Citrus Sinensis ID: 005381
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| 224092154 | 696 | predicted protein [Populus trichocarpa] | 0.992 | 0.997 | 0.663 | 0.0 | |
| 225459067 | 704 | PREDICTED: uncharacterized protein LOC10 | 1.0 | 0.992 | 0.677 | 0.0 | |
| 255545992 | 696 | protein with unknown function [Ricinus c | 0.992 | 0.997 | 0.663 | 0.0 | |
| 356515736 | 691 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.997 | 0.597 | 0.0 | |
| 356510126 | 691 | PREDICTED: uncharacterized protein LOC10 | 0.985 | 0.997 | 0.602 | 0.0 | |
| 357465223 | 705 | Geranylgeranyl transferase type-2 subuni | 0.978 | 0.970 | 0.573 | 0.0 | |
| 449433595 | 695 | PREDICTED: geranylgeranyl transferase ty | 0.979 | 0.985 | 0.592 | 0.0 | |
| 297799558 | 677 | protein binding protein [Arabidopsis lyr | 0.959 | 0.991 | 0.572 | 0.0 | |
| 79485405 | 678 | RAB geranylgeranyl transferase alpha sub | 0.964 | 0.994 | 0.566 | 0.0 | |
| 7269299 | 661 | Rab geranylgeranyl transferase like prot | 0.938 | 0.992 | 0.565 | 0.0 |
| >gi|224092154|ref|XP_002309487.1| predicted protein [Populus trichocarpa] gi|222855463|gb|EEE93010.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 936 bits (2420), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 465/701 (66%), Positives = 558/701 (79%), Gaps = 7/701 (0%)
Query: 1 MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
MHGRPRK KPED AAS AKAEKLR+LQSQFL NHH IY+KEA+ELS+KLLE NPE YT
Sbjct: 1 MHGRPRKAPKPEDLAASTAKAEKLRILQSQFLLNHHQKIYTKEALELSSKLLEINPECYT 60
Query: 61 AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS 120
AWNYRK AVQH L E++ DPDS+ SILD+ELRVVE+ALRQNFKSYGAW+HRKW+L+KGHS
Sbjct: 61 AWNYRKHAVQHSLFESNLDPDSVNSILDQELRVVENALRQNFKSYGAWYHRKWVLNKGHS 120
Query: 121 SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHN 180
S +NELRLLDK Q D RNFHAWNYRRFVAA +NRS+EDEL +T+D I NFSNYSAWHN
Sbjct: 121 STENELRLLDKLQNVDPRNFHAWNYRRFVAALLNRSDEDELNHTQDFIDKNFSNYSAWHN 180
Query: 181 RSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSP 240
RS+L+SNL+K+KV+ F K++VL EYE V +A+FTD DDQSGWFYHLWLLDQTV+ +SP
Sbjct: 181 RSVLVSNLMKKKVQAFSRKDEVLIREYELVREAVFTDEDDQSGWFYHLWLLDQTVKAESP 240
Query: 241 QLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVD 300
L SSWP GS++ L GDR LD +SSPF DS + PL+LYFNQAVEGVN+ST+TV
Sbjct: 241 LLASSWPAHGSEITLSGDRYLDLGSSSPFNTNQFDSGSLPLILYFNQAVEGVNASTVTVS 300
Query: 301 SELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGF 360
S LN N D++WKP+ S NS+ QVWV QL P+ S + +EV+LGHSQGIISSSGF
Sbjct: 301 SGLNVNMDVIWKPILSNNSRTTQVWVGQLKFPEVELDSLGAYTMEVTLGHSQGIISSSGF 360
Query: 361 HYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKN 420
HYS+P F+F V + +T+PVE LG E ISWRDE+FH Y + S +S+ + L LSIKN
Sbjct: 361 HYSHPSHFSFTVHVLPAKTEPVEGLGSEKISWRDENFHIYESDSLESNSVLPLDHLSIKN 420
Query: 421 DNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEE 480
+ E T W+A I +EI +FRELL +CKIGKLTLARLL A DA+M ++K HSEE
Sbjct: 421 EREPTHSSWQAKIIDEEISNFRELL---DCKIGKLTLARLLTARDALMS--SDKPVHSEE 475
Query: 481 VLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSN-SPSNRGSPMCLQ 539
VL LY++LM+LDP H ++YKD+HSLVLL++V S ESLLS CF Y N + S+ +P+CL+
Sbjct: 476 VLRLYSELMKLDPPHSRFYKDEHSLVLLEKVISGRESLLSYCFRYRNLTSSSSSNPICLR 535
Query: 540 LKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIR 599
L LSLSRLGSF+KLLWVQMLDLSHNEL+SIEGLEA+QLLS LNLS N GSFT+LEP+R
Sbjct: 536 LNGLSLSRLGSFEKLLWVQMLDLSHNELQSIEGLEAMQLLSHLNLSKNKFGSFTSLEPLR 595
Query: 600 QLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDD-DIKSYWEAYFI 658
LKS++ L++SYNEIG+HSIDTT+YLCSSPL HSVGSEW+ +TV D + SYWEA+FI
Sbjct: 596 HLKSMKVLDLSYNEIGSHSIDTTRYLCSSPLCHSVGSEWDGSETVTDGVSLVSYWEAFFI 655
Query: 659 LKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH 699
L+GL LTQ DI GNAI +EKF +FL KVLP LKWLDG QL+
Sbjct: 656 LRGLKLTQIDIAGNAIADEKFTAFLAKVLPALKWLDGVQLN 696
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225459067|ref|XP_002283768.1| PREDICTED: uncharacterized protein LOC100248920 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255545992|ref|XP_002514056.1| protein with unknown function [Ricinus communis] gi|223547142|gb|EEF48639.1| protein with unknown function [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356515736|ref|XP_003526554.1| PREDICTED: uncharacterized protein LOC100783193 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356510126|ref|XP_003523791.1| PREDICTED: uncharacterized protein LOC100807900 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357465223|ref|XP_003602893.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] gi|355491941|gb|AES73144.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|449433595|ref|XP_004134583.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] gi|449490592|ref|XP_004158649.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297799558|ref|XP_002867663.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297313499|gb|EFH43922.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|79485405|ref|NP_194180.2| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|145334125|ref|NP_001078443.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|18176361|gb|AAL60030.1| putative Rab geranylgeranyl transferase [Arabidopsis thaliana] gi|21436465|gb|AAM51433.1| putative rab geranylgeranyl transferase [Arabidopsis thaliana] gi|332659513|gb|AEE84913.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|332659514|gb|AEE84914.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|7269299|emb|CAB79359.1| Rab geranylgeranyl transferase like protein (fragment) [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 699 | ||||||
| TAIR|locus:2153015 | 687 | RGTA2 "RAB geranylgeranyl tran | 0.944 | 0.960 | 0.473 | 5e-147 | |
| TAIR|locus:2121860 | 678 | RGTA1 "RAB geranylgeranyl tran | 0.792 | 0.817 | 0.467 | 2e-127 | |
| RGD|621697 | 567 | Rabggta "Rab geranylgeranyltra | 0.391 | 0.483 | 0.369 | 1.7e-45 | |
| MGI|MGI:1860443 | 567 | Rabggta "Rab geranylgeranyl tr | 0.327 | 0.403 | 0.403 | 1.5e-44 | |
| UNIPROTKB|Q5EA80 | 567 | RABGGTA "Geranylgeranyl transf | 0.327 | 0.403 | 0.394 | 7.2e-41 | |
| UNIPROTKB|F1PIE1 | 567 | RABGGTA "Uncharacterized prote | 0.327 | 0.403 | 0.394 | 1.2e-40 | |
| UNIPROTKB|Q92696 | 567 | RABGGTA "Geranylgeranyl transf | 0.327 | 0.403 | 0.390 | 1.5e-40 | |
| UNIPROTKB|A5A779 | 567 | RABGGTA "Geranylgeranyl transf | 0.327 | 0.403 | 0.386 | 2.5e-39 | |
| DICTYBASE|DDB_G0269570 | 311 | rabggta "protein geranylgerany | 0.277 | 0.623 | 0.383 | 6.7e-38 | |
| ZFIN|ZDB-GENE-060929-1042 | 580 | rabggta "Rab geranylgeranyltra | 0.253 | 0.305 | 0.353 | 8.7e-38 |
| TAIR|locus:2153015 RGTA2 "RAB geranylgeranyl transferase alpha subunit 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1436 (510.6 bits), Expect = 5.0e-147, P = 5.0e-147
Identities = 342/723 (47%), Positives = 452/723 (62%)
Query: 1 MHGRPRKPLKPEDXXXXXXXXEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
MHGR R+ P E LR LQSQF+ NHH IY+KEA++LS KLL TNPE YT
Sbjct: 1 MHGRKREE-DPNPEETAAKALE-LRSLQSQFMSNHHQKIYTKEAIQLSAKLLITNPEFYT 58
Query: 61 AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSK-GH 119
AWNY KLA + +L E DSDP + SI+DEEL VV++AL +N KSYGAW+HRKW+LSK GH
Sbjct: 59 AWNYPKLAFESRLDE-DSDPSLVNSIIDEELGVVQNALERNVKSYGAWYHRKWVLSKKGH 117
Query: 120 --SSIDNELRLLDKFQKA-----D-------SRNFHAWNYRRFVAASMNRSEEDELKYTE 165
S++NEL+LL+ +QK D SRNFHAWNYRRFV SEEDEL+YT
Sbjct: 118 YYPSLENELQLLNDYQKQAHQKQDDEKQDDPSRNFHAWNYRRFVVELTKTSEEDELQYTT 177
Query: 166 DMICN-NFSNYSAWHXXXXXXXXXXXXXVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGW 224
DMI + +F+ YSAWH +GF+ KE + E ++VH AIFT + QSGW
Sbjct: 178 DMISDISFTIYSAWHYRSVLVSSLVAKKADGFMPKETIRR-ELDYVHSAIFTLEEKQSGW 236
Query: 225 FYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSP-FTRFHLDSRTFPLVL 283
FY+LWLLDQTV+++ P SSWP+ GS +IL G C + +S+ T F +S +FPL+L
Sbjct: 237 FYYLWLLDQTVKMEIPLRFSSWPSDGSIIILSGPDCFNASSSTTKLTTFCSESGSFPLIL 296
Query: 284 YFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSC-NSKAAQ-VWVTQLNLPDGNT-HSSK 340
YF+QAV GV+SST+T+ SEL KDLVW+P+S NS+ VWV +L S K
Sbjct: 297 YFDQAVSGVSSSTVTIGSEL---KDLVWEPVSDKKNSQVDSCVWVARLKFDCREPCFSRK 353
Query: 341 VFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKE-IISWRDESFHN 399
V+VSLG GI+SS G + + P+ F F +L+ +T VE +E I+SW D F N
Sbjct: 354 ETKVKVSLG---GIVSSMGCNLTAPYEFVF--TLRIHDTVEVELSQQESIVSWTD-GFDN 407
Query: 400 YNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLAR 459
++ ++ S+ ++SL L N T FEWR I EI+ FR +L + KIGKL LAR
Sbjct: 408 WDDNAL-SNDLNSLTAL-----NADTGFEWRKKAIKIEIELFR---TLPDSKIGKLILAR 458
Query: 460 LLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLL 519
LLMA + M+ +N + H +E+L+LYNDLM LD H QYYKD+HS+ L+ +VTS ES+
Sbjct: 459 LLMAEETMI---SNGV-HYKEILQLYNDLMALDSWHNQYYKDEHSVALIHKVTSRTESMS 514
Query: 520 SRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGXXXXXXX 579
F Y N + +CL+L NL+LSR+ + +KLL+VQMLDLSHNEL S EG
Sbjct: 515 RHLFRYRNM----NNIICLRLNNLTLSRIAAVEKLLFVQMLDLSHNELHSAEGLEAMQLL 570
Query: 580 XXXXXXXXXXXXFTALEPIRQLKSLRALNISYNEI-GAHSIDTTKYLCSSPLSHSVGSEW 638
F+AL+ +R LK LR L++S+N I G +DTT+YLCSSPLS+S
Sbjct: 571 CCLNLSHNRIRSFSALDSLRHLKQLRVLDVSHNHICGELPVDTTRYLCSSPLSNS----- 625
Query: 639 NHGQTVIDDDIKSYWEAYFILKGL-NLTQFDIVGNAIV--NEKFKSFLIKVLPGLKWLDG 695
G+T + K Y +AY +L+ L L Q DI GN ++ E+F SF+ +V+P L WLDG
Sbjct: 626 --GETGREVPNK-YQDAYLVLRDLMKLKQLDIRGNDLIFAGEEFSSFVRQVVPKLVWLDG 682
Query: 696 EQL 698
+L
Sbjct: 683 HKL 685
|
|
| TAIR|locus:2121860 RGTA1 "RAB geranylgeranyl transferase alpha subunit 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| RGD|621697 Rabggta "Rab geranylgeranyltransferase, alpha subunit" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1860443 Rabggta "Rab geranylgeranyl transferase, a subunit" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5EA80 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIE1 RABGGTA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92696 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5A779 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0269570 rabggta "protein geranylgeranyltransferase type II" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060929-1042 rabggta "Rab geranylgeranyltransferase, alpha subunit" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| eugene3.00061586 | hypothetical protein (696 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| COG5536 | 328 | COG5536, BET4, Protein prenyltransferase, alpha su | 2e-44 | |
