Citrus Sinensis ID: 005548

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

cccccccccccccccccccccccccHHHcccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEECccccccccccccEEECccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccccccEEEEHHHcccccEEEEEEEEEEEEEEEcccccCEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccccccccccHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccEEEcccccccccccHHcHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccEEcHHHHHHHHccc

*********F****P**********KLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCS*************************************RLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTD********VSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKI***QRRYLLNEQLKAIKKELGL******ALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLExxxxxxxxxxxxxxxxxxxxxKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lon protease homolog 1, mitochondrial	ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner.	probable	P93655
Lon protease homolog, mitochondrial	ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner.	probable	Q69UZ3
Lon protease homolog, mitochondrial	ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner.	probable	P93648

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3M6A, chain A
Confidence level:very confident
Coverage over the Query: 401-538,559-676
View the alignment between query and template
View the model in PyMOL

Template: 3LJC, chain A
Confidence level:confident
Coverage over the Query: 222-396
View the alignment between query and template
View the model in PyMOL