|++.+..++
T Consensus 117 ~~l~~l~~~l~~s~~~l~~~~~~l~~~~~ifa~~g~~lf~~~~--~~~F~~~~~a~~~lf~~~t~~~w~~i~~~~~~~~~ 194 (229)
T 4dxw_A 117 PELKQIIEAILESVRRVFFVSLLLFIILYIYATMGAILFGNDD--PSRWGDLGISLITLFQVLTLSSWETVMLPMQEIYW 194 (229)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTS--CTTTSSHHHHHHHHHHHHTTSSTHHHHHHHHTTCT
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCC--cccccCHHHHHHHHHHHHccCCHHHHHHHHHHhCC
Confidence 9999999999999999999999999999999999999999864 46899999999999999999999999999999999
Q ss_pred chHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 005350 295 WYCLFFVLYVLIGVYFVTNLILAVVYDSFKSQL 327 (701)
Q Consensus 295 ~~~ifFi~~~~l~~~~~lnLfiaVi~~~f~~~~ 327 (701)
++++||++|+++++++++||++|+++|||++++
T Consensus 195 ~~~~~f~~~~~i~~~i~lNlfiavi~~~f~~~~ 227 (229)
T 4dxw_A 195 WSWVYFFSFIIICSITILNLVIAILVDVVIQKK 227 (229)
T ss_dssp THHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTC
T ss_pred cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 999999999999999999999999999998643
|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >4f4l_A ION transport protein; alpha helical membrane protein, voltage-gated sodium channel membrane, metal transport; 3.49A {Magnetococcus marinus} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >4f4l_A ION transport protein; alpha helical membrane protein, voltage-gated sodium channel membrane, metal transport; 3.49A {Magnetococcus marinus} | Back alignment and structure |
|---|
| >2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
| >2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A | Back alignment and structure |
|---|
| >1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A | Back alignment and structure |
|---|
| >2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A | Back alignment and structure |
|---|
| >1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A | Back alignment and structure |
|---|
| >1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A | Back alignment and structure |
|---|
| >2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} | Back alignment and structure |
|---|
| >1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 | Back alignment and structure |
|---|
| >3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... | Back alignment and structure |
|---|
| >2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} | Back alignment and structure |
|---|
| >3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A | Back alignment and structure |
|---|
| >5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A | Back alignment and structure |
|---|
| >2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* | Back alignment and structure |
|---|
| >4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* | Back alignment and structure |
|---|
| >1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A | Back alignment and structure |
|---|
| >3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A | Back alignment and structure |
|---|
| >3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A | Back alignment and structure |
|---|
| >2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} | Back alignment and structure |
|---|
| >3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A | Back alignment and structure |
|---|
| >1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 | Back alignment and structure |
|---|
| >2lcm_A Voltage-dependent N-type calcium channel subunit; voltage sensor peptide, membrane protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A | Back alignment and structure |
|---|
| >2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A | Back alignment and structure |
|---|
| >3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C | Back alignment and structure |
|---|
| >2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A | Back alignment and structure |
|---|
| >1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A | Back alignment and structure |
|---|
| >1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2lcm_A Voltage-dependent N-type calcium channel subunit; voltage sensor peptide, membrane protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A | Back alignment and structure |
|---|
| >1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 | Back alignment and structure |
|---|
| >1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2kav_A Sodium channel protein type 2 subunit alpha; voltage-gated sodium channel, alternative splicing, disease epilepsy, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kbi_A | Back alignment and structure |
|---|
| >2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A | Back alignment and structure |
|---|
| >1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A | Back alignment and structure |
|---|
| >2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A | Back alignment and structure |
|---|
| >1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C | Back alignment and structure |
|---|
| >2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B | Back alignment and structure |
|---|
