Citrus Sinensis ID: 005399
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 698 | ||||||
| 297744440 | 653 | unnamed protein product [Vitis vinifera] | 0.802 | 0.857 | 0.702 | 0.0 | |
| 225428374 | 733 | PREDICTED: chloride channel protein CLC- | 0.802 | 0.763 | 0.702 | 0.0 | |
| 147820635 | 1444 | hypothetical protein VITISV_002674 [Viti | 0.775 | 0.374 | 0.701 | 0.0 | |
| 255546644 | 759 | voltage-gated clc-type chloride channel, | 0.815 | 0.749 | 0.676 | 0.0 | |
| 289541483 | 711 | chloride channel E [Eutrema halophilum] | 0.803 | 0.789 | 0.652 | 0.0 | |
| 334187188 | 749 | chloride channel protein CLC-e [Arabidop | 0.790 | 0.736 | 0.659 | 0.0 | |
| 18418749 | 710 | chloride channel protein CLC-e [Arabidop | 0.790 | 0.777 | 0.659 | 0.0 | |
| 297798378 | 715 | predicted protein [Arabidopsis lyrata su | 0.839 | 0.819 | 0.631 | 0.0 | |
| 14039799 | 708 | CLC-e chloride channel protein [Arabidop | 0.787 | 0.776 | 0.656 | 0.0 | |
| 449475886 | 779 | PREDICTED: LOW QUALITY PROTEIN: chloride | 0.869 | 0.779 | 0.608 | 0.0 |
| >gi|297744440|emb|CBI37702.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 798 bits (2062), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 423/602 (70%), Positives = 482/602 (80%), Gaps = 42/602 (6%)
Query: 92 IISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACG 151
I+SSC VGLLTGIG+VLFN VH IRDF WDGIPY GASWLRE+PI AIW RV+LVP CG
Sbjct: 9 ILSSCFVGLLTGIGIVLFNNAVHVIRDFSWDGIPYRGASWLREEPIEAIWERVILVPLCG 68
Query: 152 GFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIY 211
G +VS LN LR AL Q+ D ++I+
Sbjct: 69 GLLVSGLNVLRDAL-------------------------QSPGDGNLIS----------- 92
Query: 212 YDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVA 271
+K A QP LKAVAAC+TLGTGNSLGPEGPSVEIG SIAKGV +LFD+ +RKVSLVA
Sbjct: 93 --NIKAALQPFLKAVAACVTLGTGNSLGPEGPSVEIGASIAKGVSSLFDKSSKRKVSLVA 150
Query: 272 AGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGL 331
AGSAAGISSGFNAA AGCFFAVESV+WPS+A DSS SL TTSMVILSAVIASVVSEVGL
Sbjct: 151 AGSAAGISSGFNAAFAGCFFAVESVLWPSTA-DSSLSLQNTTSMVILSAVIASVVSEVGL 209
Query: 332 GSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAV 391
GSEPAFKVPEYDFRSPGELPLYLLLG+LCGL+SL LS+CT+YML +DN+ K GIP+A
Sbjct: 210 GSEPAFKVPEYDFRSPGELPLYLLLGILCGLVSLALSKCTSYMLVTIDNVHKAVGIPRAA 269
Query: 392 FPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCR 451
FPV+GGL+VGLIAL +PEILYWGFENVDILLESRPFVKGL+AD+LLQLVA KIVATSLCR
Sbjct: 270 FPVLGGLSVGLIALAYPEILYWGFENVDILLESRPFVKGLSADLLLQLVAVKIVATSLCR 329
Query: 452 ASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATL 511
ASGLVGGYYAPSLFIGAATGMAYGKFI FAI+QSNP H SILEVASPQAYGLVGMAATL
Sbjct: 330 ASGLVGGYYAPSLFIGAATGMAYGKFITFAISQSNPMFHLSILEVASPQAYGLVGMAATL 389
Query: 512 AGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANTNR 571
AGVCQVPLT+VLLLFELTQDYRIVLPLLGAVGLSSW TS Q +R+DV + N +
Sbjct: 390 AGVCQVPLTAVLLLFELTQDYRIVLPLLGAVGLSSWTTSRQAKRKDVGDPGKLKEGNAQK 449
Query: 572 KRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVSEVMR 631
++ + LSSS +A + +A NLCEVESSLC+DD N E +EL++R+FVS+ MR
Sbjct: 450 T---DLSSHDPSVLSSSYSVAAKASHASNLCEVESSLCVDDSNSETKELEKRIFVSQAMR 506
Query: 632 TRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFSKYAQAKTSRSK 691
TRYVTVLM+TLLIEA++L+L EKQ+CA+IVD+D++LIGLLTL DI+EFS+ +A+ RSK
Sbjct: 507 TRYVTVLMSTLLIEAVSLLLEEKQTCAVIVDDDHLLIGLLTLEDIQEFSEREKARIRRSK 566
Query: 692 NV 693
V
Sbjct: 567 EV 568
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225428374|ref|XP_002280150.1| PREDICTED: chloride channel protein CLC-e [Vitis vinifera] gi|301318140|gb|ADK66985.1| chloride channel ClC7 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147820635|emb|CAN72098.1| hypothetical protein VITISV_002674 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255546644|ref|XP_002514381.1| voltage-gated clc-type chloride channel, putative [Ricinus communis] gi|223546478|gb|EEF47977.1| voltage-gated clc-type chloride channel, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|289541483|gb|ADD09862.1| chloride channel E [Eutrema halophilum] | Back alignment and taxonomy information |
|---|
| >gi|334187188|ref|NP_001190924.1| chloride channel protein CLC-e [Arabidopsis thaliana] gi|332661111|gb|AEE86511.1| chloride channel protein CLC-e [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|18418749|ref|NP_567985.1| chloride channel protein CLC-e [Arabidopsis thaliana] gi|41688502|sp|Q8GX93.2|CLCE_ARATH RecName: Full=Chloride channel protein CLC-e; Short=AtCLC-e; AltName: Full=CBS domain-containing protein CBSCLC3 gi|332661110|gb|AEE86510.1| chloride channel protein CLC-e [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|297798378|ref|XP_002867073.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312909|gb|EFH43332.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|14039799|gb|AAK53390.1|AF366367_1 CLC-e chloride channel protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449475886|ref|XP_004154579.1| PREDICTED: LOW QUALITY PROTEIN: chloride channel protein CLC-e-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 698 | ||||||
| TAIR|locus:2020542 | 781 | CLC-F "chloride channel F" [Ar | 0.638 | 0.571 | 0.389 | 3.9e-87 | |
| TIGR_CMR|GSU_2363 | 614 | GSU_2363 "chloride channel fam | 0.199 | 0.226 | 0.363 | 5.2e-23 | |
| UNIPROTKB|P37019 | 473 | clcA "ClcA" [Escherichia coli | 0.275 | 0.405 | 0.306 | 1.9e-15 | |
| TIGR_CMR|SPO_1208 | 581 | SPO_1208 "voltage-gated chlori | 0.223 | 0.268 | 0.321 | 3.3e-14 | |
| UNIPROTKB|Q9KM62 | 468 | clcA "H(+)/Cl(-) exchange tran | 0.190 | 0.284 | 0.333 | 1.9e-13 | |
| TIGR_CMR|VC_A0526 | 468 | VC_A0526 "conserved hypothetic | 0.190 | 0.284 | 0.333 | 1.9e-13 | |
| UNIPROTKB|P76175 | 418 | clcB "chloride ion transporter | 0.224 | 0.375 | 0.306 | 2.2e-10 | |
| FB|FBgn0036566 | 882 | ClC-c "Chloride channel-c" [Dr | 0.242 | 0.191 | 0.259 | 9.2e-10 | |
| SGD|S000003801 | 779 | GEF1 "Voltage-gated chloride c | 0.239 | 0.214 | 0.273 | 5.9e-08 | |
| POMBASE|SPBC19C7.11 | 766 | SPBC19C7.11 "ClC chloride chan | 0.223 | 0.203 | 0.239 | 8.8e-08 |
| TAIR|locus:2020542 CLC-F "chloride channel F" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 750 (269.1 bits), Expect = 3.9e-87, Sum P(2) = 3.9e-87
Identities = 184/472 (38%), Positives = 246/472 (52%)
Query: 213 DYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVXX 272
D+L P++KA+ A +TLGTG SLGPEGPSV+IGKS A G + + R+++L
Sbjct: 220 DFLA-GIYPVIKAIQAAVTLGTGCSLGPEGPSVDIGKSCANGFALMMENNRERRIALTAA 278
Query: 273 XXXXXXXXXXXXXVAGCFFAVESVIWPXXXXXXXXXXXYTTXXXXXXXXXXXXXXEVGLG 332
VAGCFFA+E+V+ P +TT LG
Sbjct: 279 GAASGIASGFNAAVAGCFFAIETVLRPLRAENSPP---FTTAMIILASVISSTVSNALLG 335
Query: 333 SEPAFKVPEYDFRSPXXXXXXXXXXXXXXXXXXXXSRCTTYMLAIVDNLQKDNGIPKAVF 392
++ AF VP YD +S SR T+ D ++ G+P V
Sbjct: 336 TQSAFTVPSYDLKSAAELPLYLILGMLCGAVSVVFSRLVTWFTKSFDFIKDKFGLPAIVC 395
Query: 393 PVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRA 452
P +GGL G+IAL +P ILYWGF NV+ +L + +L QL AAK+VAT+LC+
Sbjct: 396 PALGGLGAGIIALKYPGILYWGFTNVEEILHTGKSASAPGIWLLAQLAAAKVVATALCKG 455
Query: 453 SGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLA 512
SGLVGG YAPSL IGAA G +G I ++ P VA PQAY LVGMAATLA
Sbjct: 456 SGLVGGLYAPSLMIGAAVGAVFGGSAAEIINRAIP----GNAAVAQPQAYALVGMAATLA 511
Query: 513 GVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTS--GQMRRRDVKETKVAVHANTN 570
+C VPLTSVLLLFELT+DYRI+LPL+GAVGL+ W S Q + D E + ++
Sbjct: 512 SMCSVPLTSVLLLFELTKDYRILLPLMGAVGLAIWVPSVANQGKESDSSEGRSTGRGYSS 571
Query: 571 ---RKRQFEIYTSRTRGLSSSDLLAEEEPYAINLCEVESSLCIDDWNLEVEELKRRVFVS 627
+R+ E T S +L E P + + +D+ + +E+LK V
Sbjct: 572 LSPSERKTEGVWRHTDNADSLELTVIENP--------DHNSFLDEETI-LEDLK----VM 618
Query: 628 EVMRTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEF 679
VM YV V T L EA ++ Q+C M+VD+D+ L G+LT GDI +
Sbjct: 619 RVMSKNYVKVSSGTTLREARNILKESHQNCIMVVDDDDFLAGILTHGDIRRY 670
|
|
| TIGR_CMR|GSU_2363 GSU_2363 "chloride channel family protein, putative" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P37019 clcA "ClcA" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SPO_1208 SPO_1208 "voltage-gated chloride channel family protein" [Ruegeria pomeroyi DSS-3 (taxid:246200)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KM62 clcA "H(+)/Cl(-) exchange transporter ClcA" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_A0526 VC_A0526 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P76175 clcB "chloride ion transporter ClcB" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036566 ClC-c "Chloride channel-c" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| SGD|S000003801 GEF1 "Voltage-gated chloride channel localized to the golgi, the endosomal" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC19C7.11 SPBC19C7.11 "ClC chloride channel (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00036320001 | SubName- Full=Chromosome chr3 scaffold_8, whole genome shotgun sequence; (623 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 698 | |||
| cd00400 | 383 | cd00400, Voltage_gated_ClC, CLC voltage-gated chlo | 6e-99 | |
| pfam00654 | 345 | pfam00654, Voltage_CLC, Voltage gated chloride cha | 9e-80 | |
| COG0038 | 443 | COG0038, EriC, Chloride channel protein EriC [Inor | 4e-62 | |
| cd01031 | 402 | cd01031, EriC, ClC chloride channel EriC | 7e-59 | |
| PRK01862 | 574 | PRK01862, PRK01862, putative voltage-gated ClC-typ | 5e-47 | |
| PRK05277 | 438 | PRK05277, PRK05277, chloride channel protein; Prov | 7e-47 | |
| cd01034 | 390 | cd01034, EriC_like, ClC chloride channel family | 3e-33 | |
| cd01033 | 388 | cd01033, ClC_like, Putative ClC chloride channel | 2e-30 | |
| cd01036 | 416 | cd01036, ClC_euk, Chloride channel, ClC | 2e-24 | |
| PRK01610 | 418 | PRK01610, PRK01610, putative voltage-gated ClC-typ | 2e-23 | |
| cd03684 | 445 | cd03684, ClC_3_like, ClC-3-like chloride channel p | 7e-22 | |
| cd04592 | 133 | cd04592, CBS_pair_EriC_assoc_euk, This cd contains | 3e-18 | |
| cd03683 | 426 | cd03683, ClC_1_like, ClC-1-like chloride channel p | 4e-18 | |
| cd03685 | 466 | cd03685, ClC_6_like, ClC-6-like chloride channel p | 4e-11 | |
| cd03682 | 378 | cd03682, ClC_sycA_like, ClC sycA-like chloride cha | 2e-10 | |
| pfam00571 | 57 | pfam00571, CBS, CBS domain | 2e-09 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 9e-08 | |
| cd04803 | 122 | cd04803, CBS_pair_15, The CBS domain, named after | 5e-06 | |
| cd02205 | 113 | cd02205, CBS_pair, The CBS domain, named after hum | 9e-06 | |
| cd04604 | 114 | cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contain | 3e-05 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 4e-05 | |
| cd04639 | 111 | cd04639, CBS_pair_26, The CBS domain, named after | 4e-05 | |
| smart00116 | 49 | smart00116, CBS, Domain in cystathionine beta-synt | 3e-04 | |
| cd04637 | 122 | cd04637, CBS_pair_24, The CBS domain, named after | 3e-04 | |
| PRK03655 | 414 | PRK03655, PRK03655, putative ion channel protein; | 4e-04 | |
| COG0517 | 117 | COG0517, COG0517, FOG: CBS domain [General functio | 5e-04 | |