| PLN02789 | 320 | PLN02789, PLN02789, farnesyltranstransferase | 5e-24 | |
| pfam01239 | 30 | pfam01239, PPTA, Protein prenyltransferase alpha s | 1e-05 | |
| pfam01239 | 30 | pfam01239, PPTA, Protein prenyltransferase alpha s | 7e-05 | |
| pfam01239 | 30 | pfam01239, PPTA, Protein prenyltransferase alpha s | 2e-04 | |
| pfam01239 | 30 | pfam01239, PPTA, Protein prenyltransferase alpha s | 6e-04 | |
| COG5536 | 328 | COG5536, BET4, Protein prenyltransferase, alpha su | 7e-04 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 7e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.002 |
| >gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Score = 161 bits (409), Expect = 2e-44
Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 13/200 (6%)
Query: 39 IYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESAL 98
YS A++L+ +L++ NPE YT WNYR ++H ++ +LD EL ++ AL
Sbjct: 46 EYSVRALKLTQELIDKNPEFYTIWNYRFSILKHVQMVSEDKEH----LLDNELDFLDEAL 101
Query: 99 RQNFKSYGAWHHRKWILSK-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSE 157
+ N K+Y WHHR+W+L S EL + K +DSRN+H W+YRR+V ++
Sbjct: 102 KDNPKNYQIWHHRQWMLELFPKPSWGRELFITKKLLDSDSRNYHVWSYRRWVLRTIEDLF 161
Query: 158 -----EDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQ 212
+ EL+YT +I + N SAWH+R + + R G V +K L E E++
Sbjct: 162 NFSDLKHELEYTTSLIETDIYNNSAWHHRYIWIERRFNR---GDVISQKYLEKELEYIFD 218
Query: 213 AIFTDPDDQSGWFYHLWLLD 232
IFTDPD+QS W Y +
Sbjct: 219 KIFTDPDNQSVWGYLRGVSS 238
|
Length = 328 |
| >gnl|CDD|215423 PLN02789, PLN02789, farnesyltranstransferase | Back alignment and domain information |
|---|
| >gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat | Back alignment and domain information |
|---|
| >gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 100.0 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 100.0 | |
| COG5536 | 328 | BET4 Protein prenyltransferase, alpha subunit [Pos | 100.0 | |
| PLN02789 | 320 | farnesyltranstransferase | 100.0 | |
| PLN02789 | 320 | farnesyltranstransferase | 99.94 | |
| KOG0529 | 421 | consensus Protein geranylgeranyltransferase type I | 99.91 | |
| KOG0530 | 318 | consensus Protein farnesyltransferase, alpha subun | 99.86 | |
| COG5536 | 328 | BET4 Protein prenyltransferase, alpha subunit [Pos | 99.72 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.57 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.53 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.49 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.43 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.41 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.3 | |
| TIGR00990 | 615 | 3a0801s09 mitochondrial precursor proteins import | 99.29 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.26 | |
| PF07711 | 102 | RabGGT_insert: Rab geranylgeranyl transferase alph | 99.22 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.21 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 99.17 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.16 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.13 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.13 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.1 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.08 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.07 | |
| PRK11189 | 296 | lipoprotein NlpI; Provisional | 99.06 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.02 | |
| PRK12370 | 553 | invasion protein regulator; Provisional | 99.01 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.01 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.0 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.95 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.94 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.94 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.93 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.91 | |
| KOG1126 | 638 | consensus DNA-binding cell division cycle control | 98.91 | |
| KOG4626 | 966 | consensus O-linked N-acetylglucosamine transferase | 98.89 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 98.88 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.86 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.85 | |
| PRK15174 | 656 | Vi polysaccharide export protein VexE; Provisional | 98.83 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.82 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.76 | |
| TIGR02917 | 899 | PEP_TPR_lipo putative PEP-CTERM system TPR-repeat | 98.75 | |
| PRK09782 | 987 | bacteriophage N4 receptor, outer membrane subunit; | 98.74 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.71 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.67 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.65 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.65 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.65 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.65 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.64 | |
| PRK10370 | 198 | formate-dependent nitrite reductase complex subuni | 98.62 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.62 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 98.62 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 98.61 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.59 | |
| PF01239 | 31 | PPTA: Protein prenyltransferase alpha subunit repe | 98.57 | |
| PRK11447 | 1157 | cellulose synthase subunit BcsC; Provisional | 98.56 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 98.54 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.53 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.53 | |
| PRK15179 | 694 | Vi polysaccharide biosynthesis protein TviE; Provi | 98.52 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.52 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 98.51 | |
| PF01239 | 31 | PPTA: Protein prenyltransferase alpha subunit repe | 98.5 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.5 | |
| KOG1155 | 559 | consensus Anaphase-promoting complex (APC), Cdc23 | 98.5 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 98.48 | |
| TIGR02521 | 234 | type_IV_pilW type IV pilus biogenesis/stability pr | 98.47 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.47 | |
| KOG0553 | 304 | consensus TPR repeat-containing protein [General f | 98.47 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 98.46 | |
| PRK11788 | 389 | tetratricopeptide repeat protein; Provisional | 98.45 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.45 | |
| KOG0547 | 606 | consensus Translocase of outer mitochondrial membr | 98.44 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.39 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.32 | |
| TIGR03302 | 235 | OM_YfiO outer membrane assembly lipoprotein YfiO. | 98.31 | |
| PF13429 | 280 | TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 | 98.29 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.28 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 98.28 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.27 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 98.27 | |
| PRK10049 | 765 | pgaA outer membrane protein PgaA; Provisional | 98.26 | |
| COG3063 | 250 | PilF Tfp pilus assembly protein PilF [Cell motilit | 98.25 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 98.21 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.21 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 98.19 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.18 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 98.16 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.16 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.14 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.14 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.13 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 98.13 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 98.13 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 98.12 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.11 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 98.09 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.09 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 98.06 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.06 | |
| KOG0548 | 539 | consensus Molecular co-chaperone STI1 [Posttransla | 98.03 | |
| KOG3060 | 289 | consensus Uncharacterized conserved protein [Funct | 97.96 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 97.93 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.92 | |
| KOG2076 | 895 | consensus RNA polymerase III transcription factor | 97.89 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 97.81 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 97.8 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.8 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.8 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 97.78 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.74 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.74 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 97.72 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.7 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 97.7 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.7 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 97.69 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 97.67 | |
| PRK02603 | 172 | photosystem I assembly protein Ycf3; Provisional | 97.65 | |
| cd05804 | 355 | StaR_like StaR_like; a well-conserved protein foun | 97.64 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.63 | |
| PRK11906 | 458 | transcriptional regulator; Provisional | 97.6 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.59 | |