| >2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A | Back alignment and structure |
|---|
| >3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A | Back alignment and structure |
|---|
| >3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* | Back alignment and structure |
|---|
| >3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} | Back alignment and structure |
|---|
| >3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A | Back alignment and structure |
|---|
| >1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A | Back alignment and structure |
|---|
| >2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A | Back alignment and structure |
|---|
| >1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A | Back alignment and structure |
|---|
| >1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... | Back alignment and structure |
|---|
| >4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} | Back alignment and structure |
|---|
| >1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... | Back alignment and structure |
|---|
| >2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A | Back alignment and structure |
|---|
| >3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A | Back alignment and structure |
|---|
| >1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... | Back alignment and structure |
|---|
| >1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A | Back alignment and structure |
|---|
| >2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* | Back alignment and structure |
|---|
| >3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} | Back alignment and structure |
|---|
| >3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} | Back alignment and structure |
|---|
| >1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} | Back alignment and structure |
|---|
| >3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A | Back alignment and structure |
|---|
| >1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 | Back alignment and structure |
|---|
| >1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... | Back alignment and structure |
|---|
| >1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A | Back alignment and structure |
|---|
| >2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A | Back alignment and structure |
|---|
| >3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} | Back alignment and structure |
|---|
| >2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A | Back alignment and structure |
|---|
| >2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A | Back alignment and structure |
|---|
| >2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A | Back alignment and structure |
|---|
| >3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B | Back alignment and structure |
|---|
| >1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A | Back alignment and structure |
|---|
| >2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A | Back alignment and structure |
|---|
| >1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* | Back alignment and structure |
|---|
| >1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 | Back alignment and structure |
|---|
| >3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C | Back alignment and structure |
|---|
| >3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A | Back alignment and structure |
|---|
| >2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 | Back alignment and structure |
|---|
| >2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 701 | ||||
| d1oqpa_ | 77 | a.39.1.5 (A:) Caltractin (centrin 2) {Green algae | 2e-06 | |
| d1orsc_ | 132 | f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aer | 2e-06 | |
| d1rwya_ | 109 | a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta | 3e-06 | |
| d2pvba_ | 107 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 5e-06 | |
| d1pvaa_ | 109 | a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax | 5e-06 | |
| d2opoa1 | 81 | a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che | 6e-06 | |
| d5pala_ | 109 | a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis | 7e-06 | |
| d1rroa_ | 108 | a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) | 2e-05 | |
| d1fi5a_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), | 3e-05 | |
| d1c7va_ | 68 | a.39.1.5 (A:) Calcium vector protein {Amphioxus (B | 3e-05 | |
| d2fcea1 | 61 | a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ | 3e-05 | |
| d1s6ja_ | 87 | a.39.1.5 (A:) Calcium-dependent protein kinase sk5 | 8e-05 | |
| d1f54a_ | 77 | a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom | 1e-04 | |
| d1fw4a_ | 65 | a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: | 1e-04 | |
| d1ij5a_ | 321 | a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind | 1e-04 | |
| d2obha1 | 141 | a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien | 2e-04 | |
| d1topa_ | 162 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 2e-04 | |
| d2pq3a1 | 73 | a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T | 2e-04 | |
