Citrus Sinensis ID: 005381


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------70
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccccEEcccccccccccccccccccccccccHHHHHcccccccccccEEEcccccccccccccccccccccccEEEEEEEEcccccccccccccEEEcccccccccccccccccccccEEEEEEEcccccHHHHcccccEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccEEEccccccccHHHHHHHHHHccccccccccccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcHcccccccccHHccccccccEEEEEEcccccccEEEEccccccccccEEEEEEEccccccccccEEEEEEcccccccEEEEccccccccccEEEEEEccccccccccccEEEEEEccccccccccccccEccccccEEEEEEEEcccccccHHHHccEEEEcccccccccccccccccHHHHHHHHHHHHcHcccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccHcHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccccccccccEEEEcccccccEcccHHHEEEEEEEccccccccccccHHHcHHHHEEEccccccccHHHcccHccccccEEEEccccccccccccccEEEccccccccccccHHcccEcccccHHHHHHHHHHHHcccEEEEEccccHHccHHHHHHHHHHccccEEEcccEcc
mhgrprkplkpedAAASAAKAEKLRVLQSQFLHnhhnhiysKEAVELSTKLLETNPELYTAWNYRKLAVQHkltendsdpdslkSILDEELRVVESALRQNFKsygawhhrkwilskghssiDNELRLLDKFQkadsrnfhaWNYRRFVAASMNRSEEDELKYTEDmicnnfsnysaWHNRSLLLSNLLKRKVEgfvskekvlpdeyEFVHQaiftdpddqsgwfyHLWLLDQtvrvdspqlvsswptpgsdlillgdrcldgcasspftrfhldsrtfpLVLYFNQAVEGVNSSTITVdselntnkdlvwkplsscnskAAQVWVTQlnlpdgnthsskvfPVEVSlghsqgiisssgfhysnpfcFAFRVSLqfvetqpvEALGKEIISWRDesfhnynahsqdsspisslYQLSikndneltDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHdammcppankishsEEVLELYNDLmrldpthvqyykdqHSLVLLQQVTSNWESLLSRCFhysnspsnrgspmclqlknlslsrlgsfDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNlsnnilgsftalepIRQLKSLRALNISyneigahsidttkylcssplshsvgsewnhgqtviddDIKSYWEAYFILKglnltqfdivgnAIVNEKFKSFLIKvlpglkwldgeqlh
mhgrprkplkpedAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLtendsdpdsLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKadsrnfhawnyRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIkvlpglkwldgeqlh
MHGRPRKPLKPEDaaasaakaEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHnrslllsnllkrkVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGlealqllsclnlsnnilgsFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH
************************RVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHK*************ILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVA*************TEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYN**********SLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYS*********MCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLD*****
MHGRPRK*************AEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEND**PDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNY*********ISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQL*
********************AEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYN********ISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH
********LKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDDDIKSYWEAYFILKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query699 2.2.26 [Sep-21-2011]
Q08602567 Geranylgeranyl transferas yes no 0.738 0.910 0.289 6e-48
Q9JHK4567 Geranylgeranyl transferas yes no 0.726 0.895 0.293 4e-47
Q5NVK5567 Geranylgeranyl transferas yes no 0.719 0.887 0.286 9e-47
A5A779567 Geranylgeranyl transferas yes no 0.753 0.929 0.276 4e-46
Q92696567 Geranylgeranyl transferas yes no 0.331 0.409 0.402 6e-42
Q5EA80567 Geranylgeranyl transferas yes no 0.331 0.409 0.406 2e-40
O94412344 Geranylgeranyl transferas yes no 0.323 0.656 0.362 4e-35
Q55DQ4311 Geranylgeranyl transferas yes no 0.319 0.717 0.362 4e-34
Q00618327 Geranylgeranyl transferas yes no 0.324 0.694 0.330 1e-27
O93829371 Geranylgeranyl transferas N/A no 0.329 0.619 0.308 3e-26
>sp|Q08602|PGTA_RAT Geranylgeranyl transferase type-2 subunit alpha OS=Rattus norvegicus GN=Rabggta PE=1 SV=1 Back     alignment and function desciption
 Score =  192 bits (489), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 181/625 (28%), Positives = 268/625 (42%), Gaps = 109/625 (17%)

Query: 1   MHGRPRKPLKPEDAAASAAKAE-KLRVLQSQ---FLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A   + E KL++ QS               +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRKVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +   G   +  E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238

Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN 293
               D    V          +   + CL  C S P T   + SR   L+L  ++A     
Sbjct: 239 AEPHDVLCCVH---------VSREEACLSVCFSRPLT---VGSRMGTLLLMVDEA----- 281

Query: 294 SSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQG 353
                              PLS         W T    PDG    S V+  ++       
Sbjct: 282 -------------------PLSV-------EWRT----PDGRNRPSHVWLCDLPAASLND 311

Query: 354 IISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSL 413
            +              FRV     ++Q      KE +  +D          +DS+    L
Sbjct: 312 QLPQ----------HTFRVIWTGSDSQ------KECVLLKDRP----ECWCRDSATDEQL 351

Query: 414 YQLSIKNDNELTDFEWRAATIAKEIDHFRELLSL-INCKIGKLTLARLLMAHDAMMCPPA 472
           ++  +  +        ++  +  E++  +EL  L    K   LT+  L+ A D ++    
Sbjct: 352 FRCELSVE--------KSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLL---- 399

Query: 473 NKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNR 532
               + +E L+ ++ L  +DP    Y  D  S  LL+      E    R  H ++     
Sbjct: 400 ----YEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAHK---- 451

Query: 533 GSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSI-EGLEALQLLSCLNLSNNILGS 591
                       L+ L   ++LL V  LDLSHN LR++   L AL+ L  L  S+N L +
Sbjct: 452 -----------DLTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALEN 500

Query: 592 FTALEPIRQLKSLRALNISYNEIGA 616
              +  + +L+ L   N    +  A
Sbjct: 501 VDGVANLPRLQELLLCNNRLQQSAA 525




Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
Rattus norvegicus (taxid: 10116)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 6EC: 0
>sp|Q9JHK4|PGTA_MOUSE Geranylgeranyl transferase type-2 subunit alpha OS=Mus musculus GN=Rabggta PE=1 SV=1 Back     alignment and function description
>sp|Q5NVK5|PGTA_PONAB Geranylgeranyl transferase type-2 subunit alpha OS=Pongo abelii GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|A5A779|PGTA_PIG Geranylgeranyl transferase type-2 subunit alpha OS=Sus scrofa GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|Q92696|PGTA_HUMAN Geranylgeranyl transferase type-2 subunit alpha OS=Homo sapiens GN=RABGGTA PE=1 SV=2 Back     alignment and function description
>sp|Q5EA80|PGTA_BOVIN Geranylgeranyl transferase type-2 subunit alpha OS=Bos taurus GN=RABGGTA PE=2 SV=1 Back     alignment and function description
>sp|O94412|PGTA_SCHPO Geranylgeranyl transferase type-2 subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet4 PE=3 SV=1 Back     alignment and function description
>sp|Q55DQ4|PGTA_DICDI Geranylgeranyl transferase type-2 subunit alpha OS=Dictyostelium discoideum GN=rabggta PE=3 SV=2 Back     alignment and function description
>sp|Q00618|PGTA_YEAST Geranylgeranyl transferase type-2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET4 PE=1 SV=3 Back     alignment and function description
>sp|O93829|PGTA_CANAX Geranylgeranyl transferase type-2 subunit alpha OS=Candida albicans GN=BET4 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
224092154696 predicted protein [Populus trichocarpa] 0.992 0.997 0.663 0.0
225459067704 PREDICTED: uncharacterized protein LOC10 1.0 0.992 0.677 0.0
255545992696 protein with unknown function [Ricinus c 0.992 0.997 0.663 0.0
356515736691 PREDICTED: uncharacterized protein LOC10 0.985 0.997 0.597 0.0
356510126691 PREDICTED: uncharacterized protein LOC10 0.985 0.997 0.602 0.0
357465223705 Geranylgeranyl transferase type-2 subuni 0.978 0.970 0.573 0.0
449433595695 PREDICTED: geranylgeranyl transferase ty 0.979 0.985 0.592 0.0
297799558677 protein binding protein [Arabidopsis lyr 0.959 0.991 0.572 0.0
79485405678 RAB geranylgeranyl transferase alpha sub 0.964 0.994 0.566 0.0
7269299661 Rab geranylgeranyl transferase like prot 0.938 0.992 0.565 0.0
>gi|224092154|ref|XP_002309487.1| predicted protein [Populus trichocarpa] gi|222855463|gb|EEE93010.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/701 (66%), Positives = 558/701 (79%), Gaps = 7/701 (0%)

Query: 1   MHGRPRKPLKPEDAAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
           MHGRPRK  KPED AAS AKAEKLR+LQSQFL NHH  IY+KEA+ELS+KLLE NPE YT
Sbjct: 1   MHGRPRKAPKPEDLAASTAKAEKLRILQSQFLLNHHQKIYTKEALELSSKLLEINPECYT 60

Query: 61  AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS 120
           AWNYRK AVQH L E++ DPDS+ SILD+ELRVVE+ALRQNFKSYGAW+HRKW+L+KGHS
Sbjct: 61  AWNYRKHAVQHSLFESNLDPDSVNSILDQELRVVENALRQNFKSYGAWYHRKWVLNKGHS 120