| cd04587 | 113 | cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd | 5e-04 | |
| cd04631 | 125 | cd04631, CBS_pair_18, The CBS domain, named after | 0.001 | |
| TIGR01302 | 450 | TIGR01302, IMP_dehydrog, inosine-5'-monophosphate | 0.001 | |
| cd04606 | 109 | cd04606, CBS_pair_Mg_transporter, This cd contains | 0.001 | |
| cd04622 | 113 | cd04622, CBS_pair_9, The CBS domain, named after h | 0.002 | |
| PRK05567 | 486 | PRK05567, PRK05567, inosine 5'-monophosphate dehyd | 0.002 | |
| pfam00478 | 467 | pfam00478, IMPDH, IMP dehydrogenase / GMP reductas | 0.002 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 0.002 | |
| COG2905 | 610 | COG2905, COG2905, Predicted signal-transduction pr | 0.002 |
| >gnl|CDD|238233 cd00400, Voltage_gated_ClC, CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
Score = 309 bits (793), Expect = 6e-99
Identities = 152/449 (33%), Positives = 230/449 (51%), Gaps = 67/449 (14%)
Query: 99 GLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSIL 158
G+L+G+G VLF + +++ + G+P A+ + ++LVP GG +V +L
Sbjct: 1 GVLSGLGAVLFRLLIELLQNLLFGGLPGELAAG------SLSPLYILLVPVIGGLLVGLL 54
Query: 159 NQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIA 218
+L + P+ + I ++
Sbjct: 55 VRLL-----------------GPARGHGIPEV----------------IEAIALGGGRLP 81
Query: 219 F-QPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLVAAGSAAG 277
L+K +A+ +TLG+G S+G EGP V+IG +I +G + LVA G+AAG
Sbjct: 82 LRVALVKFLASALTLGSGGSVGREGPIVQIGAAIGSWLGRRLRLSRNDRRILVACGAAAG 141
Query: 278 ISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEVGLGSEPAF 337
I++ FNA +AG FA+E ++ S A + V+L++V A++VS + G+EPAF
Sbjct: 142 IAAAFNAPLAGALFAIEVLLGEYSVA--------SLIPVLLASVAAALVSRLLFGAEPAF 193
Query: 338 KVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGG 397
VP YD S ELPLYLLLG+L GL+ + R + + L IP + P +GG
Sbjct: 194 GVPLYDPLSLLELPLYLLLGLLAGLVGVLFVRLLYKIERLFRRL----PIPPWLRPALGG 249
Query: 398 LAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVG 457
L +GL+ L P++L G+ + + L L+ +LL L+ K++AT+L SG G
Sbjct: 250 LLLGLLGLFLPQVLGSGYGAILLALAG-----ELSLLLLLLLLLLKLLATALTLGSGFPG 304
Query: 458 GYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQV 517
G +APSLFIGAA G A+G + VASP AY LVGMAA LA V +
Sbjct: 305 GVFAPSLFIGAALGAAFGLLLP----------ALFPGLVASPGAYALVGMAALLAAVLRA 354
Query: 518 PLTSVLLLFELTQDYRIVLPLLGAVGLSS 546
PLT++LL+ ELT DY ++LPL+ AV ++
Sbjct: 355 PLTAILLVLELTGDYSLLLPLMLAVVIAY 383
|
The ClC chloride channels catalyse the selective flow of Cl- ions across cell membranes, thereby regulating electrical excitation in skeletal muscle and the flow of salt and water across epithelial barriers. This domain is found in the halogen ions (Cl-, Br- and I-) transport proteins of the ClC family. The ClC channels are found in all three kingdoms of life and perform a variety of functions including cellular excitability regulation, cell volume regulation, membrane potential stabilization, acidification of intracellular organelles, signal transduction, transepithelial transport in animals, and the extreme acid resistance response in eubacteria. They lack any structural or sequence similarity to other known ion channels and exhibit unique properties of ion permeation and gating. Unlike cation-selective ion channels, which form oligomers containing a single pore along the axis of symmetry, the ClC channels form two-pore homodimers with one pore per subunit without axial symmetry. Although lacking the typical voltage-sensor found in cation channels, all studied ClC channels are gated (opened and closed) by transmembrane voltage. The gating is conferred by the permeating ion itself, acting as the gating charge. In addition, eukaryotic and some prokaryotic ClC channels have two additional C-terminal CBS (cystathionine beta synthase) domains of putative regulatory function. Length = 383 |
| >gnl|CDD|216046 pfam00654, Voltage_CLC, Voltage gated chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|223116 COG0038, EriC, Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238504 cd01031, EriC, ClC chloride channel EriC | Back alignment and domain information |
|---|
| >gnl|CDD|234987 PRK01862, PRK01862, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235385 PRK05277, PRK05277, chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238506 cd01034, EriC_like, ClC chloride channel family | Back alignment and domain information |
|---|
| >gnl|CDD|238505 cd01033, ClC_like, Putative ClC chloride channel | Back alignment and domain information |
|---|
| >gnl|CDD|238507 cd01036, ClC_euk, Chloride channel, ClC | Back alignment and domain information |
|---|
| >gnl|CDD|234963 PRK01610, PRK01610, putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239656 cd03684, ClC_3_like, ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239965 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|239655 cd03683, ClC_1_like, ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239657 cd03685, ClC_6_like, ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239654 cd03682, ClC_sycA_like, ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201313 pfam00571, CBS, CBS domain | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240116 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239067 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|239977 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|240010 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214522 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >gnl|CDD|240008 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235148 PRK03655, PRK03655, putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223591 COG0517, COG0517, FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|239960 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >gnl|CDD|240002 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|233350 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|239979 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >gnl|CDD|239994 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >gnl|CDD|235507 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|215936 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|225457 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 698 | |||
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 100.0 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 100.0 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 100.0 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 100.0 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 100.0 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 100.0 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 100.0 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 100.0 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 100.0 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 100.0 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 100.0 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 100.0 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 100.0 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 100.0 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 100.0 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 100.0 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 100.0 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.85 | |
| cd00400 | 383 | Voltage_gated_ClC CLC voltage-gated chloride chann | 99.72 | |
| cd01031 | 402 | EriC ClC chloride channel EriC. This domain is fou | 99.7 | |
| cd01034 | 390 | EriC_like ClC chloride channel family. These prote | 99.68 | |
| PRK05277 | 438 | chloride channel protein; Provisional | 99.68 | |
| cd01033 | 388 | ClC_like Putative ClC chloride channel. Clc protei | 99.68 | |
| PRK01610 | 418 | putative voltage-gated ClC-type chloride channel C | 99.58 | |
| cd03682 | 378 | ClC_sycA_like ClC sycA-like chloride channel prote | 99.57 | |
| cd03685 | 466 | ClC_6_like ClC-6-like chloride channel proteins. T | 99.52 | |
| COG0038 | 443 | EriC Chloride channel protein EriC [Inorganic ion | 99.47 | |
| cd01036 | 416 | ClC_euk Chloride channel, ClC. These domains are f | 99.46 | |
| cd03683 | 426 | ClC_1_like ClC-1-like chloride channel proteins. T | 99.46 | |
| cd03684 | 445 | ClC_3_like ClC-3-like chloride channel proteins. T | 99.41 | |
| PRK03655 | 414 | putative ion channel protein; Provisional | 99.37 | |
| PF00654 | 355 | Voltage_CLC: Voltage gated chloride channel Mutati | 99.27 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.94 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.83 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.75 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.31 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.29 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.2 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.06 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 98.02 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.91 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 97.9 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.9 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.89 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.89 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.87 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 97.87 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.86 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.86 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.86 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 97.86 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.86 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.85 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 97.84 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.81 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.81 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.8 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.8 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.79 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.79 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.78 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.78 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.78 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.77 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.77 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.76 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.76 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.76 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.75 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.75 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.73 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.72 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.71 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.71 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.7 