| KOG0624 | 504 | consensus dsRNA-activated protein kinase inhibitor | 97.58 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.58 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 97.58 | |
| KOG1125 | 579 | consensus TPR repeat-containing protein [General f | 97.56 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.55 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.52 | |
| KOG4162 | 799 | consensus Predicted calmodulin-binding protein [Si | 97.47 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.47 | |
| PRK14574 | 822 | hmsH outer membrane protein; Provisional | 97.47 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.46 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.41 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 97.39 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 97.39 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.38 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 97.33 | |
| PRK15363 | 157 | pathogenicity island 2 chaperone protein SscA; Pro | 97.29 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 97.24 | |
| CHL00033 | 168 | ycf3 photosystem I assembly protein Ycf3 | 97.23 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.23 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 97.22 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 97.22 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 97.19 | |
| KOG1156 | 700 | consensus N-terminal acetyltransferase [Chromatin | 97.19 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 97.16 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 97.12 | |
| PRK10153 | 517 | DNA-binding transcriptional activator CadC; Provis | 97.11 | |
| COG4783 | 484 | Putative Zn-dependent protease, contains TPR repea | 97.01 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 97.0 | |
| PLN03098 | 453 | LPA1 LOW PSII ACCUMULATION1; Provisional | 96.92 | |
| KOG2002 | 1018 | consensus TPR-containing nuclear phosphoprotein th | 96.91 | |
| KOG0550 | 486 | consensus Molecular chaperone (DnaJ superfamily) [ | 96.9 | |
| KOG1127 | 1238 | consensus TPR repeat-containing protein [RNA proce | 96.89 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 96.87 | |
| KOG1173 | 611 | consensus Anaphase-promoting complex (APC), Cdc16 | 96.84 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.83 | |
| TIGR00540 | 409 | hemY_coli hemY protein. This is an uncharacterized | 96.79 | |
| PRK14720 | 906 | transcript cleavage factor/unknown domain fusion p | 96.75 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.75 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.74 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 96.7 | |
| KOG4234 | 271 | consensus TPR repeat-containing protein [General f | 96.69 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.66 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.64 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 96.64 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 96.55 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 96.55 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 96.51 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 96.5 | |
| KOG1174 | 564 | consensus Anaphase-promoting complex (APC), subuni | 96.47 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 96.43 | |
| PRK10747 | 398 | putative protoheme IX biogenesis protein; Provisio | 96.26 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 96.19 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 96.14 | |
| PRK10803 | 263 | tol-pal system protein YbgF; Provisional | 96.14 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 96.11 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 96.04 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.02 | |
| KOG0543 | 397 | consensus FKBP-type peptidyl-prolyl cis-trans isom | 96.01 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.98 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 95.91 | |
| PF06552 | 186 | TOM20_plant: Plant specific mitochondrial import r | 95.91 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.89 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 95.89 | |
| COG5010 | 257 | TadD Flp pilus assembly protein TadD, contains TPR | 95.81 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 95.78 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 95.67 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.66 | |
| COG0457 | 291 | NrfG FOG: TPR repeat [General function prediction | 95.66 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 95.61 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 95.46 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 95.44 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 95.3 | |
| KOG0495 | 913 | consensus HAT repeat protein [RNA processing and m | 95.18 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 95.15 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.1 | |
| COG4235 | 287 | Cytochrome c biogenesis factor [Posttranslational | 94.94 | |
| KOG1128 | 777 | consensus Uncharacterized conserved protein, conta | 94.85 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 94.73 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 94.66 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.6 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 94.38 | |
| PF09295 | 395 | ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter | 94.37 | |
| PF13431 | 34 | TPR_17: Tetratricopeptide repeat | 94.3 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 94.28 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 94.22 | |
| KOG2003 | 840 | consensus TPR repeat-containing protein [General f | 94.21 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 94.17 | |
| KOG1308 | 377 | consensus Hsp70-interacting protein Hip/Transient | 94.12 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 93.77 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 93.69 | |
| COG4785 | 297 | NlpI Lipoprotein NlpI, contains TPR repeats [Gener | 93.33 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 93.31 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 93.15 | |
| PF12688 | 120 | TPR_5: Tetratrico peptide repeat | 93.06 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 92.91 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 92.69 | |
| KOG2376 | 652 | consensus Signal recognition particle, subunit Srp | 92.49 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 92.45 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 92.12 | |
| KOG4648 | 536 | consensus Uncharacterized conserved protein, conta | 92.12 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 91.91 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.61 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 91.57 | |
| KOG1840 | 508 | consensus Kinesin light chain [Cytoskeleton] | 91.37 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 91.07 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 90.68 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 90.68 | |
| PRK15331 | 165 | chaperone protein SicA; Provisional | 90.36 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 90.25 | |
| KOG4555 | 175 | consensus TPR repeat-containing protein [Function | 90.12 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 90.04 | |
| KOG0376 | 476 | consensus Serine-threonine phosphatase 2A, catalyt | 89.69 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 89.3 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 89.17 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 89.15 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 89.06 | |
| COG2956 | 389 | Predicted N-acetylglucosaminyl transferase [Carboh | 88.43 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 88.43 | |
| PF04184 | 539 | ST7: ST7 protein; InterPro: IPR007311 The ST7 (for | 88.17 | |
| PF12569 | 517 | NARP1: NMDA receptor-regulated protein 1 ; InterPr | 87.64 | |
| KOG4642 | 284 | consensus Chaperone-dependent E3 ubiquitin protein | 87.48 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 87.25 | |
| KOG1310 | 758 | consensus WD40 repeat protein [General function pr | 87.0 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 86.06 | |
| PLN03077 | 857 | Protein ECB2; Provisional | 85.83 | |
| KOG1129 | 478 | consensus TPR repeat-containing protein [General f | 85.67 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 84.91 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 84.89 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 84.8 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 84.8 | |
| KOG2053 | 932 | consensus Mitochondrial inheritance and actin cyto | 84.8 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 84.66 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 83.29 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 83.11 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 82.81 | |
| PRK10941 | 269 | hypothetical protein; Provisional | 82.46 | |
| PF13525 | 203 | YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M | 82.11 | |
| PLN03218 | 1060 | maturation of RBCL 1; Provisional | 81.98 | |
| PRK10866 | 243 | outer membrane biogenesis protein BamD; Provisiona | 81.87 | |
| PLN03081 | 697 | pentatricopeptide (PPR) repeat-containing protein; | 81.21 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 81.1 | |
| PF13512 | 142 | TPR_18: Tetratricopeptide repeat | 80.68 | |
| PF08424 | 321 | NRDE-2: NRDE-2, necessary for RNA interference; In | 80.46 |
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.4e-64 Score=523.78 Aligned_cols=409 Identities=44% Similarity=0.698 Sum_probs=320.5
Q ss_pred CCCCcCC-CCChHHHHH---HHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccC
Q 005381 1 MHGRPRK-PLKPEDAAA---SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN 76 (699)
Q Consensus 1 mhg~~~~-~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~ 76 (699)
||||+|+ ++++|.+++ +.+++..|+..+++|..+++.++||+++++++.++|..||++|++||||+.++.......