Query: 121 SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNYSAWHN 180
           S +NELRLLDK Q  D RNFHAWNYRRFVAA +NRS+EDEL +T+D I  NFSNYSAWHN
Sbjct: 121 STENELRLLDKLQNVDPRNFHAWNYRRFVAALLNRSDEDELNHTQDFIDKNFSNYSAWHN 180

Query: 181 RSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQTVRVDSP 240
           RS+L+SNL+K+KV+ F  K++VL  EYE V +A+FTD DDQSGWFYHLWLLDQTV+ +SP
Sbjct: 181 RSVLVSNLMKKKVQAFSRKDEVLIREYELVREAVFTDEDDQSGWFYHLWLLDQTVKAESP 240

Query: 241 QLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVD 300
            L SSWP  GS++ L GDR LD  +SSPF     DS + PL+LYFNQAVEGVN+ST+TV 
Sbjct: 241 LLASSWPAHGSEITLSGDRYLDLGSSSPFNTNQFDSGSLPLILYFNQAVEGVNASTVTVS 300

Query: 301 SELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGF 360
           S LN N D++WKP+ S NS+  QVWV QL  P+    S   + +EV+LGHSQGIISSSGF
Sbjct: 301 SGLNVNMDVIWKPILSNNSRTTQVWVGQLKFPEVELDSLGAYTMEVTLGHSQGIISSSGF 360

Query: 361 HYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSLYQLSIKN 420
           HYS+P  F+F V +   +T+PVE LG E ISWRDE+FH Y + S +S+ +  L  LSIKN
Sbjct: 361 HYSHPSHFSFTVHVLPAKTEPVEGLGSEKISWRDENFHIYESDSLESNSVLPLDHLSIKN 420

Query: 421 DNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLARLLMAHDAMMCPPANKISHSEE 480
           + E T   W+A  I +EI +FRELL   +CKIGKLTLARLL A DA+M   ++K  HSEE
Sbjct: 421 EREPTHSSWQAKIIDEEISNFRELL---DCKIGKLTLARLLTARDALMS--SDKPVHSEE 475

Query: 481 VLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSN-SPSNRGSPMCLQ 539
           VL LY++LM+LDP H ++YKD+HSLVLL++V S  ESLLS CF Y N + S+  +P+CL+
Sbjct: 476 VLRLYSELMKLDPPHSRFYKDEHSLVLLEKVISGRESLLSYCFRYRNLTSSSSSNPICLR 535

Query: 540 LKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSCLNLSNNILGSFTALEPIR 599
           L  LSLSRLGSF+KLLWVQMLDLSHNEL+SIEGLEA+QLLS LNLS N  GSFT+LEP+R
Sbjct: 536 LNGLSLSRLGSFEKLLWVQMLDLSHNELQSIEGLEAMQLLSHLNLSKNKFGSFTSLEPLR 595

Query: 600 QLKSLRALNISYNEIGAHSIDTTKYLCSSPLSHSVGSEWNHGQTVIDD-DIKSYWEAYFI 658
            LKS++ L++SYNEIG+HSIDTT+YLCSSPL HSVGSEW+  +TV D   + SYWEA+FI
Sbjct: 596 HLKSMKVLDLSYNEIGSHSIDTTRYLCSSPLCHSVGSEWDGSETVTDGVSLVSYWEAFFI 655

Query: 659 LKGLNLTQFDIVGNAIVNEKFKSFLIKVLPGLKWLDGEQLH 699
           L+GL LTQ DI GNAI +EKF +FL KVLP LKWLDG QL+
Sbjct: 656 LRGLKLTQIDIAGNAIADEKFTAFLAKVLPALKWLDGVQLN 696




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225459067|ref|XP_002283768.1| PREDICTED: uncharacterized protein LOC100248920 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255545992|ref|XP_002514056.1| protein with unknown function [Ricinus communis] gi|223547142|gb|EEF48639.1| protein with unknown function [Ricinus communis] Back     alignment and taxonomy information
>gi|356515736|ref|XP_003526554.1| PREDICTED: uncharacterized protein LOC100783193 [Glycine max] Back     alignment and taxonomy information
>gi|356510126|ref|XP_003523791.1| PREDICTED: uncharacterized protein LOC100807900 [Glycine max] Back     alignment and taxonomy information
>gi|357465223|ref|XP_003602893.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] gi|355491941|gb|AES73144.1| Geranylgeranyl transferase type-2 subunit alpha [Medicago truncatula] Back     alignment and taxonomy information
>gi|449433595|ref|XP_004134583.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] gi|449490592|ref|XP_004158649.1| PREDICTED: geranylgeranyl transferase type-2 subunit alpha-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297799558|ref|XP_002867663.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] gi|297313499|gb|EFH43922.1| protein binding protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|79485405|ref|NP_194180.2| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|145334125|ref|NP_001078443.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|18176361|gb|AAL60030.1| putative Rab geranylgeranyl transferase [Arabidopsis thaliana] gi|21436465|gb|AAM51433.1| putative rab geranylgeranyl transferase [Arabidopsis thaliana] gi|332659513|gb|AEE84913.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] gi|332659514|gb|AEE84914.1| RAB geranylgeranyl transferase alpha subunit 1 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|7269299|emb|CAB79359.1| Rab geranylgeranyl transferase like protein (fragment) [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query699
TAIR|locus:2153015687 RGTA2 "RAB geranylgeranyl tran 0.944 0.960 0.473 5e-147
TAIR|locus:2121860678 RGTA1 "RAB geranylgeranyl tran 0.792 0.817 0.467 2e-127
RGD|621697567 Rabggta "Rab geranylgeranyltra 0.391 0.483 0.369 1.7e-45
MGI|MGI:1860443567 Rabggta "Rab geranylgeranyl tr 0.327 0.403 0.403 1.5e-44
UNIPROTKB|Q5EA80567 RABGGTA "Geranylgeranyl transf 0.327 0.403 0.394 7.2e-41
UNIPROTKB|F1PIE1567 RABGGTA "Uncharacterized prote 0.327 0.403 0.394 1.2e-40
UNIPROTKB|Q92696567 RABGGTA "Geranylgeranyl transf 0.327 0.403 0.390 1.5e-40
UNIPROTKB|A5A779567 RABGGTA "Geranylgeranyl transf 0.327 0.403 0.386 2.5e-39
DICTYBASE|DDB_G0269570311 rabggta "protein geranylgerany 0.277 0.623 0.383 6.7e-38
ZFIN|ZDB-GENE-060929-1042580 rabggta "Rab geranylgeranyltra 0.253 0.305 0.353 8.7e-38
TAIR|locus:2153015 RGTA2 "RAB geranylgeranyl transferase alpha subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1436 (510.6 bits), Expect = 5.0e-147, P = 5.0e-147
 Identities = 342/723 (47%), Positives = 452/723 (62%)

Query:     1 MHGRPRKPLKPEDXXXXXXXXEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYT 60
             MHGR R+   P          E LR LQSQF+ NHH  IY+KEA++LS KLL TNPE YT
Sbjct:     1 MHGRKREE-DPNPEETAAKALE-LRSLQSQFMSNHHQKIYTKEAIQLSAKLLITNPEFYT 58

Query:    61 AWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSK-GH 119
             AWNY KLA + +L E DSDP  + SI+DEEL VV++AL +N KSYGAW+HRKW+LSK GH
Sbjct:    59 AWNYPKLAFESRLDE-DSDPSLVNSIIDEELGVVQNALERNVKSYGAWYHRKWVLSKKGH 117

Query:   120 --SSIDNELRLLDKFQKA-----D-------SRNFHAWNYRRFVAASMNRSEEDELKYTE 165
                S++NEL+LL+ +QK      D       SRNFHAWNYRRFV      SEEDEL+YT 
Sbjct:   118 YYPSLENELQLLNDYQKQAHQKQDDEKQDDPSRNFHAWNYRRFVVELTKTSEEDELQYTT 177

Query:   166 DMICN-NFSNYSAWHXXXXXXXXXXXXXVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGW 224
             DMI + +F+ YSAWH              +GF+ KE +   E ++VH AIFT  + QSGW
Sbjct:   178 DMISDISFTIYSAWHYRSVLVSSLVAKKADGFMPKETIRR-ELDYVHSAIFTLEEKQSGW 236

Query:   225 FYHLWLLDQTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSP-FTRFHLDSRTFPLVL 283
             FY+LWLLDQTV+++ P   SSWP+ GS +IL G  C +  +S+   T F  +S +FPL+L
Sbjct:   237 FYYLWLLDQTVKMEIPLRFSSWPSDGSIIILSGPDCFNASSSTTKLTTFCSESGSFPLIL 296

Query:   284 YFNQAVEGVNSSTITVDSELNTNKDLVWKPLSSC-NSKAAQ-VWVTQLNLPDGNT-HSSK 340
             YF+QAV GV+SST+T+ SEL   KDLVW+P+S   NS+    VWV +L         S K
Sbjct:   297 YFDQAVSGVSSSTVTIGSEL---KDLVWEPVSDKKNSQVDSCVWVARLKFDCREPCFSRK 353

Query:   341 VFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKE-IISWRDESFHN 399
                V+VSLG   GI+SS G + + P+ F F  +L+  +T  VE   +E I+SW D  F N
Sbjct:   354 ETKVKVSLG---GIVSSMGCNLTAPYEFVF--TLRIHDTVEVELSQQESIVSWTD-GFDN 407

Query:   400 YNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLSLINCKIGKLTLAR 459
             ++ ++  S+ ++SL  L     N  T FEWR   I  EI+ FR   +L + KIGKL LAR
Sbjct:   408 WDDNAL-SNDLNSLTAL-----NADTGFEWRKKAIKIEIELFR---TLPDSKIGKLILAR 458