| d1avsa_ | 81 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 4e-04 | |
| d1dtla_ | 156 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 5e-04 | |
| d1zfsa1 | 93 | a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no | 0.001 | |
| d1yuta1 | 98 | a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa | 0.001 | |
| d1tiza_ | 67 | a.39.1.5 (A:) Calmodulin-related protein T21P5.17 | 0.002 | |
| d1jc2a_ | 75 | a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) | 0.002 | |
| d1a4pa_ | 92 | a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien | 0.002 | |
| d1qjta_ | 99 | a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: | 0.003 | |
| d3c1va1 | 93 | a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa | 0.003 |
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: EF Hand-like superfamily: EF-hand family: Calmodulin-like domain: Caltractin (centrin 2) species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
Score = 44.1 bits (104), Expect = 2e-06
Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 5/72 (6%)
Query: 335 DRMRRRTLGKAFNLIDNYNVGFLNKEQCIKLFEELNKYRTLPNISREEFELIFDELDDTH 394
+R R + KAF L D+ N G + + ++ +EL + N++ EE + + E D
Sbjct: 4 ERDSREEILKAFRLFDDDNSGTITIKDLRRVAKELGE-----NLTEEELQEMIAEADRND 58
Query: 395 DFKINLDEFADL 406
D +I+ DEF +
Sbjct: 59 DNEIDEDEFIRI 70
|
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 132 | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 | Back information, alignment and structure |
|---|
| >d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 701 | |||
| d1orsc_ | 132 | Potassium channel KVAP {Archaeon Aeropyrum pernix | 99.59 | |
| d1orsc_ | 132 | Potassium channel KVAP {Archaeon Aeropyrum pernix | 99.03 | |
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 97.93 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 97.09 | |
| d1wlza1 | 83 | DJ-1-binding protein, DJBP {Human (Homo sapiens) [ | 96.39 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 96.3 | |
| d1oqpa_ | 77 | Caltractin (centrin 2) {Green algae (Chlamydomonas | 96.27 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 96.25 | |
| d1fw4a_ | 65 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 96.2 | |
| d1tiza_ | 67 | Calmodulin-related protein T21P5.17 {Thale cress ( | 96.01 | |
| d1fi6a_ | 92 | Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | 95.91 | |
| d2fcea1 | 61 | Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | 95.86 | |
| d1jc2a_ | 75 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.82 | |
| d1c07a_ | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 95.79 | |
| d2pq3a1 | 73 | Calmodulin {Rattus norvegicus [TaxId: 10116]} | 95.76 | |
| d1avsa_ | 81 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 95.62 | |
| d1wrka1 | 82 | Troponin C {Human (Homo sapiens), cardiac isoform | 95.57 | |
| d1fi5a_ | 81 | Troponin C {Chicken (Gallus gallus), cardiac isofo | 95.54 | |
| d1f54a_ | 77 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 95.49 | |
| d1rroa_ | 108 | Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 | 95.4 | |
| d5pala_ | 109 | Parvalbumin {Leopard shark (Triakis semifasciata) | 95.36 | |
| d2pvba_ | 107 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 95.32 | |
| d1c7va_ | 68 | Calcium vector protein {Amphioxus (Branchiostoma l | 95.32 | |
| d1qv0a_ | 189 | Calcium-regulated photoprotein {Hydrozoa (Obelia l | 95.32 | |
| d2opoa1 | 81 | Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta | 95.3 | |
| d1rwya_ | 109 | Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | 95.26 | |
| d1pvaa_ | 109 | Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | 94.87 | |
| d2jxca1 | 95 | Eps15 {Human (Homo sapiens) [TaxId: 9606]} | 94.74 | |
| d1uhka1 | 187 | Calcium-regulated photoprotein {Jellyfish (Aequore | 94.67 | |
| d1zfsa1 | 93 | Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 | 93.96 | |
| d1iq3a_ | 110 | Pob1 {Human (Homo sapiens) [TaxId: 9606]} | 93.87 | |
| d1topa_ | 162 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 93.31 | |
| d1a4pa_ | 92 | Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 | 93.25 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 93.16 | |
| d1s6ja_ | 87 | Calcium-dependent protein kinase sk5 CLD {Soybean | 93.08 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 92.89 | |
| d1qjta_ | 99 | Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | 92.87 | |
| d1qx2a_ | 76 | Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | 92.57 | |
| d2mysc_ | 145 | Myosin Regulatory Chain {Chicken (Gallus gallus) [ | 92.56 | |
| d1xo5a_ | 180 | Calcium- and integrin-binding protein, CIB {Human | 92.5 | |
| d1lkja_ | 146 | Calmodulin {Baker's yeast (Saccharomyces cerevisia | 92.45 | |
| d2sasa_ | 185 | Sarcoplasmic calcium-binding protein {Amphioxus (B | 92.3 | |
| d3c1va1 | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta | 91.42 | |
| d1dtla_ | 156 | Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | 91.42 | |
| d1m45a_ | 146 | Myosin Light Chain Mlc1p {Baker's yeast (Saccharom | 90.88 | |