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.7 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.69 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.69 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.68 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.68 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.68 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.67 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.67 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.66 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.65 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.64 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.64 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.64 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.63 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.63 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.63 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.62 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.62 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.61 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.61 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.61 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.61 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.6 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.6 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.6 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.59 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.59 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.57 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.57 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.57 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.57 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 97.56 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.56 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.56 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 97.54 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.54 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.54 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.51 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.51 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.49 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.48 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.47 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 97.47 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.47 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.47 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.45 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.42 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.38 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.36 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 97.35 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.33 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 97.31 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.31 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.22 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.21 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.17 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 97.17 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.17 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 97.17 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 97.15 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.15 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.14 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.14 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.14 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.12 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.09 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 97.07 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.06 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.06 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.05 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.01 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 96.97 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 96.97 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 96.96 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 96.95 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 96.94 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 96.94 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 96.94 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 96.92 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 96.91 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 96.9 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 96.9 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 96.87 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 96.85 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 96.85 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 96.84 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 96.83 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 96.83 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 96.83 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 96.82 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 96.82 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 96.8 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 96.78 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 96.77 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 96.74 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 96.73 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 96.72 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 96.69 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 96.67 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.66 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 96.66 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.65 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.64 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.64 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.61 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.6 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.59 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 96.58 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 96.57 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 96.54 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 96.5 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 96.48 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 96.46 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 96.45 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 96.41 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 96.37 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 96.34 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 96.32 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 96.29 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 96.28 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 96.27 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 96.24 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 96.22 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.2 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 96.15 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 96.15 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 96.12 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.12 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 96.08 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 96.07 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 96.04 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 96.03 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 96.03 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 95.99 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 95.87 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 95.84 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 95.81 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 95.71 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 94.13 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 94.09 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 93.96 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 93.51 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 93.43 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 93.31 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 92.89 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 92.66 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 91.66 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 90.86 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 90.42 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 83.75 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 83.74 |
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.3e-71 Score=636.44 Aligned_cols=529 Identities=25% Similarity=0.390 Sum_probs=408.1
Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccCCCchhHHHHHHHHHHHHHHHHHHHHHHhhccCCC
Q 005399 90 GVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSLDD 169 (698)
Q Consensus 90 ~~~~~a~lvGvl~G~~~~~f~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~l~p~~ggl~vgll~~~~~~~~~~~ 169 (698)
.+++.++++|+++|+++++|+.++++.++++|...+.. ..+.. ..+|++.+++|++||++++++.++.... ..
T Consensus 23 ~~~~~~~~vG~~~Gl~~~~f~~~~~~~~~~~~~~~~~~-~~~~~----~~~~~~~~~~p~~ggli~~~~~~~~~~~--~~ 95 (574)
T PRK01862 23 TMLIWSAIVGIGGAFATTAFREGIELIQHLISGHSGSF-VEMAK----SLPWYVRVWLPAAGGFLAGCVLLLANRG--AR 95 (574)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcchH-HHHhh----cccHHHHHHHHHHHHHHHHHHHHHhccc--cc
Confidence 37789999999999999999999999999998753211 01111 1356667889999999999886543322 12
Q ss_pred CCCcchhhccccCCCCCCCcccccccchhhhcccCCCCCcccccchhhhhHHHHHHHHHHHHHhcCCccCCchhHHHHHH
Q 005399 170 DDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGK 249 (698)
Q Consensus 170 g~g~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~k~~~~~ltl~sG~s~G~EgP~v~iGa 249 (698)
+ +++.+.+..-... ..+. .++..+.|++++++++++|+|+|||||++|+|+
T Consensus 96 ~-~g~~~~~~~~~~~---------------------------~~~~-~~~~~~~k~~~~~l~i~~G~s~G~EgP~v~~ga 146 (574)
T PRK01862 96 K-GGKTDYMEAVALG---------------------------DGVV-PVRQSLWRSASSLLTIGSGGSIGREGPMVQLAA 146 (574)
T ss_pred c-CCcHHHHHHHHcC---------------------------CCCC-ChHHHHHHHHHHHHHHHcCCCcCCcchHHHHHH
Confidence 2 2233322211000 0111 123456799999999999999999999999999
Q ss_pred HHHHHHHhhcCCChhhHHHHHHhhhhHhHHHHhhhhHHHHHHHHHHhcccCcccchhhhhhhHHHHHHHHHHHHHHHHhh
Q 005399 250 SIAKGVGNLFDRRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEV 329 (698)
Q Consensus 250 ~ig~~l~~~~~~~~~~~r~l~~~G~aAgiaa~F~APl~G~lFa~E~~~~~~~~~~~~~~~~~~~~~~~~aav~a~~v~~~ 329 (698)
++|++++|+++.+++++|.+++||+|||+||+||||++|++|++|+++.++ ..+++.+ ++++|++|+++++.