Query:   460 LLMAHDAMMCPPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLL 519
             LLMA + M+   +N + H +E+L+LYNDLM LD  H QYYKD+HS+ L+ +VTS  ES+ 
Sbjct:   459 LLMAEETMI---SNGV-HYKEILQLYNDLMALDSWHNQYYKDEHSVALIHKVTSRTESMS 514

Query:   520 SRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSIEGXXXXXXX 579
                F Y N      + +CL+L NL+LSR+ + +KLL+VQMLDLSHNEL S EG       
Sbjct:   515 RHLFRYRNM----NNIICLRLNNLTLSRIAAVEKLLFVQMLDLSHNELHSAEGLEAMQLL 570

Query:   580 XXXXXXXXXXXXFTALEPIRQLKSLRALNISYNEI-GAHSIDTTKYLCSSPLSHSVGSEW 638
                         F+AL+ +R LK LR L++S+N I G   +DTT+YLCSSPLS+S     
Sbjct:   571 CCLNLSHNRIRSFSALDSLRHLKQLRVLDVSHNHICGELPVDTTRYLCSSPLSNS----- 625

Query:   639 NHGQTVIDDDIKSYWEAYFILKGL-NLTQFDIVGNAIV--NEKFKSFLIKVLPGLKWLDG 695
               G+T  +   K Y +AY +L+ L  L Q DI GN ++   E+F SF+ +V+P L WLDG
Sbjct:   626 --GETGREVPNK-YQDAYLVLRDLMKLKQLDIRGNDLIFAGEEFSSFVRQVVPKLVWLDG 682

Query:   696 EQL 698
              +L
Sbjct:   683 HKL 685




GO:0005886 "plasma membrane" evidence=ISM
GO:0008318 "protein prenyltransferase activity" evidence=IEA
GO:0018342 "protein prenylation" evidence=IEA
TAIR|locus:2121860 RGTA1 "RAB geranylgeranyl transferase alpha subunit 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
RGD|621697 Rabggta "Rab geranylgeranyltransferase, alpha subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1860443 Rabggta "Rab geranylgeranyl transferase, a subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q5EA80 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIE1 RABGGTA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q92696 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5A779 RABGGTA "Geranylgeranyl transferase type-2 subunit alpha" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269570 rabggta "protein geranylgeranyltransferase type II" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1042 rabggta "Rab geranylgeranyltransferase, alpha subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.5.10.691

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00061586
hypothetical protein (696 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
COG5536328 COG5536, BET4, Protein prenyltransferase, alpha su 2e-44
PLN02789320 PLN02789, PLN02789, farnesyltranstransferase 5e-24
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 1e-05
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 7e-05
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 2e-04
pfam0123930 pfam01239, PPTA, Protein prenyltransferase alpha s 6e-04
COG5536328 COG5536, BET4, Protein prenyltransferase, alpha su 7e-04
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
>gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score =  161 bits (409), Expect = 2e-44
 Identities = 72/200 (36%), Positives = 108/200 (54%), Gaps = 13/200 (6%)

Query: 39  IYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESAL 98
            YS  A++L+ +L++ NPE YT WNYR   ++H    ++        +LD EL  ++ AL
Sbjct: 46  EYSVRALKLTQELIDKNPEFYTIWNYRFSILKHVQMVSEDKEH----LLDNELDFLDEAL 101

Query: 99  RQNFKSYGAWHHRKWILSK-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSE 157
           + N K+Y  WHHR+W+L      S   EL +  K   +DSRN+H W+YRR+V  ++    
Sbjct: 102 KDNPKNYQIWHHRQWMLELFPKPSWGRELFITKKLLDSDSRNYHVWSYRRWVLRTIEDLF 161

Query: 158 -----EDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQ 212
                + EL+YT  +I  +  N SAWH+R + +     R   G V  +K L  E E++  
Sbjct: 162 NFSDLKHELEYTTSLIETDIYNNSAWHHRYIWIERRFNR---GDVISQKYLEKELEYIFD 218

Query: 213 AIFTDPDDQSGWFYHLWLLD 232
            IFTDPD+QS W Y   +  
Sbjct: 219 KIFTDPDNQSVWGYLRGVSS 238


Length = 328

>gnl|CDD|215423 PLN02789, PLN02789, farnesyltranstransferase Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|201678 pfam01239, PPTA, Protein prenyltransferase alpha subunit repeat Back     alignment and domain information
>gnl|CDD|227823 COG5536, BET4, Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 699
KOG0529421 consensus Protein geranylgeranyltransferase type I 100.0
KOG0530318 consensus Protein farnesyltransferase, alpha subun 100.0
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 100.0
PLN02789320 farnesyltranstransferase 100.0
PLN02789320 farnesyltranstransferase 99.94
KOG0529421 consensus Protein geranylgeranyltransferase type I 99.91
KOG0530318 consensus Protein farnesyltransferase, alpha subun 99.86
COG5536328 BET4 Protein prenyltransferase, alpha subunit [Pos 99.72
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.57
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.53
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.49
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.43
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 99.41
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.3
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.26
PF07711102 RabGGT_insert: Rab geranylgeranyl transferase alph 99.22
PRK15359144 type III secretion system chaperone protein SscB; 99.21
PRK15359144 type III secretion system chaperone protein SscB; 99.17
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.16
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.13
PRK12370553 invasion protein regulator; Provisional 99.13
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.1
KOG0617264 consensus Ras suppressor protein (contains leucine 99.08
PRK11189296 lipoprotein NlpI; Provisional 99.07
PRK11189296 lipoprotein NlpI; Provisional 99.06
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.02
PRK12370553 invasion protein regulator; Provisional 99.01
KOG0617264 consensus Ras suppressor protein (contains leucine 99.01
KOG0472 565 consensus Leucine-rich repeat protein [Function un 99.0
KOG1126638 consensus DNA-binding cell division cycle control 98.95
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.94
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.94
KOG4626966 consensus O-linked N-acetylglucosamine transferase 98.93
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.91
KOG1126638 consensus DNA-binding cell division cycle control 98.91
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 98.89
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 98.88
PRK15174656 Vi polysaccharide export protein VexE; Provisional 98.86
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.85
PRK15174656 Vi polysaccharide export protein VexE; Provisional 98.83
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.82
KOG0547606 consensus Translocase of outer mitochondrial membr 98.76
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 98.75
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.74
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 98.71
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.67
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.65
PRK10370198 formate-dependent nitrite reductase complex subuni 98.65
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 98.65
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.65
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.64
PRK10370198 formate-dependent nitrite reductase complex subuni 98.62
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.62
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 98.62
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.61
KOG0553304 consensus TPR repeat-containing protein [General f 98.59
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 98.57
PRK114471157 cellulose synthase subunit BcsC; Provisional 98.56
KOG1125579 consensus TPR repeat-containing protein [General f 98.54
PRK11788389 tetratricopeptide repeat protein; Provisional 98.53
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.53
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 98.52
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.52
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 98.51
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 98.5
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.5
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.5
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.48
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.47
KOG0553304 consensus TPR repeat-containing protein [General f 98.47
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.46
PRK11788389 tetratricopeptide repeat protein; Provisional 98.45
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.45
KOG0547606 consensus Translocase of outer mitochondrial membr 98.44
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.39
PRK10049765 pgaA outer membrane protein PgaA; Provisional 98.32
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.31
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.29
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.28
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.28
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.27
KOG2076895 consensus RNA polymerase III transcription factor 98.27
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.26
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.25
KOG2123 388 consensus Uncharacterized conserved protein [Funct 98.21
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.21
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.19
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.18
KOG4237 498 consensus Extracellular matrix protein slit, conta 98.16
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.16
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.14
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.14
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.13
PLN03150623 hypothetical protein; Provisional 98.13
PRK14574 822 hmsH outer membrane protein; Provisional 98.13
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.12
KOG2982 418 consensus Uncharacterized conserved protein [Funct 98.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.09
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.09
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.06
KOG0531 414 consensus Protein phosphatase 1, regulatory subuni 98.06
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 98.03
KOG3060289 consensus Uncharacterized conserved protein [Funct 97.96
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.93
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.92
KOG2076 895 consensus RNA polymerase III transcription factor 97.89
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.81
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.8
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.8
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.8
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 97.78
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.74
PLN03150623 hypothetical protein; Provisional 97.74
KOG4234271 consensus TPR repeat-containing protein [General f 97.72
KOG2739 260 consensus Leucine-rich acidic nuclear protein [Cel 97.7
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.7
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.7
KOG3207 505 consensus Beta-tubulin folding cofactor E [Posttra 97.69
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.67
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.65
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.64
PRK11906458 transcriptional regulator; Provisional 97.63
PRK11906458 transcriptional regulator; Provisional 97.6
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 97.59
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 97.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.58
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.58
KOG1125579 consensus TPR repeat-containing protein [General f 97.56
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.55
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.52
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.47
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.47
PRK14574822 hmsH outer membrane protein; Provisional 97.47
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.46
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.41
KOG0495913 consensus HAT repeat protein [RNA processing and m 97.39
KOG1909 382 consensus Ran GTPase-activating protein [RNA proce 97.39
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.38
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 97.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.29
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.24
CHL00033168 ycf3 photosystem I assembly protein Ycf3 97.23
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.23
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.22
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 97.22
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.19
KOG1156700 consensus N-terminal acetyltransferase [Chromatin 97.19
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.16
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 97.12
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.11
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.01
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.0
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 96.92
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 96.91
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 96.9
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.89
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.87
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 96.84
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.83
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 96.79
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.75
PRK10803263 tol-pal system protein YbgF; Provisional 96.75
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.74
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.7
KOG4234271 consensus TPR repeat-containing protein [General f 96.69
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.66
PF1337173 TPR_9: Tetratricopeptide repeat 96.64
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 96.64
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.55
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.55
KOG1128777 consensus Uncharacterized conserved protein, conta 96.51
PF1337173 TPR_9: Tetratricopeptide repeat 96.5
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 96.47
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 96.43
PRK10747398 putative protoheme IX biogenesis protein; Provisio 96.26
KOG2376652 consensus Signal recognition particle, subunit Srp 96.19
PF06552186 TOM20_plant: Plant specific mitochondrial import r 96.14
PRK10803263 tol-pal system protein YbgF; Provisional 96.14
KOG1129478 consensus TPR repeat-containing protein [General f 96.11
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.04
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.02
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.01
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.98
KOG2003840 consensus TPR repeat-containing protein [General f 95.91
PF06552186 TOM20_plant: Plant specific mitochondrial import r 95.91
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.89
KOG2982 418 consensus Uncharacterized conserved protein [Funct 95.89
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 95.81
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 95.78
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 95.67
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.66
COG0457291 NrfG FOG: TPR repeat [General function prediction 95.66
KOG2123 388 consensus Uncharacterized conserved protein [Funct 95.61
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.46
PF12688120 TPR_5: Tetratrico peptide repeat 95.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.3
KOG0495913 consensus HAT repeat protein [RNA processing and m 95.18
KOG3763 585 consensus mRNA export factor TAP/MEX67 [RNA proces 95.15
KOG4658 889 consensus Apoptotic ATPase [Signal transduction me 95.1
COG4235287 Cytochrome c biogenesis factor [Posttranslational 94.94
KOG1128777 consensus Uncharacterized conserved protein, conta 94.85
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 94.73
PF1343134 TPR_17: Tetratricopeptide repeat 94.66
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 94.6
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 94.38
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 94.37
PF1343134 TPR_17: Tetratricopeptide repeat 94.3
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.28
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 94.22
KOG2003840 consensus TPR repeat-containing protein [General f 94.21
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 94.17
KOG1308377 consensus Hsp70-interacting protein Hip/Transient 94.12
KOG4555175 consensus TPR repeat-containing protein [Function 93.77
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 93.69
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 93.31
PRK15331165 chaperone protein SicA; Provisional 93.15
PF12688120 TPR_5: Tetratrico peptide repeat 93.06
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 92.91
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.69
KOG2376652 consensus Signal recognition particle, subunit Srp 92.49
KOG4648536 consensus Uncharacterized conserved protein, conta 92.45
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 92.12
KOG4648536 consensus Uncharacterized conserved protein, conta 92.12
PRK15386 426 type III secretion protein GogB; Provisional 91.91
KOG0473 326 consensus Leucine-rich repeat protein [Function un 91.61
PF1342844 TPR_14: Tetratricopeptide repeat 91.57
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 91.37
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 91.07
PF1342844 TPR_14: Tetratricopeptide repeat 90.68
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 90.68
PRK15331165 chaperone protein SicA; Provisional 90.36
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.25
KOG4555175 consensus TPR repeat-containing protein [Function 90.12
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 90.04
KOG0376476 consensus Serine-threonine phosphatase 2A, catalyt 89.69
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 89.3
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 89.17
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 89.15
PRK15386 426 type III secretion protein GogB; Provisional 89.06
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 88.43
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 88.43
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 88.17
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 87.64
KOG4642284 consensus Chaperone-dependent E3 ubiquitin protein 87.48
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 87.25
KOG1310758 consensus WD40 repeat protein [General function pr 87.0
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 86.06
PLN03077857 Protein ECB2; Provisional 85.83
KOG1129478 consensus TPR repeat-containing protein [General f 85.67
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 84.91
PLN032181060 maturation of RBCL 1; Provisional 84.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.8
smart0037026 LRR Leucine-rich repeats, outliers. 84.8
KOG2053 932 consensus Mitochondrial inheritance and actin cyto 84.8
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 84.66
KOG0473 326 consensus Leucine-rich repeat protein [Function un 83.29
PF13512142 TPR_18: Tetratricopeptide repeat 83.11
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 82.81
PRK10941269 hypothetical protein; Provisional 82.46
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 82.11
PLN032181060 maturation of RBCL 1; Provisional 81.98
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 81.87
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 81.21
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 81.1
PF13512142 TPR_18: Tetratricopeptide repeat 80.68
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 80.46
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=100.00  E-value=4.4e-64  Score=523.78  Aligned_cols=409  Identities=44%  Similarity=0.698  Sum_probs=320.5