| d1ksoa_ | 93 | Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta | 90.74 | |
| d1nyaa_ | 176 | Calerythrin {Saccharopolyspora erythraea [TaxId: 1 | 90.4 | |
| d2mysb_ | 145 | Myosin Essential Chain {Chicken (Gallus gallus) [T | 90.25 | |
| d1ggwa_ | 140 | Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ | 89.75 | |
| d1y1xa_ | 182 | Programmed cell death 6 protein-like protein {Leis | 88.85 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 88.61 | |
| d2scpa_ | 174 | Sarcoplasmic calcium-binding protein {Sandworm (Ne | 88.56 | |
| d1g8ia_ | 187 | Frequenin (neuronal calcium sensor 1) {Human (Homo | 88.3 | |
| d1w7jb1 | 139 | Myosin Essential Chain {Human (Homo sapiens) [TaxI | 88.24 | |
| d1yuta1 | 98 | Calcyclin (S100) {Human (Homo sapiens), s100a13 [T | 87.48 | |
| d1exra_ | 146 | Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI | 86.94 | |
| d2obha1 | 141 | Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | 86.6 | |
| d1cb1a_ | 78 | Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | 86.38 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 86.19 | |
| d1bjfa_ | 181 | Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | 85.94 | |
| d1snla_ | 99 | Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax | 84.63 | |
| d1fpwa_ | 190 | Frequenin (neuronal calcium sensor 1) {Baker's yea | 84.46 | |
| d1auib_ | 165 | Calcineurin regulatory subunit (B-chain) {Human (H | 84.26 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 83.13 | |
| d1e8aa_ | 87 | Calcyclin (S100) {Human (Homo sapiens), calgranuli | 82.05 | |
| d1jfja_ | 134 | EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: | 81.98 | |
| d1xk4c1 | 83 | Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr | 81.54 | |
| d1wdcb_ | 142 | Myosin Essential Chain {Bay scallop (Aequipecten i | 81.19 | |
| d3cr5x1 | 90 | Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: | 81.1 | |
| d1s6ca_ | 178 | Kchip1, Kv4 potassium channel-interacting protein | 80.85 | |
| d2zfda1 | 183 | Calcineurin B-like protein 2 {Thale cress (Arabido | 80.54 | |
| d1hqva_ | 181 | Apoptosis-linked protein alg-2 {Mouse (Mus musculu | 80.23 |
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel KVAP species: Archaeon Aeropyrum pernix [TaxId: 56636]
Probab=99.59 E-value=3.2e-15 Score=134.36 Aligned_cols=129 Identities=15% Similarity=0.169 Sum_probs=108.9
Q ss_pred cccchhHHHHHHHHHHHHHHHHHHhhccccccchhhhHHHHHHHHHHHHHHHHHHHHHhhcCcccccccCcCcchhHHHH
Q 005350 441 FIRSTKFGYMISIILIVNLVAVIVETTLDIQESSLQSVWQEVEFVFGWIYVLEMALKIYSYGFENYWRDGQNRFDFLVTW 520 (701)
Q Consensus 441 iv~~~~f~~~i~~~Illn~i~l~~~~~~~~~~~~~~~~~~~i~~~f~~iF~~E~ilKi~a~G~~~y~~~~wn~fD~ivv~ 520 (701)
+++||.|+.++..++++|++.+++|+.++ .++.....+.++|.+++++|++|+++|+++.|. +|....||++|++.++
T Consensus 2 ~i~~p~~e~~i~~lillnvi~~~let~~~-~~~~~~~~l~~~e~v~~~iF~~E~~lrl~~~~~-~~~~~~~~~iDl~ai~ 79 (132)
T d1orsc_ 2 VMEHPLVELGVSYAALLSVIVVVVEYTMQ-LSGEYLVRLYLVDLILVIILWADYAYRAYKSGD-PAGYVKKTLYEIPALV 79 (132)
T ss_dssp CCCCHHHHHHHHHHHHHHHHHHHHHHHSC-CCSHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-TTTTTTTCGGGTGGGS
T ss_pred cccchHHHHHHHHHHHHHHHHHHHHhccc-cchhhhHHHHHHHHHHHHHHHHHHHHHHHhCCc-cceeCCcchHHHHHHH
Confidence 68999999999999999999999998643 244566788999999999999999999999984 5666789999999887
Q ss_pred HHHHHHHHHhcCCCCccccchhhHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHhhHH
Q 005350 521 VIVIGETITLASPNGQTFLSNGEWIRYLLLARMLRLIRLLMHVQQYRGFVATFLTLIPSLM 581 (701)
Q Consensus 521 ~s~i~~i~~~~~~~~~~~~~~~~~l~~lr~~RvlRllrli~~~~~lr~l~~tl~~~~~~l~ 581 (701)
.+++...... ....+|++|++|++|++|+++..++++.+.+++.++.+++.
T Consensus 80 p~~~~~~~~~----------~~~~lr~lR~~R~~R~lrl~~~~~~~~~ll~ai~~s~~~lv 130 (132)
T d1orsc_ 80 PAGLLALIEG----------HLAGLGLFRLVRLLRFLRILLIISRGSKFLSAIADAADKLV 130 (132)
T ss_dssp CHHHHHHHHH----------HHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHS
T ss_pred HHHHHHhhhh----------hHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence 7666544321 23467889999999999999999999999999999998764
|
| >d1orsc_ f.14.1.1 (C:) Potassium channel KVAP {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} | Back information, alignment and structure |
|---|
| >d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} | Back information, alignment and structure |
|---|
| >d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} | Back information, alignment and structure |
|---|
| >d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} | Back information, alignment and structure |
|---|
| >d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} | Back information, alignment and structure |
|---|
| >d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} | Back information, alignment and structure |
|---|
| >d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} | Back information, alignment and structure |
|---|
| >d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} | Back information, alignment and structure |
|---|
| >d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} | Back information, alignment and structure |
|---|
| >d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|