T Consensus 147 ~~~~~~~~~~~~~~~~~r~l~~~G~aAglaa~F~aPl~g~lFa~E~~~~~~-------~~~~~~~-~~~as~~a~~v~~~ 218 (574)
T PRK01862 147 LAASLVGRFAHFDPPRLRLLVACGAAAGITSAYNAPIAGAFFVAEIVLGSI-------AMESFGP-LVVASVVANIVMRE 218 (574)
T ss_pred HHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHhCCchHHHHHHHHHHhhhc-------cHHHHHH-HHHHHHHHHHHHHH
Confidence 999999999999999999999999999999999999999999999987653 2355665 68999999999999
Q ss_pred hcCCCCccccccCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCchhHHHHHHHHHHHHHHHHhhc
Q 005399 330 GLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIALMFPE 409 (698)
Q Consensus 330 ~~g~~~~f~~~~~~~~~~~~l~~~illGil~Gl~g~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~lggllvg~i~~~~P~ 409 (698)
+.|+++.|.+|.++.++..++++++++|++||++|.+|+++..+.++.+ ++.+.+++++++++|+++|++.+++|+
T Consensus 219 ~~g~~~~~~~~~~~~~~~~~~~~~~~lGv~~G~~~~~f~~~~~~~~~~~----~~~~~~~~~~~~~~gl~~g~l~~~~p~ 294 (574)
T PRK01862 219 FAGYQPPYEMPVFPAVTGWEVLLFVALGVLCGAAAPQFLRLLDASKNQF----KRLPVPLPVRLALGGLLVGVISVWVPE 294 (574)
T ss_pred HcCCCceeeCCCcCcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----hccCCchhHHHHHHHHHHHHHHHHHHH
Confidence 9999999998876656678899999999999999999999887765443 333445677899999999999999999
Q ss_pred cccCcHHHHHHHHccCCCCccccHHHHHHHHHHHHHHHHHhhhcCCccceechHHHHhhHHHHHHHHHHHHhhhcCCCcc
Q 005399 410 ILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTI 489 (698)
Q Consensus 410 ~~g~G~~~i~~ll~~~~~~~~~s~~~l~~~~~~K~l~t~lt~gsG~~GG~f~Psl~iGA~~G~~~g~~~~~~~p~~~~~~ 489 (698)
.+|+||+.++.+++++ .+...++.++++|+++|++|+|+|+|||+|+|++++||++|+++|.+++..+|.
T Consensus 295 ~~g~G~~~i~~~~~~~-----~~~~~l~~~~~~K~~~t~~t~g~G~~GG~f~P~l~iGa~~G~~~g~~~~~~~~~----- 364 (574)
T PRK01862 295 VWGNGYSVVNTILHAP-----WTWQALVAVLVAKLIATAATAGSGAVGGVFTPTLFVGAVVGSLFGLAMHALWPG----- 364 (574)
T ss_pred HhcCCHHHHHHHHcCC-----chHHHHHHHHHHHHHHHHHHHccCCCccchhhHHHHHHHHHHHHHHHHHHhCCC-----
Confidence 9999999999988764 345566777889999999999999999999999999999999999999876554
Q ss_pred ccccccccchHHHHHHHHHHHHHHhhcchHHHHHHHHHHhcChhhHHHHHHHHHHHHHHhhccccccchhhhhHhhhhcc
Q 005399 490 HFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAVHANT 569 (698)
Q Consensus 490 ~~~~~~~~~p~~~alvGaaA~la~v~~aPls~~vi~~Eltg~~~~llPlmiav~va~~v~~~~~~~~~~~~~~~~~~~~~ 569 (698)
...+|..|+++||+|++++++|+|+|++++++|+|++++.++|+|+++++|+++++. ++.+++|+.........
T Consensus 365 -----~~~~~~~~a~vGmaa~~aa~~~aPlt~i~l~~Elt~~~~~~~P~~ia~~~a~~v~~~-~~~~~iy~~~~~~~~~~ 438 (574)
T PRK01862 365 -----HTSAPFAYAMVGMGAFLAGATQAPLMAILMIFEMTLSYQVVLPLMVSCVVAYFTARA-LGTTSMYEITLRRHQDE 438 (574)
T ss_pred -----cccchHHHHHHHHHHHHHHHHccHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHH-hCCCChHHHHHHhcccc
Confidence 223578899999999999999999999999999999999999999999999988754 66789999876543221
Q ss_pred c------cccccccccccccccc----cchhhhcccc-cccccccccc------ccccccchhh--hhhhhccccchhcc
Q 005399 570 N------RKRQFEIYTSRTRGLS----SSDLLAEEEP-YAINLCEVES------SLCIDDWNLE--VEELKRRVFVSEVM 630 (698)
Q Consensus 570 ~------~~~~~~i~~~~~~~l~----~~~lL~~~~~-~~~~l~~v~~------~l~~~d~~~~--~~~~~~~i~v~dvM 630 (698)
. ..+..+++..+...++ ..|.++...+ ....++.+++ .++.+|+.+. +++..++.+++|+|
T Consensus 439 ~~~~~L~~~~V~dim~~~~~~v~~~~tl~ea~~~l~~~~~~~~~VvD~~g~lvGiVt~~dL~~~l~~~~~~~~~~v~dim 518 (574)
T PRK01862 439 AERERLRTTQMRELIQPAQTVVPPTASVADMTRVFLEYPVKYLYVVDDDGRFRGAVALKDITSDLLDKRDTTDKTAADYA 518 (574)
T ss_pred chhhHHhhCcHHHHhcCCCceeCCCCCHHHHHHHHHhCCCceEEEEcCCCeEEEEEEHHHHHHHhhcccccccchHHHhc
Confidence 1 1112223322222222 2232222211 1222333322 2344554321 11122346799999
Q ss_pred ccCceEEcCCCCHHHHHHHHHHcCCCEEEEEccC--CeEEEEEeHHHHHHHHHH
Q 005399 631 RTRYVTVLMTTLLIEALTLMLAEKQSCAMIVDND--NILIGLLTLGDIEEFSKY 682 (698)
Q Consensus 631 ~~~~~~v~~~~~l~eal~~m~~~~~~~lpVVd~~--g~lvGiVt~~dl~~~l~~ 682 (698)
+++++++++|++++|+++.|.+++.+.+||+|++ ++++|+||++|+.+.+++
T Consensus 519 ~~~~~~v~~d~~L~~al~~m~~~~~~~lpVVd~~~~~~liGvIt~~DIl~~l~~ 572 (574)
T PRK01862 519 HTPFPLLTPDMPLGDALEHFMAFQGERLPVVESEASPTLAGVVYKTSLLDAYRR 572 (574)
T ss_pred cCCCeeECCCCCHHHHHHHHHhcCCCeeeeEeCCCCCeEEEEEEHHHHHHHHHh
Confidence 9999999999999999999999999999999876 489999999999998763
|
|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd00400 Voltage_gated_ClC CLC voltage-gated chloride channel | Back alignment and domain information |
|---|
| >cd01031 EriC ClC chloride channel EriC | Back alignment and domain information |
|---|
| >cd01034 EriC_like ClC chloride channel family | Back alignment and domain information |
|---|
| >PRK05277 chloride channel protein; Provisional | Back alignment and domain information |
|---|
| >cd01033 ClC_like Putative ClC chloride channel | Back alignment and domain information |
|---|
| >PRK01610 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd03682 ClC_sycA_like ClC sycA-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03685 ClC_6_like ClC-6-like chloride channel proteins | Back alignment and domain information |
|---|
| >COG0038 EriC Chloride channel protein EriC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01036 ClC_euk Chloride channel, ClC | Back alignment and domain information |
|---|
| >cd03683 ClC_1_like ClC-1-like chloride channel proteins | Back alignment and domain information |
|---|
| >cd03684 ClC_3_like ClC-3-like chloride channel proteins | Back alignment and domain information |
|---|
| >PRK03655 putative ion channel protein; Provisional | Back alignment and domain information |
|---|
| >PF00654 Voltage_CLC: Voltage gated chloride channel Mutation in several of these channels lead to human disease | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 698 | ||||
| 2ht2_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-11 | ||
| 2htk_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-11 | ||
| 3det_A | 473 | Structure Of The E418a, Y445a Doubly Ungated Mutant | 1e-11 | ||
| 2ez0_A | 473 | Crystal Structure Of The S107aE148QY445A MUTANT OF | 1e-11 | ||
| 1kpk_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 2e-11 | ||
| 2exy_A | 473 | Crystal Structure Of The E148q Mutant Of Ecclc, Fab | 2e-11 | ||
| 2ht3_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-11 | ||
| 3ejz_A | 473 | Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, C | 2e-11 | ||
| 3ejy_A | 473 | Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTE | 2e-11 | ||
| 2ht4_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-11 | ||
| 2htl_A | 473 | Structure Of The Escherichia Coli Clc Chloride Chan | 2e-11 | ||
| 2hlf_A | 444 | Structure Of The Escherichis Coli Clc Chloride Chan | 6e-11 | ||
| 2fec_A | 465 | Structure Of The E203q Mutant Of The Cl-H+ EXCHANGE | 1e-10 | ||
| 1ots_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-10 | ||
| 1otu_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-10 | ||
| 2r9h_A | 444 | Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Com | 1e-10 | ||
| 4ftp_A | 465 | Structure Of The E202y Mutant Of The Cl-H+ ANTIPORT | 1e-10 | ||
| 4ene_A | 446 | Structure Of The N- And C-Terminal Trimmed Clc-Ec1 | 1e-10 | ||
| 1ott_A | 465 | Structure Of The Escherichia Coli Clc Chloride Chan | 1e-10 | ||
| 3nmo_A | 465 | Crystal Structure Of An Engineered Monomeric Clc-Ec | 3e-10 | ||
| 1kpl_A | 473 | Crystal Structure Of The Clc Chloride Channel From | 8e-10 | ||
| 3nd0_A | 466 | X-Ray Crystal Structure Of A Slow Cyanobacterial Cl | 5e-08 |
| >pdb|2HT2|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445h Mutant And Fab Complex Length = 473 | Back alignment and structure |
|
| >pdb|2HTK|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445a Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3DET|A Chain A, Structure Of The E418a, Y445a Doubly Ungated Mutant Of E.Coli Clc_ec1, Cl-H+ ANTIPORTER Length = 473 | Back alignment and structure |
| >pdb|2EZ0|A Chain A, Crystal Structure Of The S107aE148QY445A MUTANT OF ECCLC, In Complex With A Fab Fragment Length = 473 | Back alignment and structure |
| >pdb|1KPK|A Chain A, Crystal Structure Of The Clc Chloride Channel From E. Coli Length = 473 | Back alignment and structure |
| >pdb|2EXY|A Chain A, Crystal Structure Of The E148q Mutant Of Ecclc, Fab Complexed In Absence Of Bound Ions Length = 473 | Back alignment and structure |
| >pdb|2HT3|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445l Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|3EJZ|A Chain A, Structure Of E203v Mutant E.Coli Cl-H+ EXCHANGER, CLC-Ec1 Length = 473 | Back alignment and structure |
| >pdb|3EJY|A Chain A, Structure Of E203h Mutant Of E.Coli Cl-H+ ANTIPORTER, CLC- Ec1 Length = 473 | Back alignment and structure |
| >pdb|2HT4|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445w Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2HTL|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel Y445f Mutant And Fab Complex Length = 473 | Back alignment and structure |
| >pdb|2HLF|A Chain A, Structure Of The Escherichis Coli Clc Chloride Channel Y445e Mutant And Fab Complex Length = 444 | Back alignment and structure |
| >pdb|2FEC|A Chain A, Structure Of The E203q Mutant Of The Cl-H+ EXCHANGER CLC- Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|1OTS|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|1OTU|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148q Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|2R9H|A Chain A, Crystal Structure Of Q207c Mutant Of Clc-Ec1 In Complex With Fab Length = 444 | Back alignment and structure |
| >pdb|4FTP|A Chain A, Structure Of The E202y Mutant Of The Cl-H+ ANTIPORTER CLC-Ec1 From E.Coli Length = 465 | Back alignment and structure |
| >pdb|4ENE|A Chain A, Structure Of The N- And C-Terminal Trimmed Clc-Ec1 Cl-H+ ANTIPORTER And Fab Complex Length = 446 | Back alignment and structure |
| >pdb|1OTT|A Chain A, Structure Of The Escherichia Coli Clc Chloride Channel E148a Mutant And Fab Complex Length = 465 | Back alignment and structure |
| >pdb|3NMO|A Chain A, Crystal Structure Of An Engineered Monomeric Clc-Ec1 Cl-H+ Transporter Length = 465 | Back alignment and structure |
| >pdb|1KPL|A Chain A, Crystal Structure Of The Clc Chloride Channel From S. Typhimurium Length = 473 | Back alignment and structure |
| >pdb|3ND0|A Chain A, X-Ray Crystal Structure Of A Slow Cyanobacterial Cl-H+ ANTIPORTER Length = 466 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 698 | |||
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 6e-88 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 6e-86 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 3e-59 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-08 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 1e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 7e-05 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 2e-04 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 7e-08 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 7e-04 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 2e-07 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 4e-05 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 6e-05 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 3e-07 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 8e-04 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 5e-07 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 1e-04 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 1e-06 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 3e-05 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 1e-06 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 2e-04 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 1e-06 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 7e-05 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 2e-06 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 1e-05 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 3e-06 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 3e-06 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 2e-05 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 3e-06 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 6e-06 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 3e-06 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 9e-05 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 3e-06 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 4e-06 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 3e-06 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 8e-06 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 4e-05 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 1e-04 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 5e-06 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 1e-05 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 6e-06 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 7e-06 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 8e-06 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 6e-04 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 1e-05 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 3e-05 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 1e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 1e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 2e-05 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 2e-05 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 4e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 2e-05 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 9e-05 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 2e-05 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 3e-05 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 5e-05 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 8e-04 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 7e-05 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 2e-04 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 9e-05 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 6e-04 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 1e-04 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 2e-04 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 1e-04 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 1e-04 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 1e-04 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 2e-04 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 2e-04 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 2e-04 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 4e-04 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 5e-04 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 7e-04 |