T Consensus 1 Mhg~~kv~~~eee~~~k~~~~~~k~~~~~~~~s~i~~~r~~~~yd~e~l~lt~~ll~~npe~~t~wN~Rr~~~~~r~~~~ 80 (421)
T KOG0529|consen 1 MHGRLKVKTTEEEKEAKLKERAFKAGQLRSLFSIIQKKREAKEYDEEHLELTSELLEKNPEFYTVWNYRRLIIEERLTRA 80 (421)
T ss_pred CCcccccCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhccccchHHHHHHHHHHhhCchhhhhhhhHHHHHHHhhhhh
Confidence 9999998 556666664 466688888889999999999999999999999999999999999999999998876534
Q ss_pred CCCchhhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCCC-ChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCC
Q 005381 77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS-SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR 155 (699)
Q Consensus 77 ~~~~~~~~~~~~eEL~~~~~~L~~nPKsy~aW~hR~w~L~~~~~-~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~ 155 (699)
+.+|.+.+..+++||.+++.||+.|||+|.+||||+|+|++.+. .+..||.+|+++|+.||||||||+|||||+.+..+
T Consensus 81 ~~~~~ek~~~ld~eL~~~~~~L~~npksY~aW~hR~w~L~~~p~~~~~~EL~lcek~L~~D~RNfh~W~YRRfV~~~~~~ 160 (421)
T KOG0529|consen 81 QLEPLEKQALLDEELKYVESALKVNPKSYGAWHHRKWVLQKNPHSDWNTELQLCEKALKQDPRNFHAWHYRRFVVEQAER 160 (421)
T ss_pred cCCHHHHHHhhHHHHHHHHHHHHhCchhHHHHHHHHHHHHhCCCchHHHHHHHHHHHHhcCcccccchHHHHHHHHHHhc
Confidence 56677888899999999999999999999999999999997654 49999999999999999999999999999999988
Q ss_pred C---hHHHHHHHHHHHHhccCchHHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHc
Q 005381 156 S---EEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLD 232 (699)
Q Consensus 156 ~---~e~EL~~~~~~I~~n~sN~SAW~~R~~ll~~l~~~~~~~~~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~ 232 (699)
. +.+|++||+++|..||+||||||||+.+|+.+.+++..|.....+.+..|++.+++|+|+||+|+|+|+|++|||+
T Consensus 161 ~~~~~~~El~ftt~~I~~nfSNYsaWhyRs~lL~~l~~~~~~g~~~~~~~l~sEle~v~saiFTdp~DqS~WfY~rWLl~ 240 (421)
T KOG0529|consen 161 SRNLEKEELEFTTKLINDNFSNYSAWHYRSLLLSTLHPKEADGNFMPKELLQSELEMVHSAIFTDPEDQSCWFYHRWLLG 240 (421)
T ss_pred ccccchhHHHHHHHHHhccchhhhHHHHHHHHHHHhccccccCccCCHHHHHHHHHHHHHHHhcCccccceeeehHHhhc
Confidence 7 7899999999999999999999999999999998877774334466799999999999999999999999999999
Q ss_pred CcCCCCCCcccccCCCCCCcceecCCccccCCCCCCCccccCCCCccceEEeeccccccccccceEEecccCCCccceee
Q 005381 233 QTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWK 312 (699)
Q Consensus 233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~ 312 (699)
++.+.+ |..++. +.+++.++.+|.+.+|...+.++.+ ++.++ |+
T Consensus 241 ~~~~~~---------------------~~~~S~----s~~ls~~~~~p~~~~l~~e~~~v~~---~i~~E--------~~ 284 (421)
T KOG0529|consen 241 RGMRRE---------------------CYIVSH----SALLSESFSEPLIKYLRSEIGLVQS---TIGSE--------FE 284 (421)
T ss_pred cccccc---------------------cccccc----ccccccccCCccHHHHHHHhhhhhh---hhhhh--------cc
Confidence 987655 111111 1345667788899999888877643 33333 33
Q ss_pred e-CCCCCCccceeEEEeccCCCCCCCCCCccceEEecCcccccccCCCCccCCCccceEEEEEeecccccccccccceee
Q 005381 313 P-LSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIIS 391 (699)
Q Consensus 313 ~-~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 391 (699)
+ ++..+ |+|..+.. |..|.+ ++.|++.-.+ . ..+..+
T Consensus 285 ~~~d~~g------w~~~~~~n-----------------------------~~s~~~-~~~v~~~~e~--~----~~~~~~ 322 (421)
T KOG0529|consen 285 TPIDKRG------WLCESLVN-----------------------------LESPYE-TKRVHLTVED--Q----QFGIVS 322 (421)
T ss_pred ccccccC------chhccccc-----------------------------hhhhhh-cccccccccc--c----cccccc
Confidence 3 22222 77765541 122333 2333332211 1 112334
Q ss_pred ccCCCccccc-cccCCCCCccccccccccccCccchhhhhHHHHHHHHHHHHhhhh-ccccccccccHHHHHhhcccCCC
Q 005381 392 WRDESFHNYN-AHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLS-LINCKIGKLTLARLLMAHDAMMC 469 (699)
Q Consensus 392 ~~~~~~~~~~-~~~~~~~~l~~~~~lsi~~~~~~~~~~~~~~~L~~el~~~~~L~~-~p~nk~~~Ltl~~ll~~~~~l~~ 469 (699)
|.+ .++.+. +.. ..+-+++ -+.+ .....|+++|++|.+|++ +|++||++++.++++++.++|.
T Consensus 323 ~~~-~~e~~~~~~~---~~l~~~~------~~e~----~~~a~lqe~ie~c~~l~~~~P~~k~~~l~~~~l~~a~e~~~- 387 (421)
T KOG0529|consen 323 WVA-SNEQWLHALL---DDLDSLD------CNEE----TRRAWLQEQIESCVELQELLPDSKWGLLTSALLLRALEPMD- 387 (421)
T ss_pred chh-hhhhhHHHHh---hhccccc------hhhh----ccHHHHHHHHHHHHHHHhhCCccchhHHHHHHHHhcccccc-
Confidence 433 223222 111 1111221 1122 366789999999999999 9999999999999999999974
Q ss_pred CCCCcCCCcHHHHHhcccccccCCCCCccccchhhhHHhh
Q 005381 470 PPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQ 509 (699)
Q Consensus 470 ~~~~~~~~~~~~l~~l~~L~~LDls~n~~~~~l~sl~~l~ 509 (699)
+.+++++.++.|+.+|+.+.+||+++++.+.++
T Consensus 388 -------~~~~~l~~~~~le~~d~~~~~yykdl~s~~~l~ 420 (421)
T KOG0529|consen 388 -------SEEEILQLYNDLEALDPGRHQYYKDLHSRFLLE 420 (421)
T ss_pred -------chHHHHHHHHHHhccchhhhHHHHhHHHHhccC
Confidence 348899999999999999999999999987653
|
|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >PLN02789 farnesyltranstransferase | Back alignment and domain information |
|---|
| >KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF07711 RabGGT_insert: Rab geranylgeranyl transferase alpha-subunit, insert domain ; InterPro: IPR009087 Rab geranylgeranyltransferase (RabGGT) catalyses the transfer of geranylgeranyl groups to the C-terminal cysteine residues of Rab proteins, Ras-related small GTPases that function in intracellular vesicular transport [] | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >PRK11189 lipoprotein NlpI; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12370 invasion protein regulator; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PRK15174 Vi polysaccharide export protein VexE; Provisional | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein | Back alignment and domain information |
|---|
| >PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein | Back alignment and domain information |
|---|
| >PRK11447 cellulose synthase subunit BcsC; Provisional | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG0553 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK11788 tetratricopeptide repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO | Back alignment and domain information |
|---|
| >PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PRK10049 pgaA outer membrane protein PgaA; Provisional | Back alignment and domain information |
|---|
| >COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3060 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK02603 photosystem I assembly protein Ycf3; Provisional | Back alignment and domain information |
|---|
| >cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >PRK11906 transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >KOG1125 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >PRK14574 hmsH outer membrane protein; Provisional | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00033 ycf3 photosystem I assembly protein Ycf3 | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK10153 DNA-binding transcriptional activator CadC; Provisional | Back alignment and domain information |
|---|
| >COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional | Back alignment and domain information |
|---|
| >KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00540 hemY_coli hemY protein | Back alignment and domain information |
|---|
| >PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4234 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10747 putative protoheme IX biogenesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >PRK10803 tol-pal system protein YbgF; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG0457 NrfG FOG: TPR repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0495 consensus HAT repeat protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi | Back alignment and domain information |
|---|
| >PF13431 TPR_17: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2003 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF12688 TPR_5: Tetratrico peptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >KOG1840 consensus Kinesin light chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >PRK15331 chaperone protein SicA; Provisional | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4555 consensus TPR repeat-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene | Back alignment and domain information |
|---|
| >PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala | Back alignment and domain information |
|---|
| >KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG1310 consensus WD40 repeat protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PLN03077 Protein ECB2; Provisional | Back alignment and domain information |
|---|
| >KOG1129 consensus TPR repeat-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >PRK10941 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A | Back alignment and domain information |
|---|
| >PLN03218 maturation of RBCL 1; Provisional | Back alignment and domain information |
|---|
| >PRK10866 outer membrane biogenesis protein BamD; Provisional | Back alignment and domain information |
|---|
| >PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13512 TPR_18: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 699 | ||||
| 1ltx_A | 567 | Structure Of Rab Escort Protein-1 In Complex With R | 3e-42 | ||
| 1dce_A | 567 | Crystal Structure Of Rab Geranylgeranyltransferase | 2e-41 | ||
| 4ehm_A | 330 | Rabggtase In Complex With Covalently Bound Psoromic | 8e-38 | ||
| 3pz1_A | 332 | Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) | 8e-38 | ||
| 3dss_A | 331 | Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) | 9e-38 | ||
| 3c72_A | 334 | Engineered Rabggtase In Complex With A Peptidomimet | 1e-37 | ||
| 1o1r_A | 380 | Structure Of Fpt Bound To Ggpp Length = 380 | 2e-11 | ||
| 1o5m_A | 377 | Structure Of Fpt Bound To The Inhibitor Sch66336 Le | 2e-11 | ||
| 1qbq_A | 333 | Structure Of Rat Farnesyl Protein Transferase Compl | 2e-11 | ||
| 1nl4_A | 312 | Crystal Structure Of Rat Farnesyl Transferase In Co | 2e-11 | ||
| 2bed_A | 313 | Structure Of Fpt Bound To Inhibitor Sch207736 Lengt | 2e-11 | ||
| 2r2l_A | 315 | Structure Of Farnesyl Protein Transferase Bound To | 2e-11 | ||
| 1n95_A | 315 | Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranf | 2e-11 | ||
| 1ft1_A | 377 | Crystal Structure Of Protein Farnesyltransferase At | 3e-11 | ||
| 3pz4_A | 379 | Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subu | 3e-11 | ||
| 1ft2_A | 315 | Co-Crystal Structure Of Protein Farnesyltransferase | 3e-11 | ||
| 2f0y_A | 379 | Crystal Structure Of Human Protein Farnesyltransfer | 2e-10 | ||
| 1jcq_A | 382 | Crystal Structure Of Human Protein Farnesyltransfer | 2e-10 | ||
| 3dra_A | 306 | Candida Albicans Protein Geranylgeranyltransferase- | 1e-07 | ||
| 3q73_A | 349 | Cryptococcus Neoformans Protein Farnesyltransferase | 6e-06 | ||
| 3q73_A | 349 | Cryptococcus Neoformans Protein Farnesyltransferase | 9e-05 | ||
| 3sfx_A | 349 | Cryptococcus Neoformans Protein Farnesyltransferase | 7e-06 | ||
| 3sfx_A | 349 | Cryptococcus Neoformans Protein Farnesyltransferase | 9e-05 |
| >pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 | Back alignment and structure |
|
| >pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 | Back alignment and structure |
| >pdb|4EHM|A Chain A, Rabggtase In Complex With Covalently Bound Psoromic Acid Length = 330 | Back alignment and structure |
| >pdb|3PZ1|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) In Complex With Bms3 Length = 332 | Back alignment and structure |
| >pdb|3DSS|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) Length = 331 | Back alignment and structure |
| >pdb|3C72|A Chain A, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor Length = 334 | Back alignment and structure |
| >pdb|1O1R|A Chain A, Structure Of Fpt Bound To Ggpp Length = 380 | Back alignment and structure |
| >pdb|1O5M|A Chain A, Structure Of Fpt Bound To The Inhibitor Sch66336 Length = 377 | Back alignment and structure |
| >pdb|1QBQ|A Chain A, Structure Of Rat Farnesyl Protein Transferase Complexed With A Cvim Peptide And Alpha-Hydroxyfarnesylphosphonic Acid Length = 333 | Back alignment and structure |
| >pdb|1NL4|A Chain A, Crystal Structure Of Rat Farnesyl Transferase In Complex With A Potent Biphenyl Inhibitor Length = 312 | Back alignment and structure |
| >pdb|2BED|A Chain A, Structure Of Fpt Bound To Inhibitor Sch207736 Length = 313 | Back alignment and structure |
| >pdb|2R2L|A Chain A, Structure Of Farnesyl Protein Transferase Bound To Pb-93 Length = 315 | Back alignment and structure |
| >pdb|1N95|A Chain A, Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranferase: Glycine, Phenylalanine And Histidine Derivatives Length = 315 | Back alignment and structure |
| >pdb|1FT1|A Chain A, Crystal Structure Of Protein Farnesyltransferase At 2.25 Angstroms Resolution Length = 377 | Back alignment and structure |
| >pdb|3PZ4|A Chain A, Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10) In Complex With Bms3 And Lipid Substrate Fpp Length = 379 | Back alignment and structure |
| >pdb|1FT2|A Chain A, Co-Crystal Structure Of Protein Farnesyltransferase Complexed With A Farnesyl Diphosphate Substrate Length = 315 | Back alignment and structure |
| >pdb|2F0Y|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And Hydantoin Derivative Length = 379 | Back alignment and structure |
| >pdb|1JCQ|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And The Peptidomimetic Inhibitor L-739,750 Length = 382 | Back alignment and structure |
| >pdb|3DRA|A Chain A, Candida Albicans Protein Geranylgeranyltransferase-I Complexed With Ggpp Length = 306 | Back alignment and structure |
| >pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 | Back alignment and structure |
| >pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 | Back alignment and structure |
| >pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 | Back alignment and structure |
| >pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 699 | |||