Q ss_pred             CCCCcCC-CCChHHHHH---HHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccC
Q 005381            1 MHGRPRK-PLKPEDAAA---SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN   76 (699)
Q Consensus         1 mhg~~~~-~~~~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~   76 (699)
                      ||||+|+ ++++|.+++   +.+++..|+..+++|..+++.++||+++++++.++|..||++|++||||+.++.......
T Consensus         1 Mhg~~kv~~~eee~~~k~~~~~~k~~~~~~~~s~i~~~r~~~~yd~e~l~lt~~ll~~npe~~t~wN~Rr~~~~~r~~~~   80 (421)
T KOG0529|consen    1 MHGRLKVKTTEEEKEAKLKERAFKAGQLRSLFSIIQKKREAKEYDEEHLELTSELLEKNPEFYTVWNYRRLIIEERLTRA   80 (421)
T ss_pred             CCcccccCccchhHHHHHHHHHHHHHHHHHHHHHHHHHHhccccchHHHHHHHHHHhhCchhhhhhhhHHHHHHHhhhhh
Confidence            9999998 556666664   466688888889999999999999999999999999999999999999999998876534


Q ss_pred             CCCchhhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCCC-ChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCC
Q 005381           77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGHS-SIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR  155 (699)
Q Consensus        77 ~~~~~~~~~~~~eEL~~~~~~L~~nPKsy~aW~hR~w~L~~~~~-~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~  155 (699)
                      +.+|.+.+..+++||.+++.||+.|||+|.+||||+|+|++.+. .+..||.+|+++|+.||||||||+|||||+.+..+
T Consensus        81 ~~~~~ek~~~ld~eL~~~~~~L~~npksY~aW~hR~w~L~~~p~~~~~~EL~lcek~L~~D~RNfh~W~YRRfV~~~~~~  160 (421)
T KOG0529|consen   81 QLEPLEKQALLDEELKYVESALKVNPKSYGAWHHRKWVLQKNPHSDWNTELQLCEKALKQDPRNFHAWHYRRFVVEQAER  160 (421)
T ss_pred             cCCHHHHHHhhHHHHHHHHHHHHhCchhHHHHHHHHHHHHhCCCchHHHHHHHHHHHHhcCcccccchHHHHHHHHHHhc
Confidence            56677888899999999999999999999999999999997654 49999999999999999999999999999999988


Q ss_pred             C---hHHHHHHHHHHHHhccCchHHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHc
Q 005381          156 S---EEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLD  232 (699)
Q Consensus       156 ~---~e~EL~~~~~~I~~n~sN~SAW~~R~~ll~~l~~~~~~~~~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~  232 (699)
                      .   +.+|++||+++|..||+||||||||+.+|+.+.+++..|.....+.+..|++.+++|+|+||+|+|+|+|++|||+
T Consensus       161 ~~~~~~~El~ftt~~I~~nfSNYsaWhyRs~lL~~l~~~~~~g~~~~~~~l~sEle~v~saiFTdp~DqS~WfY~rWLl~  240 (421)
T KOG0529|consen  161 SRNLEKEELEFTTKLINDNFSNYSAWHYRSLLLSTLHPKEADGNFMPKELLQSELEMVHSAIFTDPEDQSCWFYHRWLLG  240 (421)
T ss_pred             ccccchhHHHHHHHHHhccchhhhHHHHHHHHHHHhccccccCccCCHHHHHHHHHHHHHHHhcCccccceeeehHHhhc
Confidence            7   7899999999999999999999999999999998877774334466799999999999999999999999999999


Q ss_pred             CcCCCCCCcccccCCCCCCcceecCCccccCCCCCCCccccCCCCccceEEeeccccccccccceEEecccCCCccceee
Q 005381          233 QTVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVNSSTITVDSELNTNKDLVWK  312 (699)
Q Consensus       233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~w~  312 (699)
                      ++.+.+                     |..++.    +.+++.++.+|.+.+|...+.++.+   ++.++        |+
T Consensus       241 ~~~~~~---------------------~~~~S~----s~~ls~~~~~p~~~~l~~e~~~v~~---~i~~E--------~~  284 (421)
T KOG0529|consen  241 RGMRRE---------------------CYIVSH----SALLSESFSEPLIKYLRSEIGLVQS---TIGSE--------FE  284 (421)
T ss_pred             cccccc---------------------cccccc----ccccccccCCccHHHHHHHhhhhhh---hhhhh--------cc
Confidence            987655                     111111    1345667788899999888877643   33333        33