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A Length = 466 | Back alignment and structure |
|---|
Score = 282 bits (723), Expect = 6e-88
Identities = 90/462 (19%), Positives = 182/462 (39%), Gaps = 67/462 (14%)
Query: 91 VIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPAC 150
++++ +VGL+TG+ F V+ + + A L P A + ++
Sbjct: 31 TLVAAIVVGLITGVLGAGFKSAVNNMLQWR-----SQLAQILAPIPPLAWLVTALISGGM 85
Query: 151 GGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPH--PQAQAKDDISVITVSSTTSLP 208
++ R+A PQ +
Sbjct: 86 VALSFWLM--KRFA-----------------PDTSGSGIPQIEG---------------- 110
Query: 209 TIYYDYLKIAFQ-PLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKV 267
+ + + +K V ++LG G G EGP++++G SI + G F +
Sbjct: 111 HLEGKLPLVWQRVLPIKLVGGFLSLGAGMLAGFEGPTIQMGGSIGQMTGGWFKATQENQR 170
Query: 268 SLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVS 327
L+A G+ AG+++ FNA +AG E + P + + A + ++ V+A+++
Sbjct: 171 ILIAVGAGAGLATAFNAPLAGVALIGE-EMHPRFRSQTLAYHS-----LLFGCVMATIIL 224
Query: 328 EVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGI 387
+ G + E+ L ++++LG+L G++ T +R + ++D + +
Sbjct: 225 RMIRGQSAIISLTEFKRVPLDSLWMFIILGILFGVMGYTFNRG---LFKVLDWFDRLPPL 281
Query: 388 PKAVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVAT 447
+ G +G+++L + G V S+ L+ + + + T
Sbjct: 282 ATKWKGFLLGSIIGILSLFPLPLTDGGDNAVLWAFNSQ-----SHFSTLILVFCGRFLLT 336
Query: 448 SLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGM 507
+C SG +GG +AP L I + +A + + ++ P + GM
Sbjct: 337 LICYGSGAIGGIFAPMLGIASIVSVAMARHFH----------LLFPSQIPEPAVMAIAGM 386
Query: 508 AATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFT 549
A +A + PLT++LL E+T +Y ++LPLL ++S
Sbjct: 387 GALVAATVRAPLTAILLTIEMTDNYFVILPLLVTCLVASVVA 428
|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... Length = 465 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 Length = 138 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 Length = 282 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* Length = 159 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} Length = 138 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} PDB: 3kpd_A* 3kpc_A* Length = 122 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} Length = 165 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} Length = 180 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A Length = 133 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A Length = 184 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 Length = 157 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 Length = 125 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 Length = 213 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* Length = 280 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A Length = 144 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 Length = 133 | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A Length = 141 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 Length = 160 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* Length = 330 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 Length = 486 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* Length = 334 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C Length = 323 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} Length = 157 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} Length = 128 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* Length = 511 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 Length = 491 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 Length = 494 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* Length = 503 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} Length = 496 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 Length = 135 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* Length = 514 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 698 | |||
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 100.0 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 100.0 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 100.0 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 100.0 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.81 | |
| 1ots_A | 465 | Voltage-gated CLC-type chloride channel ERIC; CLC | 99.61 | |
| 3nd0_A | 466 | SLL0855 protein; CLC family CL-/H+ antiporter, CLC | 99.59 | |
| 4ene_A | 446 | CLC-EC1, H(+)/CL(-) exchange transporter CLCA; mem | 99.58 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.55 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.47 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.45 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.44 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.42 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.41 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.4 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.4 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.39 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.39 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.37 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.36 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.36 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.35 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.34 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.34 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.33 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.33 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.33 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.32 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.32 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.32 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.31 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.31 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.3 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.3 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.29 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.28 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.28 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.27 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.26 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.25 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.25 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.25 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.25 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.24 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.24 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.23 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.23 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.22 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.22 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.21 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.21 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.21 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.21 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.21 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.2 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.19 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.18 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.18 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.18 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.18 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.18 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.18 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.17 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.17 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.17 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.16 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.15 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.15 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.14 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.14 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.12 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.11 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.11 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.11 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.1 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.1 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.1 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.09 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.09 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.08 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.07 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.07 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.07 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.05 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.05 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.04 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.03 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.02 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.0 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 97.99 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.98 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 97.98 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 97.98 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 97.97 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 97.96 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 97.96 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.94 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.94 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 97.91 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 97.9 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.85 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 97.8 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 97.76 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.73 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 97.69 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 97.69 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.66 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 97.64 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 97.63 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 97.61 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.59 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.59 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 97.56 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 97.54 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.54 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.48 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.37 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 97.32 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 97.2 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.18 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.15 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.12 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.11 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 96.81 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.74 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.69 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.66 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 96.66 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.27 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.05 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 95.65 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 94.71 |
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-67 Score=611.98 Aligned_cols=529 Identities=19% Similarity=0.231 Sum_probs=378.6
Q ss_pred hhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccCCCchhHHHHHHHHHHHHHHHHHHHHHHhhccC
Q 005399 88 NSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALSL 167 (698)
Q Consensus 88 ~~~~~~~a~lvGvl~G~~~~~f~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~l~p~~ggl~vgll~~~~~~~~~ 167 (698)
-++++++++++|+++|+++++|+.+++++++++..... +... ...|+.++++|++++++++++.++. .