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-98 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 9e-70 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 4e-09 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 3e-07 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 9e-56 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 5e-11 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 2e-55 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 2e-11 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 4e-07 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 2e-52 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 9e-22 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-12 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-11 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-11 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-10 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-11 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-10 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 8e-11 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-09 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-09 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 4e-08 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 7e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 1e-10 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 9e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 7e-08 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-10 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-09 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-08 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 5e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 6e-10 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-09 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-08 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 7e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-09 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-08 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 7e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-09 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-08 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-04 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-04 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 7e-08 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 8e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 6e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 8e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 9e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 9e-05 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-04 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 7e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 7e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-04 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 3e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 5e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 8e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 8e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 7e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 9e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 9e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 7e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-04 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 8e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-06 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 2e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 1e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 8e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 5e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-06 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 9e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 6e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 6e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 8e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 6e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-04 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 3e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 7e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 5e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 9e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 1e-04 | |
| 3v6t_A | 499 | DHAX3; tandem repeats, DNA specific binding protei | 6e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-04 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 6e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 3e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 5e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 7e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-04 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 4e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 5e-04 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 5e-04 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 6e-04 |
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
Score = 314 bits (804), Expect = 1e-98
Identities = 154/633 (24%), Positives = 237/633 (37%), Gaps = 107/633 (16%)
Query: 1 MHGRPRKPLKPEDAAA----SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
MHGR + E A A K + + + +EL++++L NP
Sbjct: 1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60
Query: 57 ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
+ T WN R+ +QH E + P+ +++ EL +ES LR N KSYG WHHR W+LS
Sbjct: 61 DFATLWNCRREVLQHL--ETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118
Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
+ + EL L +F +AD RNFH W+YRRFVAA + +EL +T+ +I NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178
Query: 176 SAWHNRSLLLSNLLKRKVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
S+WH RS LL L + G + E VL E E V A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238
Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN 293
D H+ L + F++ + +
Sbjct: 239 AEPHDVLC-----------------------------CVHVSREEACLSVCFSRPLTVGS 269
Query: 294 SSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQG 353
+ + W+ N + VW+ L N + +
Sbjct: 270 RMGTLLLMVDEAPLSVEWRTPDGRNRPS-HVWLCDLPAASLNDQLPQHTFRVI------- 321
Query: 354 IISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSL 413
W +D
Sbjct: 322 --------------------------------------WTGSDSQKECVLLKDRPECWCR 343
Query: 414 YQLSIKNDNELTDFEWRAATIAKEIDHFRELLSL-INCKIGKLTLARLLMAHDAMMCPPA 472
+ + ++ + E++ +EL L K LT+ L+ A D
Sbjct: 344 DSATDEQLFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALD------- 396
Query: 473 NKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNR 532
+ + +E L+ ++ L +DP Y D S LL+ E R H ++
Sbjct: 397 -PLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAH---KD 452
Query: 533 -----GSPMCLQLKNLSLSR------LGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSC 581
L + +L LS + L +++L S N L +++G+ L L
Sbjct: 453 LTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQE 512
Query: 582 LNLSNNILGSFTALEPIRQLKSLRALNISYNEI 614
L L NN L A++P+ L LN+ N +
Sbjct: 513 LLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSL 545
|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 100.0 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 100.0 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 100.0 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 100.0 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 100.0 | |
| 3dra_A | 306 | Protein farnesyltransferase/geranylgeranyltransfer | 99.97 | |
| 3dss_A | 331 | Geranylgeranyl transferase type-2 subunit alpha; p | 99.96 | |
| 3q7a_A | 349 | Farnesyltransferase alpha subunit; protein prenylt | 99.94 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.92 | |
| 2h6f_A | 382 | Protein farnesyltransferase/geranylgeranyltransfer | 99.8 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.62 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.61 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.51 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.48 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.48 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.47 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.46 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.45 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.45 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.45 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.45 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.44 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.44 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.44 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.43 | |
| 4gyw_A | 723 | UDP-N-acetylglucosamine--peptide N- acetylglucosam | 99.43 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.43 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.43 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.42 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 99.42 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.42 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.41 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.4 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.4 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.4 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.39 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.39 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.39 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.39 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.38 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.38 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.38 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.37 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.37 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.37 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.37 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.37 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.37 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.37 | |
| 1w3b_A | 388 | UDP-N-acetylglucosamine--peptide N-acetylglucosami | 99.36 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.35 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.35 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.35 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 99.35 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 99.34 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.33 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 99.33 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.33 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.33 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.33 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.33 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.32 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.32 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.32 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.32 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 99.31 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.31 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.31 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.31 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.31 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.31 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.31 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.3 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.3 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.3 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.3 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.29 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.29 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.29 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.29 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.29 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.29 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.29 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.28 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.28 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.28 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.27 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.27 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.27 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.27 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.27 | |
| 4eqf_A | 365 | PEX5-related protein; accessory protein, tetratric | 99.27 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.26 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.26 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.26 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.26 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 99.26 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.26 | |
| 4abn_A | 474 | Tetratricopeptide repeat protein 5; P53 cofactor, | 99.26 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 99.26 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.25 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 99.25 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.25 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.24 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 99.24 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 99.24 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.24 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.24 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.24 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.23 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.23 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.23 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.23 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.23 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 99.22 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 99.22 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.22 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.22 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.22 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.22 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.21 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 99.21 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.21 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.21 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 99.21 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 99.2 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.2 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.2 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.2 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 99.2 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.2 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.2 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.19 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.19 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.18 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.18 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.18 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.17 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.17 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.17 | |
| 2y4t_A | 450 | DNAJ homolog subfamily C member 3; chaperone, endo | 99.17 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.16 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.16 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 99.16 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.16 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.15 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.15 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 99.15 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.15 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.15 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.15 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.14 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.14 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.13 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.13 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.13 | |
