Citrus Sinensis ID: 005381


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHcccccccccccEEEcccccccccccccccccccccccEEEEEEECcccccccccccccEEEcccccccccccccccccccccEEEEEEEccccccHHHcccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccccccccc
********************AEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEND**PDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYN********ISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 538-694
View the alignment between query and template
View the model in PyMOL
Template: 1H6U, chain A
Confidence level:very confident
Coverage over the Query: 481-499,517-645,658-694
View the alignment between query and template
View the model in PyMOL
Template: 3DSS, chain A
Confidence level:very confident
Coverage over the Query: 12-236,321-333,354,396,428-512
View the alignment between query and template
View the model in PyMOL
Template: 1DCE, chain A
Confidence level:very confident
Coverage over the Query: 2-244,260-261,273-361,381-619,656-694
View the alignment between query and template
View the model in PyMOL
Template: 1DCE, chain A
Confidence level:very confident
Coverage over the Query: 41-74,85-250,274-337,371-378,390-466,478-499,517-618
View the alignment between query and template
View the model in PyMOL
Template: 1LTX, chain A
Confidence level:confident
Coverage over the Query: 23-288,313-357,368-528,544-570
View the alignment between query and template
View the model in PyMOL