T Consensus 7 ~~r~~~~~~lvGi~~gl~~~~~~~~i~~~~~~~~~~~~-----~~~~---~~~~~~~~~~~~~~~~~~~~l~~~~----~ 74 (632)
T 3org_A 7 LLRLVCFLTLLGVTAALFIFAVDLAVHGLEELRMKISR-----LAGR---FAGYILYVVSGVALCLLSTFWCAVL----S 74 (632)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HSCH---HHHHHHHHHHHHHHHHHHHHHHHHS----C
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----Hhhh---hHHHHHHHHHHHHHHHHHHHHHHhc----C
Confidence 45778899999999999999999999999886532110 0000 1234445678999998888876432 2
Q ss_pred CCCCCcchhhccccCCCCCCCcccccccchhhhcccCCCCCcccccchhhhhHHHHHHHHHHHHHhcCCccCCchhHHHH
Q 005399 168 DDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEI 247 (698)
Q Consensus 168 ~~g~g~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~k~~~~~ltl~sG~s~G~EgP~v~i 247 (698)
+...|+||||++.... +. .. +.++...+++.+.|++++++++++|+|+|||||++|+
T Consensus 75 p~a~GsGIp~v~~~l~--g~--------~~-------------~~~~~~~~~~~~~K~~~~~l~igsG~s~GrEGP~vqi 131 (632)
T 3org_A 75 TEAEGSGLPQMKSILS--GF--------YD-------------KMRSALELRVLFAKALGLICAIGGGLPVGWEGPNVHI 131 (632)
T ss_dssp GGGCBCSHHHHHHHTT--TT--------HH-------------HHGGGGSHHHHHHHHHHHHHHHHTTCSCBSHHHHHHH
T ss_pred CccCCCCHHHHHHHHh--Cc--------cc-------------cccccccHHHHHHHHHHHHHHHhcCCCccccchHHHH
Confidence 3345788999875321 00 00 0122344567789999999999999999999999999
Q ss_pred HHHHHHHHHh--hcC---CChhhHHHHHHhhhhHhHHHHhhhhHHHHHHHHHHhcccCcccchhhhhhhHHHHHHHHHHH
Q 005399 248 GKSIAKGVGN--LFD---RRPRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVI 322 (698)
Q Consensus 248 Ga~ig~~l~~--~~~---~~~~~~r~l~~~G~aAgiaa~F~APl~G~lFa~E~~~~~~~~~~~~~~~~~~~~~~~~aav~ 322 (698)
||++|+.+++ +|+ .++++||.+++||+|||+||+||||++|++|++|+++.++. .+++++ ++++|++
T Consensus 132 Ga~ig~~~~~~~~f~~~~~~~~~~r~ll~aGaaAG~aaaF~aPlaGvlFalE~~~~~~~-------~~~~~~-~~~as~~ 203 (632)
T 3org_A 132 ACIIAHQFYRLGVFKELCTDRALRLQTLAAACAVGLASSFGAPLGGVLYSIETIASFYL-------VQAFWK-GVLSALS 203 (632)
T ss_dssp HHHHHHHHTTSHHHHHHHHSHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHTCSEEE-------TTHHHH-HHHHHHH
T ss_pred HHHHHHHHhhhhhhccccCCHHHHHHHHHHHHHHHHHHHhCCccHhHHHHHHHHHHHHh-------HHHHHH-HHHHHHH
Confidence 9999999999 776 57788999999999999999999999999999999976432 234454 6889999
Q ss_pred HHHHHhhhcCCCC---cccc--c-cCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCchhHHHHHH
Q 005399 323 ASVVSEVGLGSEP---AFKV--P-EYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMG 396 (698)
Q Consensus 323 a~~v~~~~~g~~~---~f~~--~-~~~~~~~~~l~~~illGil~Gl~g~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~lg 396 (698)
|+++++.+.++.+ .|.. + +++ +++.++ +++++|++||++|.+|++++.++.+. ++.+..+.+++++++++
T Consensus 204 a~~v~~~~~~~~~~~~~~~~~~~~~~~-~~~~~l-~~~~lGi~~Gl~g~~f~~~~~~~~~~--~~~~~~~~~~~~~~~~~ 279 (632)
T 3org_A 204 GAIVYELLYTTPLVEAFEGTNFDASDV-SRTQTL-LYAILGALMGVLGALFIRCVRSIYEL--RMRHYPGTNRYFLVGVV 279 (632)
T ss_dssp HHHHTTC------------------CC-CCSCTH-HHHHHHHHHHHHHHHHHHHHHHHHHH--HHHSSTTCCTHHHHHHH
T ss_pred HHHHHHHhccCccccccccccccccCC-CcHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHH--HHHhhcchhHHHHHHHH
Confidence 9998886554332 2221 1 122 356788 99999999999999999998876543 22222344567888888
Q ss_pred HHHHHHHHHHhhccccC--cHHHHHHHHccCCCCc--cccHHHHHHHHHHHHHHHHHhhhcCCccceechHHHHhhHHHH
Q 005399 397 GLAVGLIALMFPEILYW--GFENVDILLESRPFVK--GLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGM 472 (698)
Q Consensus 397 gllvg~i~~~~P~~~g~--G~~~i~~ll~~~~~~~--~~s~~~l~~~~~~K~l~t~lt~gsG~~GG~f~Psl~iGA~~G~ 472 (698)
+++++ .+++|+.+|. +++.++.++++..+.. ..++..++.++++|+++|++|+|+|.|||+|+|++++||++|+
T Consensus 280 ~~~~~--~l~~p~~~g~~~~~~~i~~l~~~~~~~~~~~~~~~~l~~~~~~k~~~t~~s~g~g~pGGif~P~l~iGA~~G~ 357 (632)
T 3org_A 280 ALFAS--ALQYPFRLFALDPRATINDLFKAVPLYQTDHFGWTELILMPIIKFILVALSIGLPLPAGVFVPSFLIGAGFGR 357 (632)
T ss_dssp HHHHH--HHTTTC------CHHHHHHHHSCC----------CCSSHHHHHHHHHHHHHTTSSSBCBCHHHHHHHHHHHHH
T ss_pred HHHHH--HHHHHHHhcCCcHHHHHHHHHcCCccccccchhHHHHHHHHHHHHHHHHHHHhCCCcchhhHHHHHHHHHHHH
Confidence 88776 3578888765 6888988887653211 1222245667889999999999999999999999999999999
Q ss_pred HHHHHHHHhhhcCCCccccccccccchHHHHHHHHHHHHHHhhcchHHHHHHHHHHhcChhhHHHHHHHHHHHHHHhhcc
Q 005399 473 AYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQ 552 (698)
Q Consensus 473 ~~g~~~~~~~p~~~~~~~~~~~~~~~p~~~alvGaaA~la~v~~aPls~~vi~~Eltg~~~~llPlmiav~va~~v~~~~ 552 (698)
++|.+++..+|. ..+|+.||++||||+++|++|+|++++ |++||||++++++|+|+++++|+++++.+
T Consensus 358 ~~g~~~~~~~p~-----------~~~p~~~a~vGmaa~~~~v~~ap~t~v-i~~E~tg~~~~~lpl~ia~~~a~~v~~~~ 425 (632)
T 3org_A 358 LYGELMRVVFGN-----------AIVPGSYAVVGAAAFTAGVTRALSCAV-IIFEVTGQIRHLVPVLISVLLAVIVGNAF 425 (632)
T ss_dssp HHHHHHHHHHCT-----------TSCHHHHHHHHHHHHHHHHSCCTTHHH-HHHHHTCCCSCSHHHHHHHHHHHHHHHHH
T ss_pred HHHHHHHHhCCc-----------ccchHHHHHHHHHHHHHHHHHHHHHHH-HHHHHhCChhHHHHHHHHHHHHHHHHHHh
Confidence 999999877764 146899999999999999999999875 89999999999999999999999998754
Q ss_pred ccccchhhhhHhhhhc----------ccccccccccc--cccccccc----chhhhccc--cccccccccccc------c
Q 005399 553 MRRRDVKETKVAVHAN----------TNRKRQFEIYT--SRTRGLSS----SDLLAEEE--PYAINLCEVESS------L 608 (698)
Q Consensus 553 ~~~~~~~~~~~~~~~~----------~~~~~~~~i~~--~~~~~l~~----~~lL~~~~--~~~~~l~~v~~~------l 608 (698)
++++|+.....+.. ....+..++|. .+...++. .|..+... ..++.++.+++. +
T Consensus 426 --~~~iY~~~~~~k~lp~l~~~~~~~~~~~~V~diM~p~~~v~~v~~~~t~~e~~~~~~~~~~~~~~PVvd~~~~lvGiV 503 (632)
T 3org_A 426 --NRSLYETLVLMKHLPYMPILRRDRSPEMTAREIMHPIEGEPHLFPDSEPQHIKGILEKFPNRLVFPVIDANGYLLGAI 503 (632)
T ss_dssp --CCCHHHHHHHHTTCCEEEEECTTCCTTSBHHHHCBCTTTSCCBCSSSCHHHHHHHHHHSTTCCEECBBCTTCBBCCEE
T ss_pred --CCCHHHHHHHhcCCCccccccccccccCcHHHHhhcCCCceEecCCCcHHHHHHHHHhcCCcceEEEEecCCeEEEEE
Confidence 46899977543321 11223344454 33333332 23322222 233445555421 2
Q ss_pred ccccchhhhhh-----------------------------hh-------------------c-cccchhccccCceEEcC
Q 005399 609 CIDDWNLEVEE-----------------------------LK-------------------R-RVFVSEVMRTRYVTVLM 639 (698)
Q Consensus 609 ~~~d~~~~~~~-----------------------------~~-------------------~-~i~v~dvM~~~~~~v~~ 639 (698)
+.+|+.+...+ .. + .-+++|+|+++++++++
T Consensus 504 t~~DL~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~v~~iMt~~pitV~~ 583 (632)
T 3org_A 504 SRKEIVDRLQHVLEDVPEPIAGHRTLVLLDAADLSENIEGLVDETPSGEHSSKGKRTATVLEPTSSLVVPCDVSPIVVTS 583 (632)
T ss_dssp SHHHHTTTTTTC-------------------------------------------------------CCSCCCCCCEEET
T ss_pred EHHHHHHHHHHHhhhcccccccccceeccCHHHHHhhcccCCCCCcccchhhhcccceEeeccccccchhhcCCCceecC
Confidence 33333211000 00 0 01388999999999999
Q ss_pred CCCHHHHHHHHHHcCCCEEEEEccCCeEEEEEeHHHHHHHH
Q 005399 640 TTLLIEALTLMLAEKQSCAMIVDNDNILIGLLTLGDIEEFS 680 (698)
Q Consensus 640 ~~~l~eal~~m~~~~~~~lpVVd~~g~lvGiVt~~dl~~~l 680 (698)
++++.|+.+.|.+++.+.+||+ ++|+++|+||++|+.+.+
T Consensus 584 ~~~l~ea~~~M~~~~i~~lpVv-e~G~lvGIVT~~Dll~~~ 623 (632)
T 3org_A 584 YSLVRQLHFLFVMLMPSMIYVT-ERGKLVGIVEREDVAYGY 623 (632)
T ss_dssp TCBHHHHHHHHHHTCCSEEEEE-ETTEEEEEEEGGGTEECC
T ss_pred CCcHHHHHHHHHhcCCCEEEEE-ECCEEEEEEehhhHHHHH
Confidence 9999999999999999999999 679999999999997653
|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1ots_A Voltage-gated CLC-type chloride channel ERIC; CLC chloride channel, FAB complex, membrane protein; 2.51A {Escherichia coli} SCOP: f.20.1.1 PDB: 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2htl_A 3ejy_A 2ht2_A 2fed_A 2fec_A 1otu_A 3ejz_A 2ht4_A 2htk_A 2ht3_A 1ott_A 2h2s_A 3det_A 2ez0_A 3nmo_A ... | Back alignment and structure |
|---|
| >3nd0_A SLL0855 protein; CLC family CL-/H+ antiporter, CLC_EC1 homolog, transport protein; 3.20A {Synechocystis} PDB: 3q17_A | Back alignment and structure |
|---|
| >4ene_A CLC-EC1, H(+)/CL(-) exchange transporter CLCA; membrane protein, coupled ION transporter, cell membrane, TR protein; HET: DMU MAL; 2.40A {Escherichia coli k-12} PDB: 1ots_A 2fee_A 2h2p_A 2exw_A 1kpk_A 2exy_A 2fed_A 2fec_A 1otu_A 2htl_A 2ht2_A 3ejy_A 1ott_A 2h2s_A 4fg6_A 2ht4_A 4ftp_A 3ejz_A 2ht3_A 2htk_A ... | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 698 | ||||
| d1otsa_ | 444 | f.20.1.1 (A:) Clc chloride channel {Escherichia co | 5e-51 | |