| 2xpi_A | 597 | Anaphase-promoting complex subunit CUT9; cell cycl | 99.13 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.12 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 99.12 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.11 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.1 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.1 | |
| 2ond_A | 308 | Cleavage stimulation factor 77 kDa subunit; HAT do | 99.09 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.08 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.08 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.08 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.07 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.07 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.07 | |
| 3fp2_A | 537 | TPR repeat-containing protein YHR117W; TOM71, mito | 99.07 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.05 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.05 | |
| 2gw1_A | 514 | Mitochondrial precursor proteins import receptor; | 99.05 | |
| 4g1t_A | 472 | Interferon-induced protein with tetratricopeptide | 99.05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.05 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 99.05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.03 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 99.02 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.02 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.02 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 99.01 | |
| 3mkr_A | 291 | Coatomer subunit epsilon; tetratricopeptide repeat | 99.0 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.0 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.0 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 99.0 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.99 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.99 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.98 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.97 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 98.97 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 98.97 | |
| 2hr2_A | 159 | Hypothetical protein; alpha-alpha superhelix fold, | 98.97 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.95 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.94 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.92 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 98.92 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.91 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 98.9 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.9 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 98.89 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.89 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.89 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.89 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.88 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 98.88 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 98.88 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.87 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.87 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.87 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 98.86 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 98.86 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 98.84 | |
| 2r5s_A | 176 | Uncharacterized protein VP0806; APC090868.1, vibri | 98.83 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.82 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.81 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.81 | |
| 2ooe_A | 530 | Cleavage stimulation factor 77 kDa subunit; HAT do | 98.8 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 98.8 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.8 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.8 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.79 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.78 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.78 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.75 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.75 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.74 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 98.74 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 98.72 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.71 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.71 | |
| 2vsy_A | 568 | XCC0866; transferase, glycosyl transferase, GT-B, | 98.71 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.71 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 98.71 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 98.7 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 98.7 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 98.7 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 98.69 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.69 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 98.69 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 98.68 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 98.68 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.67 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.64 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.64 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.63 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.62 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.61 | |
| 1zu2_A | 158 | Mitochondrial import receptor subunit TOM20-3; TPR | 98.61 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.61 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 98.61 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 98.6 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.6 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 98.6 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 98.59 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.59 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 98.59 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 98.58 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 98.58 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.57 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 98.56 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.56 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.55 | |
| 3nf1_A | 311 | KLC 1, kinesin light chain 1; TPR, structural geno | 98.54 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.53 | |
| 1wao_1 | 477 | Serine/threonine protein phosphatase 5; hydrolase, | 98.53 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 98.53 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.53 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 98.53 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.52 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.51 | |
| 3edt_B | 283 | KLC 2, kinesin light chain 2; superhelical, struct | 98.47 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.45 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 98.44 | |
| 1ouv_A | 273 | Conserved hypothetical secreted protein; TPR repea | 98.43 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.42 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 98.41 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 98.39 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 98.38 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.36 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 98.36 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.34 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.34 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 98.33 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 98.33 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.32 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 98.28 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 98.28 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.25 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 98.22 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 98.17 | |
| 4a1s_A | 411 | PINS, partner of inscuteable; cell cycle, LGN, mit | 98.16 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.16 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 98.13 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 98.12 | |
| 3ro2_A | 338 | PINS homolog, G-protein-signaling modulator 2; TPR | 98.05 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 98.04 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 98.02 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.94 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.91 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.89 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 97.86 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.84 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 97.83 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 97.82 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.82 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 97.81 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 97.8 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 97.79 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.79 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 97.73 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 97.72 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 97.72 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.65 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.65 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.57 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.56 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.52 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.43 | |
| 3rjv_A | 212 | Putative SEL1 repeat protein; alpha-alpha superhel | 97.41 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.39 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 97.35 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 97.29 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 97.28 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 97.19 | |
| 4f3v_A | 282 | ESX-1 secretion system protein ECCA1; tetratricope | 97.18 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 97.17 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 97.15 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.09 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 97.07 | |
| 3ly7_A | 372 | Transcriptional activator CADC; alpha/beta domain, | 97.02 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 96.99 | |
| 3e4b_A | 452 | ALGK; tetratricopeptide repeat, superhelix, algina | 96.98 | |
| 2xm6_A | 490 | Protein corresponding to locus C5321 from CFT073 s | 96.87 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 96.82 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 96.67 | |
| 1xi4_A | 1630 | Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle | 96.66 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.6 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.09 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 95.98 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.97 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.95 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.88 | |
| 1pc2_A | 152 | Mitochondria fission protein; unknown function; NM | 95.72 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 95.69 | |
| 3bee_A | 93 | Putative YFRE protein; putaive YFRE protein, struc | 95.68 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 95.63 | |
| 4e6h_A | 679 | MRNA 3'-END-processing protein RNA14; HAT domain, | 95.53 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 95.33 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 95.32 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 95.14 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 94.95 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 94.47 | |
| 3qww_A | 433 | SET and MYND domain-containing protein 2; methyltr | 93.97 | |
| 3u64_A | 301 | Protein TP_0956; tetratrico peptide repeat, protei | 93.77 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 93.74 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 93.62 | |
| 3n71_A | 490 | Histone lysine methyltransferase SMYD1; heart deve | 93.19 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 93.15 | |
| 1klx_A | 138 | Cysteine rich protein B; structural genomics, heli | 93.0 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 92.75 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.4 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 92.25 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 91.94 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 91.73 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 90.46 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 90.24 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 89.57 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 88.92 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 88.6 | |
| 1b89_A | 449 | Protein (clathrin heavy chain); triskelion, coated | 88.55 | |
| 3qwp_A | 429 | SET and MYND domain-containing protein 3; SMYD3,SE | 88.35 | |
| 2uy1_A | 493 | Cleavage stimulation factor 77; RNA-binding protei | 86.96 | |
| 1nzn_A | 126 | CGI-135 protein, fission protein FIS1P; TPR, unkno | 86.25 | |
| 3o48_A | 134 | Mitochondria fission 1 protein; tetratricopeptide | 85.8 | |
| 1y8m_A | 144 | FIS1; mitochondria, unknown function; NMR {Sacchar | 85.64 |
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-74 Score=662.85 Aligned_cols=554 Identities=30% Similarity=0.478 Sum_probs=441.9
Q ss_pred CCCCcCCCCC-hHHHHH---HHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccC
Q 005381 1 MHGRPRKPLK-PEDAAA---SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN 76 (699)
Q Consensus 1 mhg~~~~~~~-~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~ 76 (699)
||||+|+.++ +++++| +.+|++.|++++++|++++..+++++|||++|+++|.+||++||||++||+++..+++
T Consensus 1 mhg~~~~~~~~~~~~~~~~~~~~k~~~y~~~~~~~~~~~~~~~~~eeal~~~~~~l~~nP~~~taW~~R~~~l~~l~~-- 78 (567)
T 1dce_A 1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLET-- 78 (567)
T ss_dssp CCSCBCSSCSTTSSCCSCCCCHHHHHHHHHHHHHHHHHHHTTCCSHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHT--
T ss_pred CCCCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHCchhHHHHHHHHHHHHhccc--
Confidence 9999998444 444333 4788999999999999999999999999999999999999999999999999999975
Q ss_pred CCCchhhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCC-CChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCC
Q 005381 77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGH-SSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR 155 (699)
Q Consensus 77 ~~~~~~~~~~~~eEL~~~~~~L~~nPKsy~aW~hR~w~L~~~~-~~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~ 155 (699)
+.+++.....+++||++++++|+.+||+|+||+||+|++.++. ..+++|+++|++++++||+|||||+||+|++..++.