Q ss_pred             e-CCCCCCccceeEEEeccCCCCCCCCCCccceEEecCcccccccCCCCccCCCccceEEEEEeecccccccccccceee
Q 005381          313 P-LSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIIS  391 (699)
Q Consensus       313 ~-~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  391 (699)
                      + ++..+      |+|..+..                             |..|.+ ++.|++.-.+  .    ..+..+
T Consensus       285 ~~~d~~g------w~~~~~~n-----------------------------~~s~~~-~~~v~~~~e~--~----~~~~~~  322 (421)
T KOG0529|consen  285 TPIDKRG------WLCESLVN-----------------------------LESPYE-TKRVHLTVED--Q----QFGIVS  322 (421)
T ss_pred             ccccccC------chhccccc-----------------------------hhhhhh-cccccccccc--c----cccccc
Confidence            3 22222      77765541                             122333 2333332211  1    112334


Q ss_pred             ccCCCccccc-cccCCCCCccccccccccccCccchhhhhHHHHHHHHHHHHhhhh-ccccccccccHHHHHhhcccCCC
Q 005381          392 WRDESFHNYN-AHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLS-LINCKIGKLTLARLLMAHDAMMC  469 (699)
Q Consensus       392 ~~~~~~~~~~-~~~~~~~~l~~~~~lsi~~~~~~~~~~~~~~~L~~el~~~~~L~~-~p~nk~~~Ltl~~ll~~~~~l~~  469 (699)
                      |.+ .++.+. +..   ..+-+++      -+.+    .....|+++|++|.+|++ +|++||++++.++++++.++|. 
T Consensus       323 ~~~-~~e~~~~~~~---~~l~~~~------~~e~----~~~a~lqe~ie~c~~l~~~~P~~k~~~l~~~~l~~a~e~~~-  387 (421)
T KOG0529|consen  323 WVA-SNEQWLHALL---DDLDSLD------CNEE----TRRAWLQEQIESCVELQELLPDSKWGLLTSALLLRALEPMD-  387 (421)
T ss_pred             chh-hhhhhHHHHh---hhccccc------hhhh----ccHHHHHHHHHHHHHHHhhCCccchhHHHHHHHHhcccccc-
Confidence            433 223222 111   1111221      1122    366789999999999999 9999999999999999999974 


Q ss_pred             CCCCcCCCcHHHHHhcccccccCCCCCccccchhhhHHhh
Q 005381          470 PPANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQ  509 (699)
Q Consensus       470 ~~~~~~~~~~~~l~~l~~L~~LDls~n~~~~~l~sl~~l~  509 (699)
                             +.+++++.++.|+.+|+.+.+||+++++.+.++
T Consensus       388 -------~~~~~l~~~~~le~~d~~~~~yykdl~s~~~l~  420 (421)
T KOG0529|consen  388 -------SEEEILQLYNDLEALDPGRHQYYKDLHSRFLLE  420 (421)
T ss_pred             -------chHHHHHHHHHHhccchhhhHHHHhHHHHhccC
Confidence                   348899999999999999999999999987653



>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0529 consensus Protein geranylgeranyltransferase type II, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0530 consensus Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5536 BET4 Protein prenyltransferase, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF07711 RabGGT_insert: Rab geranylgeranyl transferase alpha-subunit, insert domain ; InterPro: IPR009087 Rab geranylgeranyltransferase (RabGGT) catalyses the transfer of geranylgeranyl groups to the C-terminal cysteine residues of Rab proteins, Ras-related small GTPases that function in intracellular vesicular transport [] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1308 consensus Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4648 consensus Uncharacterized conserved protein, contains LRR repeats [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG0376 consensus Serine-threonine phosphatase 2A, catalytic subunit [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4642 consensus Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG1310 consensus WD40 repeat protein [General function prediction only] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2053 consensus Mitochondrial inheritance and actin cytoskeleton organization protein [Cytoskeleton] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
1ltx_A567 Structure Of Rab Escort Protein-1 In Complex With R 3e-42
1dce_A567 Crystal Structure Of Rab Geranylgeranyltransferase 2e-41
4ehm_A330 Rabggtase In Complex With Covalently Bound Psoromic 8e-38
3pz1_A332 Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) 8e-38
3dss_A331 Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) 9e-38
3c72_A334 Engineered Rabggtase In Complex With A Peptidomimet 1e-37
1o1r_A380 Structure Of Fpt Bound To Ggpp Length = 380 2e-11
1o5m_A377 Structure Of Fpt Bound To The Inhibitor Sch66336 Le 2e-11
1qbq_A333 Structure Of Rat Farnesyl Protein Transferase Compl 2e-11
1nl4_A312 Crystal Structure Of Rat Farnesyl Transferase In Co 2e-11
2bed_A313 Structure Of Fpt Bound To Inhibitor Sch207736 Lengt 2e-11
2r2l_A315 Structure Of Farnesyl Protein Transferase Bound To 2e-11
1n95_A315 Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranf 2e-11
1ft1_A377 Crystal Structure Of Protein Farnesyltransferase At 3e-11
3pz4_A379 Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subu 3e-11
1ft2_A315 Co-Crystal Structure Of Protein Farnesyltransferase 3e-11
2f0y_A379 Crystal Structure Of Human Protein Farnesyltransfer 2e-10
1jcq_A382 Crystal Structure Of Human Protein Farnesyltransfer 2e-10
3dra_A306 Candida Albicans Protein Geranylgeranyltransferase- 1e-07
3q73_A349 Cryptococcus Neoformans Protein Farnesyltransferase 6e-06
3q73_A349 Cryptococcus Neoformans Protein Farnesyltransferase 9e-05
3sfx_A349 Cryptococcus Neoformans Protein Farnesyltransferase 7e-06
3sfx_A349 Cryptococcus Neoformans Protein Farnesyltransferase 9e-05
>pdb|1LTX|A Chain A, Structure Of Rab Escort Protein-1 In Complex With Rab Geranylgeranyl Transferase And Isoprenoid Length = 567 Back     alignment and structure

Iteration: 1

Score = 169 bits (429), Expect = 3e-42, Method: Compositional matrix adjust. Identities = 162/578 (28%), Positives = 239/578 (41%), Gaps = 108/578 (18%) Query: 1 MHGRPRKPLKPEDXXXXXXXXE-KLRVLQSQ---FLHNHHNHIYSKEAVELSTKLLETNP 56 MHGR + E E KL++ QS + +EL++++L NP Sbjct: 1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60 Query: 57 ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116 + T WN R+ +QH E + P+ +++ EL +ES LR N KSYG WHHR W+LS Sbjct: 61 DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118 Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175 + + EL L +F +AD RNFH W+YRRFVAA + +EL +T+ +I NFSNY Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178 Query: 176 SAWHXXXXXXXXXXXXXVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233 S+WH G + E VL E E V A FTDP+DQS WFYH WLL + Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238 Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN 293 D V + + CL C S P T + SR L+L ++A Sbjct: 239 AEPHDVLCCVH---------VSREEACLSVCFSRPLT---VGSRMGTLLLMVDEA----- 281 Query: 294 SSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQG 353 PLS W T PDG S V+ ++ Sbjct: 282 -------------------PLSV-------EWRT----PDGRNRPSHVWLCDLPAASLND 311 Query: 354 IISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSL 413 + FRV ++Q KE + +D +DS+ L Sbjct: 312 QLPQ----------HTFRVIWTGSDSQ------KECVLLKDRP----ECWCRDSATDEQL 351 Query: 414 YQLSIKNDNELTDFEWRAATIAKEIDHFRELLSL-INCKIGKLTLARLLMAHDAMMCPPA 472 ++ + + ++ + E++ +EL L K LT+ L+ A D ++ Sbjct: 352 FRCELSVE--------KSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLL---- 399 Query: 473 NKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNR 532 + +E L+ ++ L +DP Y D S LL+ E R H ++ Sbjct: 400 ----YEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAHK---- 451 Query: 533 GSPMCLQLKNLSLSRLGSFDKLLWVQMLDLSHNELRSI 570 L+ L ++LL V LDLSHN LR++ Sbjct: 452 -----------DLTVLCHLEQLLLVTHLDLSHNRLRAL 478
>pdb|1DCE|A Chain A, Crystal Structure Of Rab Geranylgeranyltransferase From Rat Brain Length = 567 Back     alignment and structure
>pdb|4EHM|A Chain A, Rabggtase In Complex With Covalently Bound Psoromic Acid Length = 330 Back     alignment and structure
>pdb|3PZ1|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) In Complex With Bms3 Length = 332 Back     alignment and structure
>pdb|3DSS|A Chain A, Crystal Structure Of Rabggtase(Delta Lrr; Delta Ig) Length = 331 Back     alignment and structure
>pdb|3C72|A Chain A, Engineered Rabggtase In Complex With A Peptidomimetic Inhibitor Length = 334 Back     alignment and structure
>pdb|1O1R|A Chain A, Structure Of Fpt Bound To Ggpp Length = 380 Back     alignment and structure
>pdb|1O5M|A Chain A, Structure Of Fpt Bound To The Inhibitor Sch66336 Length = 377 Back     alignment and structure
>pdb|1QBQ|A Chain A, Structure Of Rat Farnesyl Protein Transferase Complexed With A Cvim Peptide And Alpha-Hydroxyfarnesylphosphonic Acid Length = 333 Back     alignment and structure
>pdb|1NL4|A Chain A, Crystal Structure Of Rat Farnesyl Transferase In Complex With A Potent Biphenyl Inhibitor Length = 312 Back     alignment and structure
>pdb|2BED|A Chain A, Structure Of Fpt Bound To Inhibitor Sch207736 Length = 313 Back     alignment and structure
>pdb|2R2L|A Chain A, Structure Of Farnesyl Protein Transferase Bound To Pb-93 Length = 315 Back     alignment and structure
>pdb|1N95|A Chain A, Aryl Tetrahydrophyridine Inhbitors Of Farnesyltranferase: Glycine, Phenylalanine And Histidine Derivatives Length = 315 Back     alignment and structure
>pdb|1FT1|A Chain A, Crystal Structure Of Protein Farnesyltransferase At 2.25 Angstroms Resolution Length = 377 Back     alignment and structure
>pdb|3PZ4|A Chain A, Crystal Structure Of Ftase(Alpha-Subunit; Beta-Subunit Delta C10) In Complex With Bms3 And Lipid Substrate Fpp Length = 379 Back     alignment and structure
>pdb|1FT2|A Chain A, Co-Crystal Structure Of Protein Farnesyltransferase Complexed With A Farnesyl Diphosphate Substrate Length = 315 Back     alignment and structure
>pdb|2F0Y|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And Hydantoin Derivative Length = 379 Back     alignment and structure
>pdb|1JCQ|A Chain A, Crystal Structure Of Human Protein Farnesyltransferase Complexed With Farnesyl Diphosphate And The Peptidomimetic Inhibitor L-739,750 Length = 382 Back     alignment and structure
>pdb|3DRA|A Chain A, Candida Albicans Protein Geranylgeranyltransferase-I Complexed With Ggpp Length = 306 Back     alignment and structure
>pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 Back     alignment and structure
>pdb|3Q73|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase, Apo Enzyme Length = 349 Back     alignment and structure
>pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 Back     alignment and structure
>pdb|3SFX|A Chain A, Cryptococcus Neoformans Protein Farnesyltransferase In Complex With Fpt-Ii And Tipifarnib Length = 349 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query699
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-98
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 9e-70
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 4e-09
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 3e-07
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 9e-56
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 5e-11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 2e-55
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 2e-11
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 4e-07
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 2e-52
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 9e-22
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-12
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-10
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 8e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-09
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 4e-08
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 9e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-09
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-09
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 7e-08
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-07
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-10
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 2e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-08
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 5e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 6e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-09
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A 263 Internalin C; cellular invasion, leucine-rich repe 7e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 8e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-09
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 8e-09
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-08
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-08
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-07
1o6v_A 466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-04
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 9e-06
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-08
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-05
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-05
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-05
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 6e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 8e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-07
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-06
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 8e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-04
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 7e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-06
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 8e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 5e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-06
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 7e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-06
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 5e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 8e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-04
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 8e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 1e-04
3v6t_A499 DHAX3; tandem repeats, DNA specific binding protei 6e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 5e-04
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-04
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
 Score =  314 bits (804), Expect = 1e-98
 Identities = 154/633 (24%), Positives = 237/633 (37%), Gaps = 107/633 (16%)