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 8e-07 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 3e-06 | |
| d1jr1a4 | 120 | d.37.1.1 (A:113-232) Type II inosine monophosphate | 2e-05 | |
| d1o50a3 | 145 | d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Th | 2e-05 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 3e-05 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 8e-05 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 0.002 | |
| d2ouxa2 | 127 | d.37.1.1 (A:136-262) Magnesium transporter MgtE {E | 1e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 2e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 0.004 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 2e-04 | |
| d2o16a3 | 139 | d.37.1.1 (A:20-158) Hypothetical protein VC0737 {V | 2e-04 | |
| d2yzqa2 | 122 | d.37.1.1 (A:1-122) Uncharacterized protein PH1780 | 2e-04 | |
| d2ooxe2 | 153 | d.37.1.1 (E:182-334) Uncharacterized protein C1556 | 4e-04 | |
| d1vr9a3 | 121 | d.37.1.1 (A:1-121) Hypothetical protein TM0892, CB | 0.001 | |
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 0.001 | |
| d1zfja4 | 126 | d.37.1.1 (A:95-220) Type II inosine monophosphate | 0.001 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 0.002 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 0.004 | |
| d3ddja2 | 135 | d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 | 0.003 | |
| d2yzia1 | 132 | d.37.1.1 (A:4-135) Uncharacterized protein PH0107 | 0.003 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 0.004 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} Length = 444 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Score = 181 bits (460), Expect = 5e-51
Identities = 95/460 (20%), Positives = 179/460 (38%), Gaps = 59/460 (12%)
Query: 91 VIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPAC 150
++ + +VG L G+ V F+KGV +++ + + ++ P + L A
Sbjct: 19 ILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTADNY------PLLLTVAFLCSAV 72
Query: 151 GGFIVSILNQLRYALSLDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTI 210
L + +YA P+A +
Sbjct: 73 LAMFGYFLVR-KYA-----------------------PEAGGSGIPEIEGALEDQRPVRW 108
Query: 211 YYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVEIGKSIAKGVGNLFDRRPRRKVSLV 270
+ +K TLG G LG EGP+V+IG +I + V ++F + +
Sbjct: 109 WR-------VLPVKFFGGLGTLGGGMVLGREGPTVQIGGNIGRMVLDIFRLKGDEARHTL 161
Query: 271 -AAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASVVSEV 329
A G+AAG+++ FNA +AG F +E + + V + ++++++ +
Sbjct: 162 LATGAAAGLAAAFNAPLAGILFIIEEMRP------QFRYTLISIKAVFIGVIMSTIMYRI 215
Query: 330 GLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPK 389
V + L LYL+LG++ G+ ++ M ++ + N
Sbjct: 216 FNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKW 275
Query: 390 AVFPVMGGLAVGLIALMFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSL 449
+ G GL+ + P GF + I + ML+ + A+++ T L
Sbjct: 276 VLMGGAIGGLCGLLGFVAPATSGGGFNLIPIATAGNF-----SMGMLVFIFVARVITTLL 330
Query: 450 CRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQSNPTIHFSILEVASPQAYGLVGMAA 509
C +SG GG +AP L +G G A+G Q + + + GM A
Sbjct: 331 CFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQYHL----------EAGTFAIAGMGA 380
Query: 510 TLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFT 549
LA + PLT ++L+ E+T +Y+++LP++ ++
Sbjct: 381 LLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLA 420
|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 120 | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} Length = 145 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} Length = 127 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} Length = 139 | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 122 | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 153 | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} Length = 121 | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} Length = 126 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 135 | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} Length = 132 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 698 | |||
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 100.0 | |
| d1otsa_ | 444 | Clc chloride channel {Escherichia coli [TaxId: 562 | 99.41 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.79 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.64 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.52 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.5 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.46 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.45 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.44 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.42 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.42 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.41 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.4 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.4 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.38 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.37 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.34 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.33 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.32 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.32 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.31 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.3 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.29 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.28 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.28 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.28 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.27 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.27 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.26 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.25 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.22 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 98.19 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.18 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.17 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.16 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.15 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.11 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.09 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.08 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.06 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.05 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 97.98 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 97.98 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.89 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.86 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.84 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.82 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.8 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 97.77 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.76 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 97.7 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.7 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 97.69 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 97.52 |
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Clc chloride channel superfamily: Clc chloride channel family: Clc chloride channel domain: Clc chloride channel species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=6.2e-60 Score=524.12 Aligned_cols=420 Identities=22% Similarity=0.349 Sum_probs=337.1
Q ss_pred chhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCCCCCCcccccCCCchhHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 005399 87 GNSGVIISSCLVGLLTGIGVVLFNKGVHEIRDFFWDGIPYGGASWLREKPIPAIWIRVVLVPACGGFIVSILNQLRYALS 166 (698)
Q Consensus 87 ~~~~~~~~a~lvGvl~G~~~~~f~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~w~~~~l~p~~ggl~vgll~~~~~~~~ 166 (698)
....++++++++|+++|+.+++|+.+++++++++++..++...++ ...|..+++.+.+.+++.+++.+..
T Consensus 15 ~~l~~~~la~liGi~~gl~~~~~~~~i~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~~~~l~~~~---- 84 (444)
T d1otsa_ 15 TPLAILFMAAVVGTLVGLAAVAFDKGVAWLQNQRMGALVHTADNY------PLLLTVAFLCSAVLAMFGYFLVRKY---- 84 (444)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSSSH------HHHHHHHHHHHHHHHHHHHHHHHHH----
T ss_pred cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccc------cHHHHHHHHHHHHHHHHHHHHHHhh----
Confidence 346788999999999999999999999999999887543321111 0112222333444455555544322
Q ss_pred CCCCCCcchhhccccCCCCCCCcccccccchhhhcccCCCCCcccccchhhhhHHHHHHHHHHHHHhcCCccCCchhHHH
Q 005399 167 LDDDDDDDVQQVQDKSYPPPHPQAQAKDDISVITVSSTTSLPTIYYDYLKIAFQPLLKAVAACITLGTGNSLGPEGPSVE 246 (698)
Q Consensus 167 ~~~g~g~~i~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~k~~~~~ltl~sG~s~G~EgP~v~ 246 (698)
.+...|+|+||+++....+ +.....++...|++++++++++|+|+|||||++|
T Consensus 85 ~p~~~GsGipev~~~l~~~---------------------------~~~~~~r~~~~k~~~~~~sl~~G~s~G~EGP~v~ 137 (444)
T d1otsa_ 85 APEAGGSGIPEIEGALEDQ---------------------------RPVRWWRVLPVKFFGGLGTLGGGMVLGREGPTVQ 137 (444)
T ss_dssp CGGGSSCSHHHHHHHHTTC---------------------------SCCCHHHHHHHHHHHHHHHHHTTCSCBSHHHHHH
T ss_pred CCccCCCCHHHHHHHHhCC---------------------------CCCccHHHHHHHHHHHHHHHhcCCCccccccHHH
Confidence 2234467799987542110 1112234567899999999999999999999999
Q ss_pred HHHHHHHHHHhhcCCC-hhhHHHHHHhhhhHhHHHHhhhhHHHHHHHHHHhcccCcccchhhhhhhHHHHHHHHHHHHHH
Q 005399 247 IGKSIAKGVGNLFDRR-PRRKVSLVAAGSAAGISSGFNAAVAGCFFAVESVIWPSSAADSSASLAYTTSMVILSAVIASV 325 (698)
Q Consensus 247 iGa~ig~~l~~~~~~~-~~~~r~l~~~G~aAgiaa~F~APl~G~lFa~E~~~~~~~~~~~~~~~~~~~~~~~~aav~a~~ 325 (698)
+|+++|++++|+++.+ ++++|.+++||+|||++++||||++|++|++|++++++... ..++.+ ++++++++++
T Consensus 138 iga~i~~~l~~~~~~~~~~~~r~l~~~GaaAglaa~F~aPlaG~lFa~E~l~~~~~~~-----~~~~~~-~~~a~~~~~~ 211 (444)
T d1otsa_ 138 IGGNIGRMVLDIFRLKGDEARHTLLATGAAAGLAAAFNAPLAGILFIIEEMRPQFRYT-----LISIKA-VFIGVIMSTI 211 (444)
T ss_dssp HHHHHHHHHHHHTTCCSHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHTTTTSCSSSCC-----CCCHHH-HHHHHHHHHH
T ss_pred HHHHHHHHHHHHHhhhhHHhhHHHHHHHHHHHHhhccCCchhhhhhhhHHHhhcchHH-----HHHHHH-HHhhhHHHhh
Confidence 9999999999999865 45789999999999999999999999999999987654321 133444 5788888999
Q ss_pred HHhhhcCCCCccccccCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcCCchhHHHHHHHHHHHHHHH
Q 005399 326 VSEVGLGSEPAFKVPEYDFRSPGELPLYLLLGVLCGLISLTLSRCTTYMLAIVDNLQKDNGIPKAVFPVMGGLAVGLIAL 405 (698)
Q Consensus 326 v~~~~~g~~~~f~~~~~~~~~~~~l~~~illGil~Gl~g~lf~~~~~~~~~~~~~~~~~~~~~~~~~~~lggllvg~i~~ 405 (698)
+.+...|+.+.|+++..+..+..+++.++++|++||++|.+|++...+..+++++..+....++.+.+.+.+++++++.+
T Consensus 212 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lgi~~g~~g~~f~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~ll~~ 291 (444)
T d1otsa_ 212 MYRIFNHEVALIDVGKLSDAPLNTLWLYLILGIIFGIFGPIFNKWVLGMQDLLHRVHGGNITKWVLMGGAIGGLCGLLGF 291 (444)
T ss_dssp HHHHHSCSCCSSCCCCCCCCCGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHH
T ss_pred heeeccCcccccccccccCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccchhHHHHHHHHHHHHHHHhc
Confidence 99988898899998877666788899999999999999999999998887777765543222333445566777888888
Q ss_pred HhhccccCcHHHHHHHHccCCCCccccHHHHHHHHHHHHHHHHHhhhcCCccceechHHHHhhHHHHHHHHHHHHhhhcC
Q 005399 406 MFPEILYWGFENVDILLESRPFVKGLTADMLLQLVAAKIVATSLCRASGLVGGYYAPSLFIGAATGMAYGKFINFAIAQS 485 (698)
Q Consensus 406 ~~P~~~g~G~~~i~~ll~~~~~~~~~s~~~l~~~~~~K~l~t~lt~gsG~~GG~f~Psl~iGA~~G~~~g~~~~~~~p~~ 485 (698)
+.|+.+|+|++.++..++++ .+...++.++++|+++|++|+++|.+||.|+|++++||++|+++|.+++..+|+
T Consensus 292 ~~p~~~g~G~~~~~~~~~~~-----~~~~~l~~~~~~K~~~t~~t~~~G~~GG~f~P~l~iGa~~G~~~~~~~~~~~~~- 365 (444)
T d1otsa_ 292 VAPATSGGGFNLIPIATAGN-----FSMGMLVFIFVARVITTLLCFSSGAPGGIFAPMLALGTVLGTAFGMVAVELFPQ- 365 (444)
T ss_dssp HCGGGSSCSTTHHHHHHHTC-----SCHHHHHHHHHHHHHHHHHHHHTTCSSBSHHHHHHHHHHHHHHHHHHHHHHCGG-
T ss_pred cCcccCCCchHHHHHHhcCC-----cchHHHHHHHHHHHHHHHHHhhcCCCCCeehHHHHHHHHHHHHHHHHHHHhCCc-
Confidence 99999999999999998875 356677788899999999999999999999999999999999999999877665
Q ss_pred CCccccccccccchHHHHHHHHHHHHHHhhcchHHHHHHHHHHhcChhhHHHHHHHHHHHHHHhhccccccchhhhhHhh
Q 005399 486 NPTIHFSILEVASPQAYGLVGMAATLAGVCQVPLTSVLLLFELTQDYRIVLPLLGAVGLSSWFTSGQMRRRDVKETKVAV 565 (698)
Q Consensus 486 ~~~~~~~~~~~~~p~~~alvGaaA~la~v~~aPls~~vi~~Eltg~~~~llPlmiav~va~~v~~~~~~~~~~~~~~~~~ 565 (698)
...+|+.|+++||+|++++++|+|+|++++++|+||++++++|+|+++++|+++++ ++.++++||.....
T Consensus 366 ---------~~~~~~~~alvGmaa~~a~~~~~Plta~vl~~Eltg~~~~~~p~~ia~~~a~~v~~-~~~~~siY~~~l~~ 435 (444)
T d1otsa_ 366 ---------YHLEAGTFAIAGMGALLAASIRAPLTGIILVLEMTDNYQLILPMIITGLGATLLAQ-FTGGKPLYSAILAR 435 (444)
T ss_dssp ---------GTCCHHHHHHHHHTHHHHHTSCCHHHHHHHHHHHHCCGGGHHHHHHHHHHHHHHHH-TTTCCCHHHHHHHH
T ss_pred ---------ccCCHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHH-HhCCCChHHHHHHH
Confidence 23679999999999999999999999999999999999999999999999998875 56788999987543
|
| >d1otsa_ f.20.1.1 (A:) Clc chloride channel {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|