T Consensus 79 ~~~~~~~~~~~~~eL~~~~~~l~~~pK~y~aW~hR~w~l~~l~~~~~~~el~~~~k~l~~d~~N~~aW~~R~~~l~~l~~ 158 (567)
T 1dce_A 79 EKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAV 158 (567)
T ss_dssp TSCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTCSSCCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTCC
T ss_pred ccchhhhhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcccccHHHHHHHHHHHHhhccccccHHHHHHHHHHHcCC
Confidence 2334666778999999999999999999999999999999873 267999999999999999999999999999999995
Q ss_pred ChHHHHHHHHHHHHhccCchHHHHHHHHHHHHhhhhhccCc--cchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHcC
Q 005381 156 SEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGF--VSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233 (699)
Q Consensus 156 ~~e~EL~~~~~~I~~n~sN~SAW~~R~~ll~~l~~~~~~~~--~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~~ 233 (699)
..++|++|++++|+.||+|+||||||+.++..+++....+. ....+.+++|++++++||+++|+|+|+|+|+||++..
T Consensus 159 ~~~~el~~~~~~I~~~p~n~saW~~r~~ll~~l~~~~~~~~~~~~~~~~~~eel~~~~~ai~~~P~~~saW~y~~~ll~~ 238 (567)
T 1dce_A 159 APAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238 (567)
T ss_dssp CHHHHHHHHHTTTTTTCCCHHHHHHHHHHHHHHSCCCCSSSCCSSCHHHHHHHHHHHHHHHHHCSSCSHHHHHHHHHHSC
T ss_pred ChHHHHHHHHHHHHHCCCCccHHHHHHHHHHhhcccccccccccccHHHHHHHHHHHHHHHhhCCCCccHHHHHHHHHhc
Confidence 55899999999999999999999999999999865422221 1234679999999999999999999999999999998
Q ss_pred cCCCCCCcccccCCCCCCcceecCCccccCCCCCCCccccCCCCccceEEeecccccccc-ccceEEecccCCCccceee
Q 005381 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN-SSTITVDSELNTNKDLVWK 312 (699)
Q Consensus 234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~w~ 312 (699)
..+.+ .+. |+ +......+++++|++||.... .+|+.+.+... ...+.|+
T Consensus 239 ~~~~~---~~~---------------~~-----------~~~~~~~~~~~~f~~~i~~~~~~~~~~~~~~~~-~~~~~W~ 288 (567)
T 1dce_A 239 AEPHD---VLC---------------CV-----------HVSREEACLSVCFSRPLTVGSRMGTLLLMVDEA-PLSVEWR 288 (567)
T ss_dssp CCCCS---CEE---------------EE-----------EEETTTTEEEEEEEEEECTTBTTBCEEEEESSS-EECCCCB
T ss_pred CCCcc---cee---------------ee-----------eeccCCceEEEEeccceeccccccceEEeecCc-ccceeec
Confidence 75422 111 11 112346678999999998642 33467666543 6799999
Q ss_pred eCCCCCCccceeEEEeccCCCCCCCCCCccceEEecCcccccccCCCCccCCCccceEEEEEeecccccccccccceeec
Q 005381 313 PLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISW 392 (699)
Q Consensus 313 ~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 392 (699)
|+. .++++++||+++++.+...++ ..+|+|+|.+++.++. .. |... .+..+.|
T Consensus 289 ~~~-~~~~~~~vw~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-----~~-------------------~~~~-~~~~~~~ 341 (567)
T 1dce_A 289 TPD-GRNRPSHVWLCDLPAASLNDQ-LPQHTFRVIWTGSDSQ-----KE-------------------CVLL-KDRPECW 341 (567)
T ss_dssp CTT-SSCCSEEEEEEECCGGGTSTT-SSEEEEEEEETTTTEE-----EE-------------------EEEE-TTCSEEE
T ss_pred cCC-cccccceeEEeecCccccccc-cccceEEEeeccCCCC-----cc-------------------cccc-CCCchhh
Confidence 987 678899999999998664333 4567788877766532 11 1111 2345556
Q ss_pred cCCCccccccccCCCCCccccccccccccCccchhhhhHHHHHHHHHHHHhhhh-ccccccccccHHHHHhhcccCCCCC
Q 005381 393 RDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLS-LINCKIGKLTLARLLMAHDAMMCPP 471 (699)
Q Consensus 393 ~~~~~~~~~~~~~~~~~l~~~~~lsi~~~~~~~~~~~~~~~L~~el~~~~~L~~-~p~nk~~~Ltl~~ll~~~~~l~~~~ 471 (699)
.+... ...+|. .|.+ +...++.||.+|..|.+|.+ .++++|.+.++..++..++.
T Consensus 342 ~~d~~--------~~~~L~---~L~L--------s~n~L~~Lp~~i~~l~~L~~L~l~~n~~l~~l~~ll~~~~~----- 397 (567)
T 1dce_A 342 CRDSA--------TDEQLF---RCEL--------SVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDP----- 397 (567)
T ss_dssp EECCS--------TTTTSS---SCCC--------CHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHCT-----
T ss_pred hcccc--------cCccce---eccC--------ChhhHHhhHHHHHHHHHHHHhccccchhhhhHHHHHHhccc-----
Confidence 32111 112333 4444 55688999999999999999 78999998888888877554
Q ss_pred CCcCCCcHHHHHhcccccccCCCCCccccchhhhHHhhhhccchHHHhhhhccCCCCCCCCCCCCeEEccCCCCCcccCC
Q 005381 472 ANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSF 551 (699)
Q Consensus 472 ~~~~~~~~~~l~~l~~L~~LDls~n~~~~~l~sl~~l~~l~~~~~~l~~~~~~l~~l~~l~L~~~~L~Ls~n~l~~l~~l 551 (699)
.+..++.++.+++|+.||+.+.+.+.+++.+++..+....+. . ..++ .|+|++|.|+.+|.+
T Consensus 398 ---~~~~~~~l~~l~~L~~L~~l~~n~~~~L~~l~l~~n~i~~l~---~-----~~L~-------~L~Ls~n~l~~lp~~ 459 (567)
T 1dce_A 398 ---LLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKME---Y-----ADVR-------VLHLAHKDLTVLCHL 459 (567)
T ss_dssp ---GGGHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHH---H-----TTCS-------EEECTTSCCSSCCCG
T ss_pred ---ccCCHHHHHHHHhcccCcchhhcccchhhhhhhhcccccccC---c-----cCce-------EEEecCCCCCCCcCc
Confidence 478889999999999999655666778888777666332121 1 1122 399999999999999
Q ss_pred CCCcccCEEEccCCCCCCCcC-CccccccceeecccCCCCCCCCCccccccccccccccccccCCCCCcccccccCCCCC
Q 005381 552 DKLLWVQMLDLSHNELRSIEG-LEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPL 630 (699)
Q Consensus 552 ~~L~~L~~LdLS~N~L~~l~~-l~~L~~L~~L~Ls~N~l~~l~~~~~l~~l~~L~~L~Ls~N~I~~lp~~~~~~l~~l~l 630 (699)
..+++|+.|+|++|.|+.+|. +..|++|+.|+|++|.|+++ | .++.+++|+.|+|++|+|+.++.
T Consensus 460 ~~l~~L~~L~Ls~N~l~~lp~~~~~l~~L~~L~Ls~N~l~~l--p-~l~~l~~L~~L~Ls~N~l~~~~~----------- 525 (567)
T 1dce_A 460 EQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENV--D-GVANLPRLQELLLCNNRLQQSAA----------- 525 (567)
T ss_dssp GGGTTCCEEECCSSCCCCCCGGGGGCTTCCEEECCSSCCCCC--G-GGTTCSSCCEEECCSSCCCSSST-----------
T ss_pred cccccCcEeecCcccccccchhhhcCCCCCEEECCCCCCCCC--c-ccCCCCCCcEEECCCCCCCCCCC-----------
Confidence 999999999999999999998 99999999999999999987 3 78999999999999999998720
Q ss_pred cccccCCCCccceeecCCcchhhhhhccCCCC-CccEEEecCCCC-CCccchHHHhhcCCcccccc
Q 005381 631 SHSVGSEWNHGQTVIDDDIKSYWEAYFILKGL-NLTQFDIVGNAI-VNEKFKSFLIKVLPGLKWLD 694 (699)
Q Consensus 631 l~ll~l~~N~l~~~~~~~~~~~~~~p~~l~~L-~L~~LdLs~N~l-~~~~~~~~~~~~l~~L~~LD 694 (699)
|..+..+ +|+.|+|++|+| ..+.....+...+|+|+.||
T Consensus 526 -------------------------p~~l~~l~~L~~L~L~~N~l~~~~~~~~~l~~~lp~L~~L~ 566 (567)
T 1dce_A 526 -------------------------IQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSIL 566 (567)
T ss_dssp -------------------------TGGGGGCTTCCEEECTTSGGGGSSSCTTHHHHHCTTCSEEE
T ss_pred -------------------------cHHHhcCCCCCEEEecCCcCCCCccHHHHHHHHCcccCccC
Confidence 2345667 899999999999 44445556677799999986
|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} | Back alignment and structure |
|---|
| >3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* | Back alignment and structure |
|---|
| >3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* | Back alignment and structure |
|---|
| >3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 | Back alignment and structure |
|---|
| >3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* | Back alignment and structure |
|---|
| >2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B | Back alignment and structure |
|---|
| >1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A | Back alignment and structure |
|---|
| >3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A | Back alignment and structure |
|---|
| >1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 699 | ||||
| d1dcea1 | 334 | a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr | 9e-36 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 5e-16 | |
| d2h6fa1 | 315 | a.118.6.1 (A:55-369) Protein farnesyltransferase a | 0.003 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-08 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.003 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 2e-08 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 6e-06 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 4e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 3e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 6e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.001 | |
| d1m9la_ | 198 | c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree | 0.002 |
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: Protein prenylyltransferase family: Protein prenylyltransferase domain: Rab geranylgeranyltransferase alpha-subunit, N-terminal domain species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 135 bits (341), Expect = 9e-36
Identities = 95/240 (39%), Positives = 128/240 (53%), Gaps = 9/240 (3%)
Query: 1 MHGRPRKPLKPEDAAAS----AAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
MHGR + E A A K + + + +EL++++L NP
Sbjct: 1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60
Query: 57 ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
+ T WN R+ +QH E + P+ +++ EL +ES LR N KSYG WHHR W+LS
Sbjct: 61 DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118
Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
+ + EL L +F +AD RNFH W+YRRFVAA + +EL +T+ +I NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178
Query: 176 SAWHNRSLLLSNLLKRK--VEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
S+WH RS LL L + E VL E E V A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238
|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 699 | |||
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.97 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.95 | |
| d2h6fa1 | 315 | Protein farnesyltransferase alpha-subunit {Human ( | 99.84 | |
| d1dcea1 | 334 | Rab geranylgeranyltransferase alpha-subunit, N-ter | 99.65 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.58 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.57 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.46 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.44 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.42 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.37 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.37 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.33 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.33 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 99.32 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 99.31 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.25 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.22 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.2 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.2 | |
| d1dcea2 | 109 | Rab geranylgeranyltransferase alpha-subunit, inser | 99.19 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.15 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.14 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.14 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.13 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.13 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 99.07 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 99.05 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 99.05 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.02 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.01 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.01 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 98.94 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.94 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.94 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.94 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.94 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.87 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.85 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.85 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.84 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.84 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.8 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.8 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.79 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.78 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 98.76 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 98.76 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.75 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.72 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.7 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.6 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.59 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.59 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.58 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 98.56 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 98.55 | |
| d1zu2a1 | 145 | Mitochondrial import receptor subunit tom20-3 {Tha | 98.55 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 98.52 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 98.45 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 98.43 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.37 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.36 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 98.36 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 98.35 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.29 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 98.29 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.28 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.25 | |
| d2onda1 | 308 | Cleavage stimulation factor 77 kDa subunit CSTF3 { | 98.17 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.97 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.96 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.9 | |
| d1ya0a1 | 497 | SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | 97.88 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.76 | |
| d2hr2a1 | 156 | Hypothetical protein CT2138 {Chlorobium tepidum [T | 97.66 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.64 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.63 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 97.52 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 97.51 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.42 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.39 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.32 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 97.29 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 97.06 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 97.03 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 96.61 | |
| d2ff4a2 | 179 | Probable regulatory protein EmbR, middle domain {M | 96.53 | |
| d1zbpa1 | 264 | Hypothetical protein VPA1032 {Vibrio parahaemolyti | 96.47 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.89 | |
| d1hz4a_ | 366 | Transcription factor MalT domain III {Escherichia | 95.56 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 95.27 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.21 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 94.74 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 92.26 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 90.52 |
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: Protein prenylyltransferase family: Protein prenylyltransferase domain: Protein farnesyltransferase alpha-subunit species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=1.1e-29 Score=267.62 Aligned_cols=201 Identities=24% Similarity=0.470 Sum_probs=185.4
Q ss_pred HHHHHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccCCCCchhhhhhHHHHHHH
Q 005381 14 AAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRV 93 (699)
Q Consensus 14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~~~~~~~~~~~~~eEL~~ 93 (699)
+.+.+++.++|.++++.+...+.+++.+++||++++++|.+||++++||++|+.++..+++ .+++|+.+
T Consensus 32 ~~~~I~~~p~~~~a~~~~~~~~~~~e~~~~Al~~~~~ai~lnP~~~~a~~~r~~~l~~l~~-----------~~~eal~~ 100 (315)
T d2h6fa1 32 PVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQK-----------DLHEEMNY 100 (315)
T ss_dssp CSSEECCCHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTC-----------CHHHHHHH
T ss_pred cccccccCHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHCCCChHHHHHHHHHHHHhCc-----------CHHHHHHH
Confidence 3345667789999999999999999999999999999999999999999999999998853 48999999
Q ss_pred HHHHHHhCCCChHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCCChHHHHHHHHHHHHhccC
Q 005381 94 VESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFS 173 (699)
Q Consensus 94 ~~~~L~~nPKsy~aW~hR~w~L~~~~~~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~~~e~EL~~~~~~I~~n~s 173 (699)
++++++.+||++.+|+||+|++.++ +.+++|++++++++++||+|+++|.+|+|++..++.+ ++++++++++|+.||+
T Consensus 101 ~~~al~~~p~~~~a~~~~~~~~~~l-~~~~eAl~~~~kal~~dp~n~~a~~~~~~~~~~~~~~-~~Al~~~~~al~~~p~ 178 (315)
T d2h6fa1 101 ITAIIEEQPKNYQVWHHRRVLVEWL-RDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLW-DNELQYVDQLLKEDVR 178 (315)
T ss_dssp HHHHHHHCTTCHHHHHHHHHHHHHH-TCCTTHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCC-TTHHHHHHHHHHHCTT
T ss_pred HHHHHHHHHhhhhHHHHHhHHHHhh-ccHHHHHHHHhhhhhhhhcchHHHHHHHHHHHHHHhh-HHHHHHHHHHHHHCCc
Confidence 9999999999999999999999987 6899999999999999999999999999999999999 6899999999999999
Q ss_pred chHHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHcC
Q 005381 174 NYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233 (699)
Q Consensus 174 N~SAW~~R~~ll~~l~~~~~~~~~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~~ 233 (699)
|.+||++|+.++..++.. .....+++|++.+.+||..+|+|.++|+|+++++..
T Consensus 179 n~~a~~~r~~~l~~~~~~------~~~~~~~~ai~~~~~al~~~P~~~~~~~~l~~ll~~ 232 (315)
T d2h6fa1 179 NNSVWNQRYFVISNTTGY------NDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQD 232 (315)
T ss_dssp CHHHHHHHHHHHHHTTCS------CSHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHTT
T ss_pred cHHHHHHHHHHHHHcccc------chhhhhHHhHHHHHHHHHhCCCchHHHHHHHHHHHh
Confidence 999999999999877542 234567999999999999999999999999999965
|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|