Query: 1   MHGRPRKPLKPEDAAA----SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A       K +  +                +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQHL--ETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRKVEGFVSK--EKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +   G   +  E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238

Query: 234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN 293
               D                                  H+      L + F++ +   +
Sbjct: 239 AEPHDVLC-----------------------------CVHVSREEACLSVCFSRPLTVGS 269

Query: 294 SSTITVDSELNTNKDLVWKPLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQG 353
                +         + W+     N  +  VW+  L     N    +     +       
Sbjct: 270 RMGTLLLMVDEAPLSVEWRTPDGRNRPS-HVWLCDLPAASLNDQLPQHTFRVI------- 321

Query: 354 IISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISWRDESFHNYNAHSQDSSPISSL 413
                                                 W            +D       
Sbjct: 322 --------------------------------------WTGSDSQKECVLLKDRPECWCR 343

Query: 414 YQLSIKNDNELTDFEWRAATIAKEIDHFRELLSL-INCKIGKLTLARLLMAHDAMMCPPA 472
              + +          ++  +  E++  +EL  L    K   LT+  L+ A D       
Sbjct: 344 DSATDEQLFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALD------- 396

Query: 473 NKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNR 532
             + + +E L+ ++ L  +DP    Y  D  S  LL+      E    R  H ++     
Sbjct: 397 -PLLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKMEYADVRVLHLAH---KD 452

Query: 533 -----GSPMCLQLKNLSLSR------LGSFDKLLWVQMLDLSHNELRSIEGLEALQLLSC 581
                     L + +L LS         +   L  +++L  S N L +++G+  L  L  
Sbjct: 453 LTVLCHLEQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENVDGVANLPRLQE 512

Query: 582 LNLSNNILGSFTALEPIRQLKSLRALNISYNEI 614
           L L NN L    A++P+     L  LN+  N +
Sbjct: 513 LLLCNNRLQQSAAIQPLVSCPRLVLLNLQGNSL 545


>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* Length = 331 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3CX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Length = 349 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Length = 306 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Length = 382 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3v6t_A DHAX3; tandem repeats, DNA specific binding protein, DNA binding DNA complex; HET: DNA; 1.85A {Xanthomonas} PDB: 3v6p_A 2kq5_A Length = 499 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 100.0
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 100.0
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 100.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 100.0
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 100.0
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.97
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 99.96
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 99.94
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.92
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.8
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.62
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.61
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.51
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.48
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.48
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.47
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.46
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.45
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.45
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.45
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.45
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.44
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.44
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.44
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.43
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.43
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.43
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.43
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.42
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.42
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.42
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.41
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.4
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.4
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.4
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.39
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.39
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.39
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.38
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.38
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.38
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.37
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.37
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.37
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.37
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.37
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.37
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.36
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.35
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.35
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.35
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.34
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.33
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.33
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.33
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.33
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.33
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.32
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.32
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.32
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.32
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.31
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.31
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.31
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.31
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.31
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.31
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.3
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.3
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.3
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.3
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.29
3u4t_A272 TPR repeat-containing protein; structural genomics 99.29
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.29
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.29
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.29
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.29
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.28
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.28
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.28
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.27
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.27
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.27
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.27
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.27
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.27
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.26
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.26
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.26
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 99.26
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.26
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.26
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.26
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.26
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.25
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.25
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.24
3u4t_A272 TPR repeat-containing protein; structural genomics 99.24
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.24
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.24
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.24
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.23
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.23
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.23
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.23
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.23
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.22
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.22
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.22
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.22
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.22
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.21
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.21
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.21
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.21
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.21
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.2
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.2
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.2
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.2
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.2
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.2
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.2
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.19
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.19
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.18
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.18
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.17
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.17
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.17
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.16
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.16
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.16
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.16
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.15
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.15
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.15
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.15
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.15
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.14
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.13
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.13
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.13
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.13
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.12
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.12
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.11
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.1
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.1
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.09
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.08
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.08
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.08
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.07
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.07
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.07
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.07
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.05
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.05
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.05
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.05
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.03
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.02
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.02
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.02
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.01
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.0
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.0
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.0
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.0
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.99
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.99
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.98
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.97
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.97
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.97
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.97
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.95
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.94
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.92
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 98.92
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.91
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.9
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.9
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.89
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.89
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.89
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.89
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.88
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 98.88
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.87
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.87
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.87
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.86
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.86
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.84
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.83
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 98.82
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.81
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.81
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.8
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.8
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.8
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.8
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.79
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 98.78
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.78
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.75
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.75
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.74
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.74
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.72
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.71
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.71
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 98.71
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.71
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 98.7
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.7
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.69
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.69
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 98.68
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.67
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.64
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.64
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.62
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.61
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.61
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.61
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.61
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.6
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.6
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.6
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.59
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.59
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 98.59
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.58
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.58
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.56
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.55
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.54
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.53
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 98.53
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.53
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.53
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.53
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.52
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.51
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.47
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.45
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.44
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.43
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.42
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 98.41
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.39
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.38
3k9i_A117 BH0479 protein; putative protein binding protein, 98.36
3k9i_A117 BH0479 protein; putative protein binding protein, 98.36
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.34
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.34
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.33
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 98.33
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.32
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.28
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.25
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.22
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.17
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.16
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.16
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.13
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.12
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.04
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.94
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 97.89
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.86
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.84
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.83
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.82
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.82
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.81
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.8
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 97.79
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.79
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.73
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.72
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.72
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 97.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.65
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.57
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.56
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.52
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.43
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.41
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.39
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.35
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 97.29
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.28
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.19
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.18
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.17
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.15
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.09
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 97.07
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.02
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 96.99
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 96.98
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 96.87
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.82
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.67
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 96.66
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.22
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.09
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.98
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.97
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.95
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.88
1pc2_A152 Mitochondria fission protein; unknown function; NM 95.72
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.69
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 95.68
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 95.63
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 95.53
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.33
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 95.32
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 95.14
1klx_A138 Cysteine rich protein B; structural genomics, heli 94.95
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 94.47
3qww_A433 SET and MYND domain-containing protein 2; methyltr 93.97
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 93.77
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 93.74
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 93.62
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 93.19
4gt6_A394 Cell surface protein; leucine rich repeats, putati 93.15
1klx_A138 Cysteine rich protein B; structural genomics, heli 93.0
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 92.75
4gt6_A394 Cell surface protein; leucine rich repeats, putati 92.4
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 92.25
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 91.94
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.73
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 90.46
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 90.24
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 89.57
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 88.92
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 88.6
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 88.55
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 88.35
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 86.96
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 86.25
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 85.8
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 85.64
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
Probab=100.00  E-value=1.8e-74  Score=662.85  Aligned_cols=554  Identities=30%  Similarity=0.478  Sum_probs=441.9

Q ss_pred             CCCCcCCCCC-hHHHHH---HHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccC
Q 005381            1 MHGRPRKPLK-PEDAAA---SAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTEN   76 (699)
Q Consensus         1 mhg~~~~~~~-~~~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~   76 (699)
                      ||||+|+.++ +++++|   +.+|++.|++++++|++++..+++++|||++|+++|.+||++||||++||+++..+++  
T Consensus         1 mhg~~~~~~~~~~~~~~~~~~~~k~~~y~~~~~~~~~~~~~~~~~eeal~~~~~~l~~nP~~~taW~~R~~~l~~l~~--   78 (567)
T 1dce_A            1 MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRREVLQHLET--   78 (567)
T ss_dssp             CCSCBCSSCSTTSSCCSCCCCHHHHHHHHHHHHHHHHHHHTTCCSHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHT--
T ss_pred             CCCCCcCCCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHHHHHCchhHHHHHHHHHHHHhccc--
Confidence            9999998444 444333   4788999999999999999999999999999999999999999999999999999975  


Q ss_pred             CCCchhhhhhHHHHHHHHHHHHHhCCCChHHHHHHHHHHHhCC-CChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCC
Q 005381           77 DSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILSKGH-SSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNR  155 (699)
Q Consensus        77 ~~~~~~~~~~~~eEL~~~~~~L~~nPKsy~aW~hR~w~L~~~~-~~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~  155 (699)
                      +.+++.....+++||++++++|+.+||+|+||+||+|++.++. ..+++|+++|++++++||+|||||+||+|++..++.
T Consensus        79 ~~~~~~~~~~~~~eL~~~~~~l~~~pK~y~aW~hR~w~l~~l~~~~~~~el~~~~k~l~~d~~N~~aW~~R~~~l~~l~~  158 (567)
T 1dce_A           79 EKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLSRLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAV  158 (567)
T ss_dssp             TSCHHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHTCSSCCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTCC
T ss_pred             ccchhhhhhhHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHcccccHHHHHHHHHHHHhhccccccHHHHHHHHHHHcCC
Confidence            2334666778999999999999999999999999999999873 267999999999999999999999999999999995


Q ss_pred             ChHHHHHHHHHHHHhccCchHHHHHHHHHHHHhhhhhccCc--cchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHcC
Q 005381          156 SEEDELKYTEDMICNNFSNYSAWHNRSLLLSNLLKRKVEGF--VSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ  233 (699)
Q Consensus       156 ~~e~EL~~~~~~I~~n~sN~SAW~~R~~ll~~l~~~~~~~~--~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~~  233 (699)
                      ..++|++|++++|+.||+|+||||||+.++..+++....+.  ....+.+++|++++++||+++|+|+|+|+|+||++..
T Consensus       159 ~~~~el~~~~~~I~~~p~n~saW~~r~~ll~~l~~~~~~~~~~~~~~~~~~eel~~~~~ai~~~P~~~saW~y~~~ll~~  238 (567)
T 1dce_A          159 APAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR  238 (567)
T ss_dssp             CHHHHHHHHHTTTTTTCCCHHHHHHHHHHHHHHSCCCCSSSCCSSCHHHHHHHHHHHHHHHHHCSSCSHHHHHHHHHHSC
T ss_pred             ChHHHHHHHHHHHHHCCCCccHHHHHHHHHHhhcccccccccccccHHHHHHHHHHHHHHHhhCCCCccHHHHHHHHHhc
Confidence            55899999999999999999999999999999865422221  1234679999999999999999999999999999998


Q ss_pred             cCCCCCCcccccCCCCCCcceecCCccccCCCCCCCccccCCCCccceEEeecccccccc-ccceEEecccCCCccceee
Q 005381          234 TVRVDSPQLVSSWPTPGSDLILLGDRCLDGCASSPFTRFHLDSRTFPLVLYFNQAVEGVN-SSTITVDSELNTNKDLVWK  312 (699)
Q Consensus       234 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~w~  312 (699)
                      ..+.+   .+.               |+           +......+++++|++||.... .+|+.+.+... ...+.|+
T Consensus       239 ~~~~~---~~~---------------~~-----------~~~~~~~~~~~~f~~~i~~~~~~~~~~~~~~~~-~~~~~W~  288 (567)
T 1dce_A          239 AEPHD---VLC---------------CV-----------HVSREEACLSVCFSRPLTVGSRMGTLLLMVDEA-PLSVEWR  288 (567)
T ss_dssp             CCCCS---CEE---------------EE-----------EEETTTTEEEEEEEEEECTTBTTBCEEEEESSS-EECCCCB
T ss_pred             CCCcc---cee---------------ee-----------eeccCCceEEEEeccceeccccccceEEeecCc-ccceeec
Confidence            75422   111               11           112346678999999998642 33467666543 6799999


Q ss_pred             eCCCCCCccceeEEEeccCCCCCCCCCCccceEEecCcccccccCCCCccCCCccceEEEEEeecccccccccccceeec
Q 005381          313 PLSSCNSKAAQVWVTQLNLPDGNTHSSKVFPVEVSLGHSQGIISSSGFHYSNPFCFAFRVSLQFVETQPVEALGKEIISW  392 (699)
Q Consensus       313 ~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  392 (699)
                      |+. .++++++||+++++.+...++ ..+|+|+|.+++.++.     ..                   |... .+..+.|
T Consensus       289 ~~~-~~~~~~~vw~~~~~~~~~~~~-~~~~~~~~~~~~~~~~-----~~-------------------~~~~-~~~~~~~  341 (567)
T 1dce_A          289 TPD-GRNRPSHVWLCDLPAASLNDQ-LPQHTFRVIWTGSDSQ-----KE-------------------CVLL-KDRPECW  341 (567)
T ss_dssp             CTT-SSCCSEEEEEEECCGGGTSTT-SSEEEEEEEETTTTEE-----EE-------------------EEEE-TTCSEEE
T ss_pred             cCC-cccccceeEEeecCccccccc-cccceEEEeeccCCCC-----cc-------------------cccc-CCCchhh
Confidence            987 678899999999998664333 4567788877766532     11                   1111 2345556


Q ss_pred             cCCCccccccccCCCCCccccccccccccCccchhhhhHHHHHHHHHHHHhhhh-ccccccccccHHHHHhhcccCCCCC
Q 005381          393 RDESFHNYNAHSQDSSPISSLYQLSIKNDNELTDFEWRAATIAKEIDHFRELLS-LINCKIGKLTLARLLMAHDAMMCPP  471 (699)
Q Consensus       393 ~~~~~~~~~~~~~~~~~l~~~~~lsi~~~~~~~~~~~~~~~L~~el~~~~~L~~-~p~nk~~~Ltl~~ll~~~~~l~~~~  471 (699)
                      .+...        ...+|.   .|.+        +...++.||.+|..|.+|.+ .++++|.+.++..++..++.     
T Consensus       342 ~~d~~--------~~~~L~---~L~L--------s~n~L~~Lp~~i~~l~~L~~L~l~~n~~l~~l~~ll~~~~~-----  397 (567)
T 1dce_A          342 CRDSA--------TDEQLF---RCEL--------SVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDP-----  397 (567)
T ss_dssp             EECCS--------TTTTSS---SCCC--------CHHHHHHHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHCT-----
T ss_pred             hcccc--------cCccce---eccC--------ChhhHHhhHHHHHHHHHHHHhccccchhhhhHHHHHHhccc-----
Confidence            32111        112333   4444        55688999999999999999 78999998888888877554     


Q ss_pred             CCcCCCcHHHHHhcccccccCCCCCccccchhhhHHhhhhccchHHHhhhhccCCCCCCCCCCCCeEEccCCCCCcccCC
Q 005381          472 ANKISHSEEVLELYNDLMRLDPTHVQYYKDQHSLVLLQQVTSNWESLLSRCFHYSNSPSNRGSPMCLQLKNLSLSRLGSF  551 (699)
Q Consensus       472 ~~~~~~~~~~l~~l~~L~~LDls~n~~~~~l~sl~~l~~l~~~~~~l~~~~~~l~~l~~l~L~~~~L~Ls~n~l~~l~~l  551 (699)
                         .+..++.++.+++|+.||+.+.+.+.+++.+++..+....+.   .     ..++       .|+|++|.|+.+|.+
T Consensus       398 ---~~~~~~~l~~l~~L~~L~~l~~n~~~~L~~l~l~~n~i~~l~---~-----~~L~-------~L~Ls~n~l~~lp~~  459 (567)
T 1dce_A          398 ---LLYEKETLQYFSTLKAVDPMRAAYLDDLRSKFLLENSVLKME---Y-----ADVR-------VLHLAHKDLTVLCHL  459 (567)
T ss_dssp             ---GGGHHHHHHHHHHHHHHCGGGHHHHHHHHHHHHHHHHHHHHH---H-----TTCS-------EEECTTSCCSSCCCG
T ss_pred             ---ccCCHHHHHHHHhcccCcchhhcccchhhhhhhhcccccccC---c-----cCce-------EEEecCCCCCCCcCc
Confidence               478889999999999999655666778888777666332121   1     1122       399999999999999


Q ss_pred             CCCcccCEEEccCCCCCCCcC-CccccccceeecccCCCCCCCCCccccccccccccccccccCCCCCcccccccCCCCC
Q 005381          552 DKLLWVQMLDLSHNELRSIEG-LEALQLLSCLNLSNNILGSFTALEPIRQLKSLRALNISYNEIGAHSIDTTKYLCSSPL  630 (699)
Q Consensus       552 ~~L~~L~~LdLS~N~L~~l~~-l~~L~~L~~L~Ls~N~l~~l~~~~~l~~l~~L~~L~Ls~N~I~~lp~~~~~~l~~l~l  630 (699)
                      ..+++|+.|+|++|.|+.+|. +..|++|+.|+|++|.|+++  | .++.+++|+.|+|++|+|+.++.           
T Consensus       460 ~~l~~L~~L~Ls~N~l~~lp~~~~~l~~L~~L~Ls~N~l~~l--p-~l~~l~~L~~L~Ls~N~l~~~~~-----------  525 (567)
T 1dce_A          460 EQLLLVTHLDLSHNRLRALPPALAALRCLEVLQASDNALENV--D-GVANLPRLQELLLCNNRLQQSAA-----------  525 (567)
T ss_dssp             GGGTTCCEEECCSSCCCCCCGGGGGCTTCCEEECCSSCCCCC--G-GGTTCSSCCEEECCSSCCCSSST-----------
T ss_pred             cccccCcEeecCcccccccchhhhcCCCCCEEECCCCCCCCC--c-ccCCCCCCcEEECCCCCCCCCCC-----------
Confidence            999999999999999999998 99999999999999999987  3 78999999999999999998720           


Q ss_pred             cccccCCCCccceeecCCcchhhhhhccCCCC-CccEEEecCCCC-CCccchHHHhhcCCcccccc
Q 005381          631 SHSVGSEWNHGQTVIDDDIKSYWEAYFILKGL-NLTQFDIVGNAI-VNEKFKSFLIKVLPGLKWLD  694 (699)
Q Consensus       631 l~ll~l~~N~l~~~~~~~~~~~~~~p~~l~~L-~L~~LdLs~N~l-~~~~~~~~~~~~l~~L~~LD  694 (699)
                                               |..+..+ +|+.|+|++|+| ..+.....+...+|+|+.||
T Consensus       526 -------------------------p~~l~~l~~L~~L~L~~N~l~~~~~~~~~l~~~lp~L~~L~  566 (567)
T 1dce_A          526 -------------------------IQPLVSCPRLVLLNLQGNSLCQEEGIQERLAEMLPSVSSIL  566 (567)
T ss_dssp             -------------------------TGGGGGCTTCCEEECTTSGGGGSSSCTTHHHHHCTTCSEEE
T ss_pred             -------------------------cHHHhcCCCCCEEEecCCcCCCCccHHHHHHHHCcccCccC
Confidence                                     2345667 899999999999 44445556677799999986



>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 699
d1dcea1334 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltr 9e-36
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 5e-16
d2h6fa1315 a.118.6.1 (A:55-369) Protein farnesyltransferase a 0.003
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-08
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1m9la_198 c.10.3.1 (A:) Outer arm dynein light chain 1 {Gree 0.002
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 334 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Protein prenylyltransferase
family: Protein prenylyltransferase
domain: Rab geranylgeranyltransferase alpha-subunit, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  135 bits (341), Expect = 9e-36
 Identities = 95/240 (39%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 1   MHGRPRKPLKPEDAAAS----AAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNP 56
           MHGR +     E A A       K +  +                +  +EL++++L  NP
Sbjct: 1   MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP 60

Query: 57  ELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRVVESALRQNFKSYGAWHHRKWILS 116
           +  T WN R+  +QH   E +  P+   +++  EL  +ES LR N KSYG WHHR W+LS
Sbjct: 61  DFATLWNCRREVLQH--LETEKSPEESAALVKAELGFLESCLRVNPKSYGTWHHRCWLLS 118

Query: 117 K-GHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFSNY 175
           +    +   EL L  +F +AD RNFH W+YRRFVAA    +  +EL +T+ +I  NFSNY
Sbjct: 119 RLPEPNWARELELCARFLEADERNFHCWDYRRFVAAQAAVAPAEELAFTDSLITRNFSNY 178

Query: 176 SAWHNRSLLLSNLLKRK--VEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ 233
           S+WH RS LL  L  +          E VL  E E V  A FTDP+DQS WFYH WLL +
Sbjct: 179 SSWHYRSCLLPQLHPQPDSGPQGRLPENVLLKELELVQNAFFTDPNDQSAWFYHRWLLGR 238


>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query699
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.97
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.95
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.84
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.65
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.57
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.44
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.37
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.37
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.33
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.33
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.32
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.31
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.25
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.22
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.2
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.2
d1dcea2109 Rab geranylgeranyltransferase alpha-subunit, inser 99.19
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.15
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.14
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.14
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.13
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.13
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.07
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.05
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.02
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.01
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.01
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.94
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.94
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.94
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.87
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.85
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.84
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.8
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.8
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.79
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.76
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.76
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.75
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.72
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.7
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.6
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.59
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.59
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.58
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 98.56
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.55
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.55
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.52
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.45
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.43
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.37
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 98.36
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.35
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.29
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.28
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.25
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.17
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.97
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.96
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.9
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.76
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 97.66
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.64
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.63
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.52
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.51
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.42
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.39
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.32
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.06
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.03
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.61
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.53
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.47
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.89
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.56
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 95.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.21
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 94.74
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.26
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 90.52
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: Protein prenylyltransferase
family: Protein prenylyltransferase
domain: Protein farnesyltransferase alpha-subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.1e-29  Score=267.62  Aligned_cols=201  Identities=24%  Similarity=0.470  Sum_probs=185.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhcCCCCcHHHHHHHHHHHHhCCCchHHHHHHHHHHHhhhccCCCCchhhhhhHHHHHHH
Q 005381           14 AAASAAKAEKLRVLQSQFLHNHHNHIYSKEAVELSTKLLETNPELYTAWNYRKLAVQHKLTENDSDPDSLKSILDEELRV   93 (699)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~eaL~~~~~~L~~nP~~ytaWn~R~~~l~~l~~~~~~~~~~~~~~~~eEL~~   93 (699)
                      +.+.+++.++|.++++.+...+.+++.+++||++++++|.+||++++||++|+.++..+++           .+++|+.+
T Consensus        32 ~~~~I~~~p~~~~a~~~~~~~~~~~e~~~~Al~~~~~ai~lnP~~~~a~~~r~~~l~~l~~-----------~~~eal~~  100 (315)
T d2h6fa1          32 PVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQK-----------DLHEEMNY  100 (315)
T ss_dssp             CSSEECCCHHHHHHHHHHHHHHHHTCCCHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTTC-----------CHHHHHHH
T ss_pred             cccccccCHHHHHHHHHHHHHHHhCCchHHHHHHHHHHHHHCCCChHHHHHHHHHHHHhCc-----------CHHHHHHH
Confidence            3345667789999999999999999999999999999999999999999999999998853           48999999


Q ss_pred             HHHHHHhCCCChHHHHHHHHHHHhCCCChHHHHHHHHHHHHhCCCChhhhhHHHHHHHhcCCChHHHHHHHHHHHHhccC
Q 005381           94 VESALRQNFKSYGAWHHRKWILSKGHSSIDNELRLLDKFQKADSRNFHAWNYRRFVAASMNRSEEDELKYTEDMICNNFS  173 (699)
Q Consensus        94 ~~~~L~~nPKsy~aW~hR~w~L~~~~~~~~~EL~~~~k~L~~dprN~haW~yR~~vl~~l~~~~e~EL~~~~~~I~~n~s  173 (699)
                      ++++++.+||++.+|+||+|++.++ +.+++|++++++++++||+|+++|.+|+|++..++.+ ++++++++++|+.||+
T Consensus       101 ~~~al~~~p~~~~a~~~~~~~~~~l-~~~~eAl~~~~kal~~dp~n~~a~~~~~~~~~~~~~~-~~Al~~~~~al~~~p~  178 (315)
T d2h6fa1         101 ITAIIEEQPKNYQVWHHRRVLVEWL-RDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLW-DNELQYVDQLLKEDVR  178 (315)
T ss_dssp             HHHHHHHCTTCHHHHHHHHHHHHHH-TCCTTHHHHHHHHHHHCTTCHHHHHHHHHHHHHHTCC-TTHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHhhhhHHHHHhHHHHhh-ccHHHHHHHHhhhhhhhhcchHHHHHHHHHHHHHHhh-HHHHHHHHHHHHHCCc
Confidence            9999999999999999999999987 6899999999999999999999999999999999999 6899999999999999


Q ss_pred             chHHHHHHHHHHHHhhhhhccCccchhchHHHHHHHHHHHHHhCCCCchhHHHHHHHHcC
Q 005381          174 NYSAWHNRSLLLSNLLKRKVEGFVSKEKVLPDEYEFVHQAIFTDPDDQSGWFYHLWLLDQ  233 (699)
Q Consensus       174 N~SAW~~R~~ll~~l~~~~~~~~~~~~~~~~eeL~~~~~ai~~dP~d~SaW~Y~~~Ll~~  233 (699)
                      |.+||++|+.++..++..      .....+++|++.+.+||..+|+|.++|+|+++++..
T Consensus       179 n~~a~~~r~~~l~~~~~~------~~~~~~~~ai~~~~~al~~~P~~~~~~~~l~~ll~~  232 (315)
T d2h6fa1         179 NNSVWNQRYFVISNTTGY------NDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQD  232 (315)
T ss_dssp             CHHHHHHHHHHHHHTTCS------CSHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHTT
T ss_pred             cHHHHHHHHHHHHHcccc------chhhhhHHhHHHHHHHHHhCCCchHHHHHHHHHHHh
Confidence            999999999999877542      234567999999999999999999999999999965



>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dcea2 b.7.4.1 (A:242-350) Rab geranylgeranyltransferase alpha-subunit, insert domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure