Citrus Sinensis ID: 005548

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

ccccccccccccccccccccccccHHHHcccccccccccccccccHHHHHHcccccccccccccccccccccccccHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccEEEEccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccccccccccccEEEEHHHcccccEEEEEEEEEEEEEEEcccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccccccccccHHHHHHHHHcccccccEEEEccccccccccccHHHHHHHcccccccccccccccccccccccccEEEccccccccccHHHcHHcccccccccHHHHHHHHHHHHHHHHHHHccccccccEEcHHHHHHHHccc

cccccccccccccccEEEccccccccEEEEcccccEEEcccccccHHHHHHcccccEEccEEEccccEEcccccccHHHHHHHHccccccccccccccEEEEEccccccccHHHHHHHHHHHHHcccccccccccEEEccccccccEEEcEcccccEEEEccEEEEEEcccHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHccccccHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEEEccccccEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHHHccEEEEEccccccHHHHcccccEEEccccHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHccHHHcccccccEEEEcccHccEEEEEEcccHHcccccHHccEEEEEcccccHHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHcc

mqgfnssahfpktsplyfngtspnpklalkfpqnyrlcrssnrnlpmlklLSSTAATSCRTHAltattfrtgaepapfFKALSQltglttrsgrtvgyrrffcsdsagkgdeegTVVEAeaksesdgsdtksssaivstnprLEDYLSVLalplphrplfpgfympiyvkDPKLLAALQESRKrqapyagafllkddsltdastdteksvsdlKGKELFNRLHEVgtlaqissiqgdQVILIGHRRLRItemvsedpltvkvdhlkdkpydkdddviKATSFEVISTLRDVLKTSSLWRDHVQTYTQhigdfsfprladfgaaisgaNKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDwltalpwgnysdenFDVIRAQkildedhyglndVKERILEFIAVGKlrgisqgkiiclsgppgvgktsIGRSIARALNRKFFrfsvggladvaeiKGHRrtyigampgKMVQCLKnvgtanplVLIDEIdklgrghagdpASALLElldpeqnanfldhyldvpidlSKVLFVCTANvvenipnplldRMEVIAIAGYITDEKMHIARDYLEKTtreacgikpeqkitagkqgfgifrnr

mqgfnssahfpktsplyfNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATtfrtgaepaPFFKALSqltglttrsgrtvgyRRFFCsdsagkgdeegTVVEAeaksesdgsdtksssaivstnpRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAfllkddsltdastdteksvsdlkgkELFNRLHEVgtlaqissiqgdqVILIGHRRLRITemvsedpltvkvdhlkdkpydkdddviKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIkkelgletddktALSAKFRErieqykdkcprHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKiiclsgppgvgkTSIGRSIARALNRKFFRfsvggladvaeiKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVenipnplldrMEVIAIAGYITDEKMHIARDYLEKTTreacgikpeqkitagkqgfgifrnr

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAGKGDEEGTVVEAEAksesdgsdtksssAIVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

**************************LALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCS*************************************RLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQ********YAGAFLL**********************ELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKI***QRRYLLNEQLKAIKKELGL******ALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIK******************

*********F****P**********KLALKFPQNYRLCRSSNRNLPMLKLLS***************TFRTGAEPAPFFKALSQLTG*TT*******************************************************YLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDT***VSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKD*******DVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEIS******************RRYLLNEQLKAIKKELG************F*ERIEQYKDKCPRHVLQVIEEELTKL*******SEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRN*

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAG****************************VSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTD**********DLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

**********PKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCS*******************************IVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDD*********EKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQGFNSSAHFPKTSPLYFNGTSPNPKLALKFPQNYRLCRSSNRNLPMLKLLSSTAATSCRTHALTATTFRTGAEPAPFFKALSQLTGLTTRSGRTVGYRRFFCSDSAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLExxxxxxxxxxxxxxxxxxxxxKISGEQRRYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		691	2.2.26 [Sep-21-2011]
P93655		940	Lon protease homolog 1, m	yes	no	0.904	0.664	0.815	0.0
A2YQ56		1002	Lon protease homolog, mit	N/A	no	0.858	0.591	0.813	0.0
Q69UZ3		1002	Lon protease homolog, mit	yes	no	0.858	0.591	0.813	0.0
P93648		964	Lon protease homolog, mit	N/A	no	0.850	0.609	0.816	0.0
Q9M9L7		942	Lon protease homolog 4, c	no	no	0.876	0.643	0.743	0.0
Q9M9L8		924	Lon protease homolog 3, m	no	no	0.803	0.600	0.641	0.0
A4S6Y4		936	Lon protease homolog, mit	yes	no	0.758	0.559	0.579	1e-180
Q5AZT7		1104	Lon protease homolog, mit	yes	no	0.743	0.465	0.485	1e-157
A2QCJ2		1113	Lon protease homolog, mit	yes	no	0.746	0.463	0.487	1e-157
Q8CGK3		949	Lon protease homolog, mit	yes	no	0.808	0.589	0.470	1e-156

>sp\|P93655\|LONM1_ARATH Lon protease homolog 1, mitochondrial OS=Arabidopsis thaliana GN=LON1 PE=1 SV=2	Back alignment and function desciption

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/634 (81%), Positives = 569/634 (89%), Gaps = 9/634 (1%)

Query: 47  MLKLLSSTAATSCRTHALTATTFRTGAEP--APFFKALSQLTGLTTRSGRTVGYRRFFCS 104
           MLKL +S+A+   R H LT  +   G+ P  +P FKALSQ+TG   RS  ++G+R FFCS
Sbjct: 1   MLKLFTSSAS---RVHHLTPVSRVVGSSPVESPLFKALSQITGWNRRS-TSLGHRAFFCS 56

Query: 105 DSAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFY 164
           +    G+          +S+S+ SD+KSSSAIV TNPR ED L+VLALP+PHRPLFPGFY
Sbjct: 57  EPTN-GEAAAEAETKAVESDSEVSDSKSSSAIVPTNPRPEDCLTVLALPVPHRPLFPGFY 115

Query: 165 MPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDT--EKSVSDLKGKELFNRL 222
           MPIYVKDPK+LAALQESR+RQAPYAGAFLLKDD   D+S+ T  EK++++LKGKEL NRL
Sbjct: 116 MPIYVKDPKVLAALQESRRRQAPYAGAFLLKDDPSADSSSSTDAEKNINELKGKELLNRL 175

Query: 223 HEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATSF 282
           HEVGTLAQISSIQGDQVIL+GHRRLRI EMVSE+PLTVKVDHLKD P+D DDDV+KATSF
Sbjct: 176 HEVGTLAQISSIQGDQVILVGHRRLRIKEMVSEEPLTVKVDHLKDNPFDMDDDVVKATSF 235

Query: 283 EVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVY 342
           EVISTLRDVLKTSSLWRDHVQTYTQHIGDF++PRLADFGAAI GAN+ Q Q+VLEELDV+
Sbjct: 236 EVISTLRDVLKTSSLWRDHVQTYTQHIGDFTYPRLADFGAAICGANRHQAQEVLEELDVH 295

Query: 343 KRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKTA 402
           KRL+LTLEL+KKEMEISKIQE+IAKAIEEKISGEQRRYLLNEQLKAIKKELG+ETDDK+A
Sbjct: 296 KRLRLTLELMKKEMEISKIQETIAKAIEEKISGEQRRYLLNEQLKAIKKELGVETDDKSA 355

Query: 403 LSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNYS 462
           LSAKF+ERIE  K+K P HVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLT LPWGNYS
Sbjct: 356 LSAKFKERIEPNKEKIPAHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTILPWGNYS 415

Query: 463 DENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGR 522
           +ENFDV RAQ ILDEDHYGL+DVKERILEFIAVG+LRG SQGKIICLSGPPGVGKTSIGR
Sbjct: 416 NENFDVARAQTILDEDHYGLSDVKERILEFIAVGRLRGTSQGKIICLSGPPGVGKTSIGR 475

Query: 523 SIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDK 582
           SIARALNRKFFRFSVGGLADVAEIKGHRRTY+GAMPGKMVQCLK+VGTANPLVLIDEIDK
Sbjct: 476 SIARALNRKFFRFSVGGLADVAEIKGHRRTYVGAMPGKMVQCLKSVGTANPLVLIDEIDK 535

Query: 583 LGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRME 642
           LGRGHAGDPASALLELLDPEQNANFLDHYLDV IDLSKVLFVCTANV++ IPNPLLDRME
Sbjct: 536 LGRGHAGDPASALLELLDPEQNANFLDHYLDVTIDLSKVLFVCTANVIDMIPNPLLDRME 595

Query: 643 VIAIAGYITDEKMHIARDYLEKTTREACGIKPEQ 676
           VI+IAGYITDEK+HIARDYLEKT R  CG+KPEQ
Sbjct: 596 VISIAGYITDEKVHIARDYLEKTARGDCGVKPEQ 629

ATP-dependent serine protease that mediates the selective degradation of misfolded, unassembled or oxidatively damaged polypeptides as well as certain short-lived regulatory proteins in the mitochondrial matrix. May also have a chaperone function in the assembly of inner membrane protein complexes. Participates in the regulation of mitochondrial gene expression and in the maintenance of the integrity of the mitochondrial genome. Binds to mitochondrial DNA in a site-specific manner.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: -

>sp\|A2YQ56\|LONM_ORYSI Lon protease homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_27415 PE=2 SV=1	Back alignment and function description

>sp\|Q69UZ3\|LONM_ORYSJ Lon protease homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os07g0689300 PE=2 SV=1	Back alignment and function description

>sp\|P93648\|LONM_MAIZE Lon protease homolog, mitochondrial OS=Zea mays GN=LON2 PE=1 SV=1	Back alignment and function description

>sp\|Q9M9L7\|LONM4_ARATH Lon protease homolog 4, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=LON4 PE=3 SV=1	Back alignment and function description

>sp\|Q9M9L8\|LONM3_ARATH Lon protease homolog 3, mitochondrial OS=Arabidopsis thaliana GN=LON3 PE=3 SV=1	Back alignment and function description

>sp\|A4S6Y4\|LONM_OSTLU Lon protease homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_41620 PE=3 SV=1	Back alignment and function description

>sp\|Q5AZT7\|LONM_EMENI Lon protease homolog, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pim1 PE=3 SV=1	Back alignment and function description

>sp\|A2QCJ2\|LONM_ASPNC Lon protease homolog, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pim1 PE=3 SV=1	Back alignment and function description

>sp\|Q8CGK3\|LONM_MOUSE Lon protease homolog, mitochondrial OS=Mus musculus GN=Lonp1 PE=1 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		691
449454016		972	PREDICTED: lon protease homolog, mitocho	0.923	0.656	0.833	0.0
356575351		971	PREDICTED: lon protease homolog 1, mitoc	0.897	0.638	0.839	0.0
224123964		950	predicted protein [Populus trichocarpa]	0.908	0.661	0.837	0.0
356533540		961	PREDICTED: lon protease homolog 1, mitoc	0.895	0.644	0.834	0.0
224122936		968	predicted protein [Populus trichocarpa]	0.908	0.648	0.823	0.0
225450599		978	PREDICTED: lon protease homolog, mitocho	0.908	0.642	0.832	0.0
296089772		964	unnamed protein product [Vitis vinifera]	0.908	0.651	0.832	0.0
334187963		940	lon protease 1 [Arabidopsis thaliana] gi	0.904	0.664	0.815	0.0
297808717		991	hypothetical protein ARALYDRAFT_489519 [	0.966	0.674	0.773	0.0
1848291		941	LON protease homolog [Arabidopsis thalia	0.904	0.664	0.812	0.0

>gi\|449454016\|ref\|XP_004144752.1\| PREDICTED: lon protease homolog, mitochondrial-like [Cucumis sativus]	Back alignment and taxonomy information

 Score = 1082 bits (2798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/649 (83%), Positives = 574/649 (88%), Gaps = 11/649 (1%)

Query: 47  MLKLLSSTAATSCRTHALTATTFRTGAEP-APFFKALSQLTGLTTRSGRTVGYRRFFCSD 105
           MLK L+S+   S R H L A +FR   E  +P  + L  L GL  RS R +  R FFCSD
Sbjct: 1   MLKALNSSCFRS-RLHNL-APSFRPATESESPLLRVLGSLRGLGGRSTR-LTCRAFFCSD 57

Query: 106 SAGKGDEEGTVVEAEAKSESDGSDTKSSSAIVSTNPRLEDYLSVLALPLPHRPLFPGFYM 165
           +    D      E EAK + +  + KSSSAIVSTNPR EDYL+VLALPLPHRPLFPGFYM
Sbjct: 58  A---NDVSAREAEIEAKVKEEDVEVKSSSAIVSTNPRPEDYLTVLALPLPHRPLFPGFYM 114

Query: 166 PIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDAST----DTEKSVSDLKGKELFNR 221
           PIYVKDPKLLAALQESR+RQAPYAGAFLLKD+  TD+ST    +TEK+ SDL GKEL++R
Sbjct: 115 PIYVKDPKLLAALQESRRRQAPYAGAFLLKDEPGTDSSTVSGSETEKNTSDLTGKELYDR 174

Query: 222 LHEVGTLAQISSIQGDQVILIGHRRLRITEMVSEDPLTVKVDHLKDKPYDKDDDVIKATS 281
           LHEVGTLAQISSIQGDQV+LIGHRRLRITEMVSEDPLTVKVDHLKDKPY+KDD+VIKATS
Sbjct: 175 LHEVGTLAQISSIQGDQVVLIGHRRLRITEMVSEDPLTVKVDHLKDKPYNKDDNVIKATS 234

Query: 282 FEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDV 341
           FEVISTLRDVLKTSSLWRDHVQTYTQHIGDF+FPRLADFGAAISGANK+QCQ+VLEELDV
Sbjct: 235 FEVISTLRDVLKTSSLWRDHVQTYTQHIGDFNFPRLADFGAAISGANKVQCQEVLEELDV 294

Query: 342 YKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKT 401
           YKRLK+TLEL+KKEMEI+KIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKT
Sbjct: 295 YKRLKITLELLKKEMEINKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKELGLETDDKT 354

Query: 402 ALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNY 461
           ALSAKFRER+E  KDKCP+HV QVIEEEL KLQLLEASSSEFNVTRNYLDWLT LPWG Y
Sbjct: 355 ALSAKFRERLEPVKDKCPQHVAQVIEEELAKLQLLEASSSEFNVTRNYLDWLTVLPWGVY 414

Query: 462 SDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIG 521
           SDENFDV+ AQKILDEDHYGL DVKERILEFIAVGKLRG SQGKIICLSGPPGVGKTSIG
Sbjct: 415 SDENFDVLGAQKILDEDHYGLTDVKERILEFIAVGKLRGSSQGKIICLSGPPGVGKTSIG 474

Query: 522 RSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEID 581
           RSIARALNRKFFRFSVGGL DVAEIKGHRRTYIGAMPGKMVQCLK+VGTANPLVLIDEID
Sbjct: 475 RSIARALNRKFFRFSVGGLVDVAEIKGHRRTYIGAMPGKMVQCLKSVGTANPLVLIDEID 534

Query: 582 KLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPLLDRM 641
           KLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANV+E IPNPLLDRM
Sbjct: 535 KLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVIEMIPNPLLDRM 594

Query: 642 EVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRN 690
           EVIAIAGYITDEKMHIARDYLEK TREACGIKPEQ         G+  N
Sbjct: 595 EVIAIAGYITDEKMHIARDYLEKATREACGIKPEQVEVTDAALLGLIEN 643

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|356575351\|ref\|XP_003555805.1\| PREDICTED: lon protease homolog 1, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|224123964\|ref\|XP_002330253.1\| predicted protein [Populus trichocarpa] gi\|222871709\|gb\|EEF08840.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|356533540\|ref\|XP_003535321.1\| PREDICTED: lon protease homolog 1, mitochondrial-like [Glycine max]	Back alignment and taxonomy information

>gi\|224122936\|ref\|XP_002318953.1\| predicted protein [Populus trichocarpa] gi\|222857329\|gb\|EEE94876.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225450599\|ref\|XP_002277956.1\| PREDICTED: lon protease homolog, mitochondrial-like [Vitis vinifera]	Back alignment and taxonomy information

>gi\|296089772\|emb\|CBI39591.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi|334187963|ref|NP_568490.3| lon protease 1 [Arabidopsis thaliana] gi|27735209|sp|P93655.2|LONM1_ARATH RecName: Full=Lon protease homolog 1, mitochondrial; Flags: Precursor gi|20259500|gb|AAM13870.1| putative Lon protease homolog 2 precursor [Arabidopsis thaliana] gi|21436459|gb|AAM51430.1| putative Lon protease homolog 2 precursor [Arabidopsis thaliana] gi|332006234|gb|AED93617.1| lon protease 1 [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|297808717\|ref\|XP_002872242.1\| hypothetical protein ARALYDRAFT_489519 [Arabidopsis lyrata subsp. lyrata] gi\|297318079\|gb\|EFH48501.1\| hypothetical protein ARALYDRAFT_489519 [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|1848291\|gb\|AAB48000.1\| LON protease homolog [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P93648	LONM_MAIZE	3, ., 4, ., 2, 1, ., -	0.8163	0.8509	0.6099	N/A	no
Q69UZ3	LONM_ORYSJ	3, ., 4, ., 2, 1, ., -	0.8137	0.8581	0.5918	yes	no
P93655	LONM1_ARATH	3, ., 4, ., 2, 1, ., -	0.8154	0.9044	0.6648	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	3.4.21	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		691
TIGR00763		775	TIGR00763, lon, ATP-dependent protease La	0.0
COG0466		782	COG0466, Lon, ATP-dependent Lon protease, bacteria	0.0
PRK10787		784	PRK10787, PRK10787, DNA-binding ATP-dependent prot	1e-114
pfam02190		191	pfam02190, LON, ATP-dependent protease La (LON) do	4e-30
pfam00004		131	pfam00004, AAA, ATPase family associated with vari	4e-27
smart00464		92	smart00464, LON, Found in ATP-dependent protease L	2e-15
cd00009		151	cd00009, AAA, The AAA+ (ATPases Associated with a	2e-13
COG0714		329	COG0714, COG0714, MoxR-like ATPases [General funct	6e-12
COG0464		494	COG0464, SpoVK, ATPases of the AAA+ class [Posttra	1e-08
PRK13342		413	PRK13342, PRK13342, recombination factor protein R	9e-07
smart00382		148	smart00382, AAA, ATPases associated with a variety	4e-06
COG2255		332	COG2255, RuvB, Holliday junction resolvasome, heli	3e-05
pfam07728		135	pfam07728, AAA_5, AAA domain (dynein-related subfa	4e-05
COG2256		436	COG2256, MGS1, ATPase related to the helicase subu	4e-05
PRK00131		175	PRK00131, aroK, shikimate kinase; Reviewed	1e-04
COG0703		172	COG0703, AroK, Shikimate kinase [Amino acid transp	2e-04
TIGR00635		305	TIGR00635, ruvB, Holliday junction DNA helicase, R	4e-04
cd00464		154	cd00464, SK, Shikimate kinase (SK) is the fifth en	4e-04
COG0194		191	COG0194, Gmk, Guanylate kinase [Nucleotide transpo	0.001
smart00763		361	smart00763, AAA_PrkA, PrkA AAA domain	0.001
COG5271		4600	COG5271, MDN1, AAA ATPase containing von Willebran	0.001
PHA02544		316	PHA02544, 44, clamp loader, small subunit; Provisi	0.002
pfam07724		168	pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	0.002
TIGR01241		495	TIGR01241, FtsH_fam, ATP-dependent metalloprotease	0.002
pfam13401		124	pfam13401, AAA_22, AAA domain	0.003
TIGR02639		730	TIGR02639, ClpA, ATP-dependent Clp protease ATP-bi	0.003
PRK10733		644	PRK10733, hflB, ATP-dependent metalloprotease; Rev	0.003
pfam13207		114	pfam13207, AAA_17, AAA domain	0.004

>gnl\|CDD\|233119 TIGR00763, lon, ATP-dependent protease La	Back alignment and domain information

 Score =  757 bits (1956), Expect = 0.0
 Identities = 287/542 (52%), Positives = 369/542 (68%), Gaps = 31/542 (5%)

Query: 150 LALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKS 209
             LPL  RPLFPG   PI V   K +  ++E+ + + PY G FL KDD            
Sbjct: 1   PLLPLRRRPLFPGMIKPIDVGREKSIKLIKEALRLKQPYLGLFLQKDDD----------- 49

Query: 210 VSDLKGKELFNRLHEVGTLAQI--------SSIQGDQVILIGHRRLRITEMVSEDP-LTV 260
                 +   + ++ VG +AQI        S     +V++ G RR+RI E+  +   L V
Sbjct: 50  ----NEEPEEDDIYSVGVVAQILEMLPLPSSGTATYKVVVEGLRRIRIKELSDKGGYLVV 105

Query: 261 KVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDHVQTYTQHIGDFSFP-RLAD 319
           +VD+LK++P+DKDD+ IKA + E+  T R+++  S L+R+     +  + D   P RLAD
Sbjct: 106 RVDNLKEEPFDKDDEEIKALTREIKETFRELISLSKLFREQPALLSA-LEDIDEPGRLAD 164

Query: 320 FGAAISG-ANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQR 378
           F AA      K + Q+VLE +++ KRLK  LEL+KKE+E+ K+Q  I K +EEK+   QR
Sbjct: 165 FVAASLQLKEKDELQEVLETVNIEKRLKKALELLKKELELLKLQNKITKKVEEKMEKTQR 224

Query: 379 RYLLNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEA 438
            Y L EQLKAIKKELG+E DDK  L  K +E++E  + K P  V +VIE+ELTKL LLE 
Sbjct: 225 EYYLREQLKAIKKELGIEKDDKDEL-EKLKEKLE--ELKLPEEVKKVIEKELTKLSLLEP 281

Query: 439 SSSEFNVTRNYLDWLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKL 498
           SSSEF VTRNYLDWLT LPWG YS EN D+ RA++ILDEDHYGL  VKERILE++AV KL
Sbjct: 282 SSSEFTVTRNYLDWLTDLPWGKYSKENLDLKRAKEILDEDHYGLKKVKERILEYLAVQKL 341

Query: 499 RGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMP 558
           RG  +G I+CL GPPGVGKTS+G+SIA+ALNRKF RFS+GG+ D AEI+GHRRTY+GAMP
Sbjct: 342 RGKMKGPILCLVGPPGVGKTSLGKSIAKALNRKFVRFSLGGVRDEAEIRGHRRTYVGAMP 401

Query: 559 GKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDL 618
           G+++Q LK   T NPL L+DEIDK+G    GDPASALLE+LDPEQN  F DHYLDVP DL
Sbjct: 402 GRIIQGLKKAKTKNPLFLLDEIDKIGSSFRGDPASALLEVLDPEQNNAFSDHYLDVPFDL 461

Query: 619 SKVLFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQ-K 677
           SKV+F+ TAN ++ IP PLLDRMEVI ++GY  +EK+ IA+ YL     E  G+KP++ K
Sbjct: 462 SKVIFIATANSIDTIPRPLLDRMEVIELSGYTEEEKLEIAKKYLIPKALEDHGLKPDELK 521

Query: 678 IT 679
           IT
Sbjct: 522 IT 523

This protein is induced by heat shock and other stresses in E. coli, B. subtilis, and other species. The yeast member, designated PIM1, is located in the mitochondrial matrix, required for mitochondrial function, and also induced by heat shock [Protein fate, Degradation of proteins, peptides, and glycopeptides]. Length = 775

>gnl\|CDD\|223542 COG0466, Lon, ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|182730 PRK10787, PRK10787, DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>gnl\|CDD\|216923 pfam02190, LON, ATP-dependent protease La (LON) domain	Back alignment and domain information

>gnl\|CDD\|215649 pfam00004, AAA, ATPase family associated with various cellular activities (AAA)	Back alignment and domain information

>gnl\|CDD\|197740 smart00464, LON, Found in ATP-dependent protease La (LON)	Back alignment and domain information

>gnl\|CDD\|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>gnl\|CDD\|223786 COG0714, COG0714, MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|223540 COG0464, SpoVK, ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|237355 PRK13342, PRK13342, recombination factor protein RarA; Reviewed	Back alignment and domain information

>gnl\|CDD\|214640 smart00382, AAA, ATPases associated with a variety of cellular activities	Back alignment and domain information

>gnl\|CDD\|225164 COG2255, RuvB, Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily)	Back alignment and domain information

>gnl\|CDD\|225165 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|234654 PRK00131, aroK, shikimate kinase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223775 COG0703, AroK, Shikimate kinase [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|129721 TIGR00635, ruvB, Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>gnl\|CDD\|238260 cd00464, SK, Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants	Back alignment and domain information

>gnl\|CDD\|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|214810 smart00763, AAA_PrkA, PrkA AAA domain	Back alignment and domain information

>gnl\|CDD\|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|222866 PHA02544, 44, clamp loader, small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|219536 pfam07724, AAA_2, AAA domain (Cdc48 subfamily)	Back alignment and domain information

>gnl\|CDD\|233327 TIGR01241, FtsH_fam, ATP-dependent metalloprotease FtsH	Back alignment and domain information

>gnl\|CDD\|222104 pfam13401, AAA_22, AAA domain	Back alignment and domain information

>gnl\|CDD\|233959 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>gnl\|CDD\|182683 PRK10733, hflB, ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>gnl\|CDD\|221983 pfam13207, AAA_17, AAA domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		691
COG0466		782	Lon ATP-dependent Lon protease, bacterial type [Po	100.0
KOG2004		906	consensus Mitochondrial ATP-dependent protease PIM	100.0
PRK10787		784	DNA-binding ATP-dependent protease La; Provisional	100.0
TIGR00763		775	lon ATP-dependent protease La. This protein is ind	100.0
COG2802		221	Uncharacterized protein, similar to the N-terminal	99.96
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	99.94
PF02190		205	LON: ATP-dependent protease La (LON) domain; Inter	99.93
PRK10865		857	protein disaggregation chaperone; Provisional	99.91
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.86
COG1222		406	RPT1 ATP-dependent 26S proteasome regulatory subun	99.86
CHL00095		821	clpC Clp protease ATP binding subunit	99.84
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.83
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.82
TIGR01242		364	26Sp45 26S proteasome subunit P45 family. Many pro	99.82
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.81
KOG0727		408	consensus 26S proteasome regulatory complex, ATPas	99.81
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.8
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.8
COG1223		368	Predicted ATPase (AAA+ superfamily) [General funct	99.77
PRK03992		389	proteasome-activating nucleotidase; Provisional	99.77
KOG0736		953	consensus Peroxisome assembly factor 2 containing	99.75
KOG0733		802	consensus Nuclear AAA ATPase (VCP subfamily) [Post	99.75
KOG0734		752	consensus AAA+-type ATPase containing the peptidas	99.74
CHL00195		489	ycf46 Ycf46; Provisional	99.72
KOG0738		491	consensus AAA+-type ATPase [Posttranslational modi	99.71
KOG0728		404	consensus 26S proteasome regulatory complex, ATPas	99.68
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	99.68
TIGR03689		512	pup_AAA proteasome ATPase. In the Actinobacteria,	99.67
KOG0739		439	consensus AAA+-type ATPase [Posttranslational modi	99.67
PF05496		233	RuvB_N: Holliday junction DNA helicase ruvB N-term	99.67
PLN00020		413	ribulose bisphosphate carboxylase/oxygenase activa	99.66
PTZ00361		438	26 proteosome regulatory subunit 4-like protein; P	99.65
KOG0731		774	consensus AAA+-type ATPase containing the peptidas	99.65
CHL00181		287	cbbX CbbX; Provisional	99.65
COG0464		494	SpoVK ATPases of the AAA+ class [Posttranslational	99.65
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.64
PRK05342		412	clpX ATP-dependent protease ATP-binding subunit Cl	99.63
KOG1051		898	consensus Chaperone HSP104 and related ATP-depende	99.63
KOG0737		386	consensus AAA+-type ATPase [Posttranslational modi	99.62
KOG0726		440	consensus 26S proteasome regulatory complex, ATPas	99.62
TIGR00382		413	clpX endopeptidase Clp ATP-binding regulatory subu	99.62
KOG0652		424	consensus 26S proteasome regulatory complex, ATPas	99.62
TIGR01241		495	FtsH_fam ATP-dependent metalloprotease FtsH. HflB(	99.61
TIGR02881		261	spore_V_K stage V sporulation protein K. Members o	99.6
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	99.6
COG2256		436	MGS1 ATPase related to the helicase subunit of the	99.59
KOG0729		435	consensus 26S proteasome regulatory complex, ATPas	99.58
TIGR02880		284	cbbX_cfxQ probable Rubsico expression protein CbbX	99.57
TIGR02903		615	spore_lon_C ATP-dependent protease, Lon family. Me	99.55
COG2255		332	RuvB Holliday junction resolvasome, helicase subun	99.55
CHL00176		638	ftsH cell division protein; Validated	99.54
PRK07003		830	DNA polymerase III subunits gamma and tau; Validat	99.53
COG0465		596	HflB ATP-dependent Zn proteases [Posttranslational	99.52
KOG0740		428	consensus AAA+-type ATPase [Posttranslational modi	99.52
PRK14956		484	DNA polymerase III subunits gamma and tau; Provisi	99.52
PRK05201		443	hslU ATP-dependent protease ATP-binding subunit Hs	99.51
KOG0742		630	consensus AAA+-type ATPase [Posttranslational modi	99.51
PRK12323		700	DNA polymerase III subunits gamma and tau; Provisi	99.5
KOG0651		388	consensus 26S proteasome regulatory complex, ATPas	99.49
TIGR00390		441	hslU ATP-dependent protease HslVU, ATPase subunit.	99.48
KOG0989		346	consensus Replication factor C, subunit RFC4 [Repl	99.48
PLN03025		319	replication factor C subunit; Provisional	99.47
TIGR01243		733	CDC48 AAA family ATPase, CDC48 subfamily. This sub	99.46
COG1219		408	ClpX ATP-dependent protease Clp, ATPase subunit [P	99.46
PRK14962		472	DNA polymerase III subunits gamma and tau; Provisi	99.46
KOG0744		423	consensus AAA+-type ATPase [Posttranslational modi	99.45
PRK14949		944	DNA polymerase III subunits gamma and tau; Provisi	99.45
KOG0743		457	consensus AAA+-type ATPase [Posttranslational modi	99.45
PRK14960		702	DNA polymerase III subunits gamma and tau; Provisi	99.45
TIGR00635		305	ruvB Holliday junction DNA helicase, RuvB subunit.	99.45
PF00004		132	AAA: ATPase family associated with various cellula	99.44
PRK14958		509	DNA polymerase III subunits gamma and tau; Provisi	99.44
CHL00206		2281	ycf2 Ycf2; Provisional	99.43
PRK10733		644	hflB ATP-dependent metalloprotease; Reviewed	99.43
PRK04195		482	replication factor C large subunit; Provisional	99.42
PRK00080		328	ruvB Holliday junction DNA helicase RuvB; Reviewed	99.42
PRK14961		363	DNA polymerase III subunits gamma and tau; Provisi	99.42
PRK07994		647	DNA polymerase III subunits gamma and tau; Validat	99.42
PRK07764		824	DNA polymerase III subunits gamma and tau; Validat	99.41
PRK14964		491	DNA polymerase III subunits gamma and tau; Provisi	99.41
COG2812		515	DnaX DNA polymerase III, gamma/tau subunits [DNA r	99.41
PRK08691		709	DNA polymerase III subunits gamma and tau; Validat	99.4
PRK14951		618	DNA polymerase III subunits gamma and tau; Provisi	99.39
PRK06645		507	DNA polymerase III subunits gamma and tau; Validat	99.39
PHA02544		316	44 clamp loader, small subunit; Provisional	99.38
TIGR02640		262	gas_vesic_GvpN gas vesicle protein GvpN. Members o	99.38
TIGR02639		731	ClpA ATP-dependent Clp protease ATP-binding subuni	99.37
PRK14952		584	DNA polymerase III subunits gamma and tau; Provisi	99.37
PRK14957		546	DNA polymerase III subunits gamma and tau; Provisi	99.37
PRK14963		504	DNA polymerase III subunits gamma and tau; Provisi	99.36
PF07724		171	AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR	99.35
PRK14959		624	DNA polymerase III subunits gamma and tau; Provisi	99.35
PRK13342		413	recombination factor protein RarA; Reviewed	99.34
KOG0732		1080	consensus AAA+-type ATPase containing the bromodom	99.34
TIGR03345		852	VI_ClpV1 type VI secretion ATPase, ClpV1 family. M	99.34
PRK14965		576	DNA polymerase III subunits gamma and tau; Provisi	99.33
KOG0741		744	consensus AAA+-type ATPase [Posttranslational modi	99.32
PRK05563		559	DNA polymerase III subunits gamma and tau; Validat	99.32
PHA02244		383	ATPase-like protein	99.31
PRK14969		527	DNA polymerase III subunits gamma and tau; Provisi	99.31
TIGR01650		327	PD_CobS cobaltochelatase, CobS subunit. This model	99.29
KOG2028		554	consensus ATPase related to the helicase subunit o	99.29
TIGR02902		531	spore_lonB ATP-dependent protease LonB. Members of	99.28
PRK07133		725	DNA polymerase III subunits gamma and tau; Validat	99.28
PRK05896		605	DNA polymerase III subunits gamma and tau; Validat	99.28
PRK09111		598	DNA polymerase III subunits gamma and tau; Validat	99.28
COG0714		329	MoxR-like ATPases [General function prediction onl	99.27
PRK13341		725	recombination factor protein RarA/unknown domain f	99.26
KOG0730		693	consensus AAA+-type ATPase [Posttranslational modi	99.26
PRK06647		563	DNA polymerase III subunits gamma and tau; Validat	99.26
PRK08451		535	DNA polymerase III subunits gamma and tau; Validat	99.25
PRK14953		486	DNA polymerase III subunits gamma and tau; Provisi	99.25
TIGR02397		355	dnaX_nterm DNA polymerase III, subunit gamma and t	99.25
PRK06305		451	DNA polymerase III subunits gamma and tau; Validat	99.25
KOG0991		333	consensus Replication factor C, subunit RFC2 [Repl	99.24
PRK07940		394	DNA polymerase III subunit delta'; Validated	99.24
PRK14954		620	DNA polymerase III subunits gamma and tau; Provisi	99.24
PRK12402		337	replication factor C small subunit 2; Reviewed	99.23
PRK08181		269	transposase; Validated	99.22
PF07728		139	AAA_5: AAA domain (dynein-related subfamily); Inte	99.22
PRK13531		498	regulatory ATPase RavA; Provisional	99.22
PRK14955		397	DNA polymerase III subunits gamma and tau; Provisi	99.21
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.21
PRK00440		319	rfc replication factor C small subunit; Reviewed	99.21
PRK10865		857	protein disaggregation chaperone; Provisional	99.21
PRK14950		585	DNA polymerase III subunits gamma and tau; Provisi	99.2
PRK09183		259	transposase/IS protein; Provisional	99.2
PRK14948		620	DNA polymerase III subunits gamma and tau; Provisi	99.2
PRK14970		367	DNA polymerase III subunits gamma and tau; Provisi	99.19
KOG0745		564	consensus Putative ATP-dependent Clp-type protease	99.19
PRK11034		758	clpA ATP-dependent Clp protease ATP-binding subuni	99.18
PRK14971		614	DNA polymerase III subunits gamma and tau; Provisi	99.17
PRK06526		254	transposase; Provisional	99.17
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	99.16
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.16
COG1220		444	HslU ATP-dependent protease HslVU (ClpYQ), ATPase	99.15
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.15
TIGR03346		852	chaperone_ClpB ATP-dependent chaperone ClpB. Membe	99.14
CHL00095		821	clpC Clp protease ATP binding subunit	99.13
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.13
PF07726		131	AAA_3: ATPase family associated with various cellu	99.13
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	99.12
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	99.11
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.1
PRK13407		334	bchI magnesium chelatase subunit I; Provisional	99.08
PRK11331		459	5-methylcytosine-specific restriction enzyme subun	99.07
PRK08084		235	DNA replication initiation factor; Provisional	99.07
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.06
PRK06893		229	DNA replication initiation factor; Validated	99.06
TIGR02030		337	BchI-ChlI magnesium chelatase ATPase subunit I. Th	99.06
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	99.05
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.03
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.02
PF05673		249	DUF815: Protein of unknown function (DUF815); Inte	98.99
smart00763		361	AAA_PrkA PrkA AAA domain. This is a family of PrkA	98.99
CHL00081		350	chlI Mg-protoporyphyrin IX chelatase	98.99
COG1127		263	Ttg2A ABC-type transport system involved in resist	98.98
cd03216		163	ABC_Carb_Monos_I This family represents the domain	98.98
smart00464		92	LON Found in ATP-dependent protease La (LON). N-te	98.98
PRK05564		313	DNA polymerase III subunit delta'; Validated	98.97
PRK09112		351	DNA polymerase III subunit delta'; Validated	98.97
TIGR00678		188	holB DNA polymerase III, delta' subunit. At positi	98.96
TIGR02928		365	orc1/cdc6 family replication initiation protein. M	98.96
PF01078		206	Mg_chelatase: Magnesium chelatase, subunit ChlI; I	98.95
COG0470		325	HolB ATPase involved in DNA replication [DNA repli	98.95
PRK13536		340	nodulation factor exporter subunit NodI; Provision	98.94
PRK07399		314	DNA polymerase III subunit delta'; Validated	98.94
PRK08058		329	DNA polymerase III subunit delta'; Validated	98.94
PRK07471		365	DNA polymerase III subunit delta'; Validated	98.93
PRK08903		227	DnaA regulatory inactivator Hda; Validated	98.93
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	98.93
PRK08727		233	hypothetical protein; Validated	98.93
PRK00149		450	dnaA chromosomal replication initiation protein; R	98.92
TIGR00362		405	DnaA chromosomal replication initiator protein Dna	98.92
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	98.91
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	98.91
smart00350		509	MCM minichromosome maintenance proteins.	98.91
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	98.91
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	98.9
PRK00411		394	cdc6 cell division control protein 6; Reviewed	98.9
PRK05642		234	DNA replication initiation factor; Validated	98.9
COG4586		325	ABC-type uncharacterized transport system, ATPase	98.9
PRK14086		617	dnaA chromosomal replication initiation protein; P	98.89
PF13177		162	DNA_pol3_delta2: DNA polymerase III, delta subunit	98.89
cd00009		151	AAA The AAA+ (ATPases Associated with a wide varie	98.89
TIGR03420		226	DnaA_homol_Hda DnaA regulatory inactivator Hda. Me	98.88
PRK12422		445	chromosomal replication initiation protein; Provis	98.88
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	98.88
cd03246		173	ABCC_Protease_Secretion This family represents the	98.88
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	98.86
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	98.84
PTZ00112		1164	origin recognition complex 1 protein; Provisional	98.84
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	98.83
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	98.83
COG3638		258	ABC-type phosphate/phosphonate transport system, A	98.83
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	98.83
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	98.83
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	98.82
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	98.82
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	98.82
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	98.82
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	98.81
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	98.81
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	98.81
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	98.81
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	98.81
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	98.81
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	98.81
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	98.81
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	98.81
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	98.81
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	98.8
PRK05707		328	DNA polymerase III subunit delta'; Validated	98.8
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	98.8
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	98.8
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	98.8
PRK06620		214	hypothetical protein; Validated	98.8
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	98.79
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	98.79
TIGR00602		637	rad24 checkpoint protein rad24. This family is bas	98.79
TIGR02974		329	phageshock_pspF psp operon transcriptional activat	98.79
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	98.79
cd03215		182	ABC_Carb_Monos_II This family represents domain II	98.79
COG3604		550	FhlA Transcriptional regulator containing GAF, AAA	98.78
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	98.78
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	98.78
COG0411		250	LivG ABC-type branched-chain amino acid transport	98.78
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	98.78
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	98.78
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	98.78
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	98.77
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	98.77
cd03269		210	ABC_putative_ATPase This subfamily is involved in	98.76
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	98.76
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	98.76
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	98.75
PRK14088		440	dnaA chromosomal replication initiation protein; P	98.75
PRK09087		226	hypothetical protein; Validated	98.75
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	98.75
COG2884		223	FtsE Predicted ATPase involved in cell division [C	98.75
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	98.75
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	98.74
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	98.74
PF00308		219	Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013	98.74
PRK06871		325	DNA polymerase III subunit delta'; Validated	98.74
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	98.74
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	98.73
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	98.73
PRK10908		222	cell division protein FtsE; Provisional	98.73
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	98.73
COG0410		237	LivF ABC-type branched-chain amino acid transport	98.73
COG3829		560	RocR Transcriptional regulator containing PAS, AAA	98.72
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	98.72
PRK04132		846	replication factor C small subunit; Provisional	98.72
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	98.71
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	98.71
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	98.71
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	98.71
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	98.71
COG2204		464	AtoC Response regulator containing CheY-like recei	98.7
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	98.7
TIGR01817		534	nifA Nif-specific regulatory protein. This model r	98.7
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	98.7
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	98.7
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	98.7
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	98.7
TIGR00368		499	Mg chelatase-related protein. The N-terminal end m	98.7
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	98.7
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	98.7
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	98.7
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	98.7
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	98.69
PF01695		178	IstB_IS21: IstB-like ATP binding protein; InterPro	98.69
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	98.69
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	98.68
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	98.68
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	98.68
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	98.68
PF06068		398	TIP49: TIP49 C-terminus; InterPro: IPR010339 This	98.68
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	98.68
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	98.68
COG0542		786	clpA ATP-binding subunits of Clp protease and DnaK	98.68
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	98.67
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	98.67
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	98.67
PRK09862		506	putative ATP-dependent protease; Provisional	98.66
KOG0736		953	consensus Peroxisome assembly factor 2 containing	98.66
PRK05022		509	anaerobic nitric oxide reductase transcription reg	98.66
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	98.66
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	98.66
PF00158		168	Sigma54_activat: Sigma-54 interaction domain; Inte	98.66
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	98.66
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	98.66
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	98.66
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	98.66
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	98.66
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	98.65
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	98.65
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	98.65
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	98.65
PTZ00111		915	DNA replication licensing factor MCM4; Provisional	98.65
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	98.65
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	98.65
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	98.64
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	98.64
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	98.64
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	98.64
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	98.64
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	98.64
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	98.64
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	98.64
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	98.63
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	98.63
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	98.63
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	98.63
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	98.63
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	98.63
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	98.63
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	98.62
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	98.62
COG2607		287	Predicted ATPase (AAA+ superfamily) [General funct	98.62
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	98.62
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	98.62
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	98.62
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	98.62
PRK08769		319	DNA polymerase III subunit delta'; Validated	98.62
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	98.62
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	98.62
KOG0478		804	consensus DNA replication licensing factor, MCM4 c	98.61
PRK11608		326	pspF phage shock protein operon transcriptional ac	98.61
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	98.61
COG1224		450	TIP49 DNA helicase TIP49, TBP-interacting protein	98.61
COG1221		403	PspF Transcriptional regulators containing an AAA-	98.61
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	98.61
PRK14087		450	dnaA chromosomal replication initiation protein; P	98.61
PRK06090		319	DNA polymerase III subunit delta'; Validated	98.61
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	98.61
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	98.61
COG4525		259	TauB ABC-type taurine transport system, ATPase com	98.6
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	98.6
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	98.6
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	98.6
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	98.6
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	98.6
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	98.6
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	98.6
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	98.6
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	98.6
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	98.59
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	98.59
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	98.59
PRK06964		342	DNA polymerase III subunit delta'; Validated	98.59
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	98.59
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	98.59
KOG1969		877	consensus DNA replication checkpoint protein CHL12	98.59
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	98.59
COG1484		254	DnaC DNA replication protein [DNA replication, rec	98.59
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	98.59
COG1239		423	ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis	98.58
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	98.58
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	98.58
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	98.58
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	98.58
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	98.58
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	98.58
PRK15429		686	formate hydrogenlyase transcriptional activator Fh	98.58
KOG0990		360	consensus Replication factor C, subunit RFC5 [Repl	98.58
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	98.57
COG3845		501	ABC-type uncharacterized transport systems, ATPase	98.57
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	98.57
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	98.57
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	98.57
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	98.57
COG4619		223	ABC-type uncharacterized transport system, ATPase	98.57
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	98.57
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	98.56
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	98.56
PRK07993		334	DNA polymerase III subunit delta'; Validated	98.56
smart00382		148	AAA ATPases associated with a variety of cellular	98.55
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	98.55
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	98.55
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	98.55
KOG2035		351	consensus Replication factor C, subunit RFC3 [Cell	98.55
PRK03695		248	vitamin B12-transporter ATPase; Provisional	98.55
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	98.54
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	98.54
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	98.54
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	98.54
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	98.54
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	98.54
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	98.54
COG1241		682	MCM2 Predicted ATPase involved in replication cont	98.54
cd03234		226	ABCG_White The White subfamily represents ABC tran	98.54
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	98.53
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	98.53
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	98.53
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	98.52
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	98.52
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	98.52
PRK13546		264	teichoic acids export protein ATP-binding subunit;	98.52
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	98.52
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	98.52
COG5271		4600	MDN1 AAA ATPase containing von Willebrand factor t	98.52
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	98.52
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	98.52
COG1474		366	CDC6 Cdc6-related protein, AAA superfamily ATPase	98.52
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	98.52
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	98.51
PRK15424		538	propionate catabolism operon regulatory protein Pr	98.51
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	98.51
cd03299		235	ABC_ModC_like Archeal protein closely related to M	98.51
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	98.51
KOG0058		716	consensus Peptide exporter, ABC superfamily [Intra	98.5
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	98.5
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	98.5
PRK10938		490	putative molybdenum transport ATP-binding protein	98.5
COG4133		209	CcmA ABC-type transport system involved in cytochr	98.5
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	98.5
PRK10820		520	DNA-binding transcriptional regulator TyrR; Provis	98.49
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	98.49
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	98.49
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	98.49
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	98.49
KOG0735		952	consensus AAA+-type ATPase [Posttranslational modi	98.49
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	98.49
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	98.48
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	98.48
KOG0480		764	consensus DNA replication licensing factor, MCM6 c	98.48
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	98.48
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	98.48
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	98.48
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	98.48
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	98.48
PRK08699		325	DNA polymerase III subunit delta'; Validated	98.48
PRK12377		248	putative replication protein; Provisional	98.47
TIGR02329		526	propionate_PrpR propionate catabolism operon regul	98.47
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	98.47
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	98.47
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	98.46
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	98.46
KOG0057		591	consensus Mitochondrial Fe/S cluster exporter, ABC	98.46
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	98.46
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	98.45
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	98.45
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	98.45
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	98.44
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	98.44
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	98.44
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	98.44
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	98.44
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	98.44
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	98.43
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	98.43
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	98.43
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	98.43
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	98.43
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	98.42
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	98.42
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	98.42
PRK10261		623	glutathione transporter ATP-binding protein; Provi	98.42
PRK11388		638	DNA-binding transcriptional regulator DhaR; Provis	98.42
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	98.42
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	98.41
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	98.41
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	98.41
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	98.41
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	98.41
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	98.4
PRK09984		262	phosphonate/organophosphate ester transporter subu	98.4
COG1123		539	ATPase components of various ABC-type transport sy	98.4
COG0606		490	Predicted ATPase with chaperone activity [Posttran	98.4
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	98.4
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	98.4
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	98.39
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	98.39
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	98.39
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	98.38
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	98.38
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	98.38
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	98.38
PRK10261		623	glutathione transporter ATP-binding protein; Provi	98.38
PRK08116		268	hypothetical protein; Validated	98.38
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	98.38
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	98.37
COG0488		530	Uup ATPase components of ABC transporters with dup	98.37
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	98.37
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	98.37
KOG0059		885	consensus Lipid exporter ABCA1 and related protein	98.37
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	98.36
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	98.36
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	98.36
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	98.36
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	98.36
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	98.36
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	98.35
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	98.35
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	98.35
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	98.35
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	98.35
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	98.35

>COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

Probab=100.00  E-value=1.4e-93  Score=785.54  Aligned_cols=523  Identities=45%  Similarity=0.711  Sum_probs=495.0

Q ss_pred             eEEEEecCCCcccCCceeeEEeCCHhHHHHHHHHHhcCCCeEEEEEeeCCCCCCCCCcccccccccccccccccccccee
Q 005548          148 SVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVGT  227 (691)
Q Consensus       148 ~lPlfPL~~~VLfPg~~lpL~Ifepry~~~v~~~~~~~~~~~gv~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~l~~vGt  227 (691)
                      +||++||++.|+||++++||.|.+++++++++.++.+++.+++++++|+...++|..               +++|+|||
T Consensus         9 ~lpvlplr~~vvfP~m~~pl~vgr~~si~ale~a~~~~~k~i~l~~qk~~~~d~p~~---------------~dly~vGt   73 (782)
T COG0466           9 ELPVLPLRDVVVFPGMVIPLFVGREKSIKALEEAMKNDQKYILLVTQKDASTDEPTE---------------DDLYEVGT   73 (782)
T ss_pred             cceeEEecCceeCCCceeeEEcCChhHHHHHHHHHhCCCCEEEEEEecccccCCCCh---------------hhhhhcch
Confidence            899999999999999999999999999999999999877889999999877666643               79999999


Q ss_pred             EEEEEEe-----cCeEEEEEeeeEEEEEEeeecCC-eEEEEEecCCCCCCCChHHHHHHHHHHHHHHHHHHHhCccchhh
Q 005548          228 LAQISSI-----QGDQVILIGHRRLRITEMVSEDP-LTVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWRDH  301 (691)
Q Consensus       228 ~a~I~~~-----g~~~i~v~G~~R~rI~~~~~~~p-~~a~V~~l~d~~~~~~~~~~~~l~~~l~~~l~~~~~~~~~~~~~  301 (691)
                      +|+|.++     |+.+|+++|++|++|.++..+++ +.|+++.+++.+.+. ..+.+++.+.+.+.|++|.++++..+.+
T Consensus        74 ~a~I~q~~~lpdg~~kvlveg~~R~~I~~~~~~~~~~~a~~~~i~~~~~~~-~~~~~al~~~i~~~~~~~~~l~~~~~~e  152 (782)
T COG0466          74 LAKILQILKLPDGTVKVLVEGLQRVRISKLSDEEEFFEAEIELLPDEPIDE-EREIEALVRSILSEFEEYAKLNKKIPPE  152 (782)
T ss_pred             heeeeeeeeCCCCcEEEEEEeeeeEEEEeeccCCCceEEEEEecCCCcccc-hhHHHHHHHHHHHHHHHHHHhccCCCHH
Confidence            9999999     88999999999999999998766 699999999886542 5678999999999999999999866554


Q ss_pred             HHHHhhhcCCCChhHHHHHHHHhCCCChhhHHHHHhccCHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHhhHHHHHHH
Q 005548          302 VQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYL  381 (691)
Q Consensus       302 ~~~~~~~~~~~d~~~L~d~~a~~l~l~~~~Kq~LLe~~d~~~Rl~~l~~lL~~Eie~l~l~~ei~~~v~~~i~~~qre~~  381 (691)
                      .......++  ++.+|+|++|++++++.++||++|++.|+.+|++.++.+|..|++.++++++|.++|+++|++.|||||
T Consensus       153 ~l~~~~~i~--~~~klad~iaa~l~~~~~~kQ~iLe~~~v~~Rlek~l~~l~~ei~~~~~ek~I~~kVk~~meK~QREyy  230 (782)
T COG0466         153 ELQSLNSID--DPGKLADTIAAHLPLKLEEKQEILETLDVKERLEKLLDLLEKEIDLLQLEKRIRKKVKEQMEKSQREYY  230 (782)
T ss_pred             HHHHHhccc--chHHHHHHHHHhCCCCHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            333333566  999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHcCccccchHHHHHHHHHHHHHhhccCChhhHHHHHHHHHHHhhcccCCccchhhHhHHhhhcCCCCCCC
Q 005548          382 LNEQLKAIKKELGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALPWGNY  461 (691)
Q Consensus       382 l~eql~~i~kel~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~el~~l~~~~~~~~~~~~~~~~l~~~~~lp~~~~  461 (691)
                      |+|||++||+|||... +...+++++++++++.  .+|+++.+.+++|+.+++.|++++++++++|||++|+..+||.+.
T Consensus       231 L~EQlKaIqkELG~~~-d~~~e~~~~~~kie~~--~~p~evk~k~~~El~kL~~m~~~SaE~~ViRnYlDwll~lPW~~~  307 (782)
T COG0466         231 LREQLKAIQKELGEDD-DDKDEVEELREKIEKL--KLPKEAKEKAEKELKKLETMSPMSAEATVIRNYLDWLLDLPWGKR  307 (782)
T ss_pred             HHHHHHHHHHHhCCCc-cchhHHHHHHHHHhhc--CCCHHHHHHHHHHHHHHhcCCCCCchHHHHHHHHHHHHhCCCccc
Confidence            9999999999999654 3348899999999975  899999999999999999999999999999999999999999999


Q ss_pred             CchhhhHHHHhhhhhccccchHHHHHHHHHHHHhccccCCCCCceEEEEcCCCCcHHHHHHHHHHHhcCCeEEEEeCccc
Q 005548          462 SDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGKTSIGRSIARALNRKFFRFSVGGLA  541 (691)
Q Consensus       462 ~~~~~~~~~~~~~l~~~i~Gl~~vk~~i~~~l~l~~~~~~~~g~~vlL~GPpGtGKTtLakaLA~~l~~~~~~i~~~~~~  541 (691)
                      +.+..|+.+++++|+++|||++++|+++.+++++..+...-+|.++||+||||+|||+|+++||+.+++.|++++++|+.
T Consensus       308 sk~~~Dl~~a~~iLd~dHYGLekVKeRIlEyLAV~~l~~~~kGpILcLVGPPGVGKTSLgkSIA~al~RkfvR~sLGGvr  387 (782)
T COG0466         308 SKDKLDLKKAEKILDKDHYGLEKVKERILEYLAVQKLTKKLKGPILCLVGPPGVGKTSLGKSIAKALGRKFVRISLGGVR  387 (782)
T ss_pred             cchhhhHHHHHHHhcccccCchhHHHHHHHHHHHHHHhccCCCcEEEEECCCCCCchhHHHHHHHHhCCCEEEEecCccc
Confidence            99999999999999999999999999999999999888888999999999999999999999999999999999999999


Q ss_pred             hhhhhhcccCcccccccchHHHHHHHhcccCCEEEehhhhhhcccCCCCHHHHHHhhcCHHHHHHHHHhhccccccCCce
Q 005548          542 DVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKV  621 (691)
Q Consensus       542 ~~~~l~g~~~~~vG~~~~~i~~~l~~~~~~~~VlllDEidkl~~~~~~~~~~~LL~~LD~~~~~~~~d~~~~~~~~~~~v  621 (691)
                      |.++++||+++|+|.+||++.+.+..+...|||++||||||++.++++|++++||++|||+||..|.|+|+++++|++++
T Consensus       388 DEAEIRGHRRTYIGamPGrIiQ~mkka~~~NPv~LLDEIDKm~ss~rGDPaSALLEVLDPEQN~~F~DhYLev~yDLS~V  467 (782)
T COG0466         388 DEAEIRGHRRTYIGAMPGKIIQGMKKAGVKNPVFLLDEIDKMGSSFRGDPASALLEVLDPEQNNTFSDHYLEVPYDLSKV  467 (782)
T ss_pred             cHHHhccccccccccCChHHHHHHHHhCCcCCeEEeechhhccCCCCCChHHHHHhhcCHhhcCchhhccccCccchhhe
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeCCCCCCChhhcCeEEEEEEcCCCHHHHHHHHHHHHhHHhHHhcCCCCCceeeCHHHHHHhhhcC
Q 005548          622 LFVCTANVVENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQKITAGKQGFGIFRNR  691 (691)
Q Consensus       622 i~I~TsN~~~~l~~aLldR~~iI~~~~~~~~e~~~I~~~~l~~~~~~~~~l~~~~l~is~~~i~~ii~~~  691 (691)
                      +||+|+|..+.+|.+|+|||++|++++|+.+|+.+|+++||.+++.+.+|+++.++.++|++|..||++|
T Consensus       468 mFiaTANsl~tIP~PLlDRMEiI~lsgYt~~EKl~IAk~~LiPk~~~~~gL~~~el~i~d~ai~~iI~~Y  537 (782)
T COG0466         468 MFIATANSLDTIPAPLLDRMEVIRLSGYTEDEKLEIAKRHLIPKQLKEHGLKKGELTITDEAIKDIIRYY  537 (782)
T ss_pred             EEEeecCccccCChHHhcceeeeeecCCChHHHHHHHHHhcchHHHHHcCCCccceeecHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999875

>KOG2004 consensus Mitochondrial ATP-dependent protease PIM1/LON [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK10787 DNA-binding ATP-dependent protease La; Provisional	Back alignment and domain information

>TIGR00763 lon ATP-dependent protease La	Back alignment and domain information

>COG2802 Uncharacterized protein, similar to the N-terminal domain of Lon protease [General function prediction only]	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF02190 LON: ATP-dependent protease La (LON) domain; InterPro: IPR003111 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01242 26Sp45 26S proteasome subunit P45 family	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0727 consensus 26S proteasome regulatory complex, ATPase RPT3 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>PRK03992 proteasome-activating nucleotidase; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0733 consensus Nuclear AAA ATPase (VCP subfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0734 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00195 ycf46 Ycf46; Provisional	Back alignment and domain information

>KOG0738 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0728 consensus 26S proteasome regulatory complex, ATPase RPT6 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>TIGR03689 pup_AAA proteasome ATPase	Back alignment and domain information

>KOG0739 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair	Back alignment and domain information

>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional	Back alignment and domain information

>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional	Back alignment and domain information

>KOG0731 consensus AAA+-type ATPase containing the peptidase M41 domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>CHL00181 cbbX CbbX; Provisional	Back alignment and domain information

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional	Back alignment and domain information

>KOG1051 consensus Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0737 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0726 consensus 26S proteasome regulatory complex, ATPase RPT2 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX)	Back alignment and domain information

>KOG0652 consensus 26S proteasome regulatory complex, ATPase RPT5 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH	Back alignment and domain information

>TIGR02881 spore_V_K stage V sporulation protein K	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX	Back alignment and domain information

>TIGR02903 spore_lon_C ATP-dependent protease, Lon family	Back alignment and domain information

>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>CHL00176 ftsH cell division protein; Validated	Back alignment and domain information

>PRK07003 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0740 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14956 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional	Back alignment and domain information

>KOG0742 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK12323 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0651 consensus 26S proteasome regulatory complex, ATPase RPT4 [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit	Back alignment and domain information

>KOG0989 consensus Replication factor C, subunit RFC4 [Replication, recombination and repair]	Back alignment and domain information

>PLN03025 replication factor C subunit; Provisional	Back alignment and domain information

>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily	Back alignment and domain information

>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14962 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0744 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14949 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0743 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14960 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit	Back alignment and domain information

>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport	Back alignment and domain information

>PRK14958 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>CHL00206 ycf2 Ycf2; Provisional	Back alignment and domain information

>PRK10733 hflB ATP-dependent metalloprotease; Reviewed	Back alignment and domain information

>PRK04195 replication factor C large subunit; Provisional	Back alignment and domain information

>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed	Back alignment and domain information

>PRK14961 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK07994 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK07764 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14964 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK08691 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14951 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06645 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02544 44 clamp loader, small subunit; Provisional	Back alignment and domain information

>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN	Back alignment and domain information

>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA	Back alignment and domain information

>PRK14952 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14957 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14963 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK14959 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK13342 recombination factor protein RarA; Reviewed	Back alignment and domain information

>KOG0732 consensus AAA+-type ATPase containing the bromodomain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family	Back alignment and domain information

>PRK14965 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0741 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05563 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PHA02244 ATPase-like protein	Back alignment and domain information

>PRK14969 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR01650 PD_CobS cobaltochelatase, CobS subunit	Back alignment and domain information

>KOG2028 consensus ATPase related to the helicase subunit of the Holliday junction resolvase [Replication, recombination and repair]	Back alignment and domain information

>TIGR02902 spore_lonB ATP-dependent protease LonB	Back alignment and domain information

>PRK07133 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK05896 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK09111 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>COG0714 MoxR-like ATPases [General function prediction only]	Back alignment and domain information

>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed	Back alignment and domain information

>KOG0730 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK06647 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK08451 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>PRK14953 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau	Back alignment and domain information

>PRK06305 DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>KOG0991 consensus Replication factor C, subunit RFC2 [Replication, recombination and repair]	Back alignment and domain information

>PRK07940 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK14954 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK12402 replication factor C small subunit 2; Reviewed	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []	Back alignment and domain information

>PRK13531 regulatory ATPase RavA; Provisional	Back alignment and domain information

>PRK14955 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00440 rfc replication factor C small subunit; Reviewed	Back alignment and domain information

>PRK10865 protein disaggregation chaperone; Provisional	Back alignment and domain information

>PRK14950 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK09183 transposase/IS protein; Provisional	Back alignment and domain information

>PRK14948 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK14970 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>KOG0745 consensus Putative ATP-dependent Clp-type protease (AAA+ ATPase superfamily) [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14971 DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>PRK06526 transposase; Provisional	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG1220 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB	Back alignment and domain information

>CHL00095 clpC Clp protease ATP binding subunit	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13407 bchI magnesium chelatase subunit I; Provisional	Back alignment and domain information

>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional	Back alignment and domain information

>PRK08084 DNA replication initiation factor; Provisional	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function	Back alignment and domain information

>smart00763 AAA_PrkA PrkA AAA domain	Back alignment and domain information

>CHL00081 chlI Mg-protoporyphyrin IX chelatase	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>smart00464 LON Found in ATP-dependent protease La (LON)	Back alignment and domain information

>PRK05564 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK09112 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>TIGR00678 holB DNA polymerase III, delta' subunit	Back alignment and domain information

>TIGR02928 orc1/cdc6 family replication initiation protein	Back alignment and domain information

>PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX	Back alignment and domain information

>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>PRK07399 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08058 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK07471 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK08903 DnaA regulatory inactivator Hda; Validated	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PRK08727 hypothetical protein; Validated	Back alignment and domain information

>PRK00149 dnaA chromosomal replication initiation protein; Reviewed	Back alignment and domain information

>TIGR00362 DnaA chromosomal replication initiator protein DnaA	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>smart00350 MCM minichromosome maintenance proteins	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK00411 cdc6 cell division control protein 6; Reviewed	Back alignment and domain information

>PRK05642 DNA replication initiation factor; Validated	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK14086 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A	Back alignment and domain information

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold	Back alignment and domain information

>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda	Back alignment and domain information

>PRK12422 chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>PTZ00112 origin recognition complex 1 protein; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK05707 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>PRK06620 hypothetical protein; Validated	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>TIGR00602 rad24 checkpoint protein rad24	Back alignment and domain information

>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK09087 hypothetical protein; Validated	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication	Back alignment and domain information

>PRK06871 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>PRK04132 replication factor C small subunit; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms]	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01817 nifA Nif-specific regulatory protein	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR00368 Mg chelatase-related protein	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09862 putative ATP-dependent protease; Provisional	Back alignment and domain information

>KOG0736 consensus Peroxisome assembly factor 2 containing the AAA+-type ATPase domain [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PTZ00111 DNA replication licensing factor MCM4; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only]	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK08769 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>KOG0478 consensus DNA replication licensing factor, MCM4 component [Replication, recombination and repair]	Back alignment and domain information

>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]	Back alignment and domain information

>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms]	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK06090 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK06964 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>KOG1969 consensus DNA replication checkpoint protein CHL12/CTF18 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism]	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional	Back alignment and domain information

>KOG0990 consensus Replication factor C, subunit RFC5 [Replication, recombination and repair]	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK07993 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>smart00382 AAA ATPases associated with a variety of cellular activities	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>KOG2035 consensus Replication factor C, subunit RFC3 [Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair]	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>KOG0058 consensus Peptide exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0735 consensus AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>KOG0480 consensus DNA replication licensing factor, MCM6 component [Replication, recombination and repair]	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>PRK12377 putative replication protein; Provisional	Back alignment and domain information

>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK08116 hypothetical protein; Validated	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>KOG0059 consensus Lipid exporter ABCA1 and related proteins, ABC superfamily [Lipid transport and metabolism; General function prediction only]	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		691
3m6a_A		543	Crystal Structure Of Bacillus Subtilis Lon C-Termin		2e-80
3ljc_A		252	Crystal Structure Of Lon N-Terminal Domain Length =		2e-08
4b4t_J		405	Near-Atomic Resolution Structural Model Of The Yeas		1e-04
2ce7_A		476	Edta Treated Length = 476		6e-04

>pdb|3M6A|A Chain A, Crystal Structure Of Bacillus Subtilis Lon C-Terminal Domain Length = 543

Back alignment and structure

Iteration: 1

Score = 296 bits (758), Expect = 2e-80, Method: Compositional matrix adjust. Identities = 138/265 (52%), Positives = 192/265 (72%), Gaps = 2/265 (0%) Query: 398 DDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTALP 457 + KT E+IE+ P HV + +EL + + + +SS+E +V RNY+DWL ALP Sbjct: 4 EGKTGEVQTLTEKIEEAG--MPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVALP 61 Query: 458 WGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGVGK 517 W + +D+ D+ A ++LDE+H+GL VKERILE++AV KL +G I+CL+GPPGVGK Sbjct: 62 WTDETDDKLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGVGK 121 Query: 518 TSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLVLI 577 TS+ +SIA++L RKF R S+GG+ D +EI+GHRRTY+GAMPG+++Q +K G NP+ L+ Sbjct: 122 TSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVFLL 181 Query: 578 DEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPNPL 637 DEIDK+ GDP+SA+LE+LDPEQN++F DHY++ DLSKVLF+ TAN + IP PL Sbjct: 182 DEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPGPL 241 Query: 638 LDRMEVIAIAGYITDEKMHIARDYL 662 DRME+I IAGY EK+ I +D+L Sbjct: 242 RDRMEIINIAGYTEIEKLEIVKDHL 266

PyMOL of 3m6a

>pdb|3LJC|A Chain A, Crystal Structure Of Lon N-Terminal Domain Length = 252

Back alignment and structure

>pdb|4B4T|J Chain J, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 405

Back alignment and structure

>pdb|2CE7|A Chain A, Edta Treated Length = 476

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		691
3m6a_A		543	ATP-dependent protease LA 1; alpha, beta, ATP-bind	1e-155
3k1j_A		604	LON protease, ATP-dependent protease LON; ATP-bind	2e-25
3ljc_A		252	ATP-dependent protease LA; LON N-domain, allosteri	6e-22
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	6e-13
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-11
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-06
1ypw_A		806	Transitional endoplasmic reticulum ATPase; AAA, P9	8e-12
3m65_A		209	ATP-dependent protease LA 1; coiled-coil, ATP-bind	3e-09
3syl_A		309	Protein CBBX; photosynthesis, rubisco activase, AA	9e-07
1kag_A		173	SKI, shikimate kinase I; transferase, structural g	1e-05
1d2n_A		272	N-ethylmaleimide-sensitive fusion protein; hexamer	1e-05
2c9o_A		456	RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-	1e-05
3pvs_A		447	Replication-associated recombination protein A; ma	2e-05
2pt5_A		168	Shikimate kinase, SK; aromatic amino acid biosynth	2e-05
1via_A		175	Shikimate kinase; structural genomics, transferase	2e-05
3nwj_A		250	ATSK2; P loop, shikimate, nucleoside monophosphate	2e-05
1zuh_A		168	Shikimate kinase; alpha-beta protein, transferase;	3e-05
1qhx_A		178	CPT, protein (chloramphenicol phosphotransferase);	3e-05
2iyv_A		184	Shikimate kinase, SK; transferase, aromatic amino	4e-05
1sxj_A		516	Activator 1 95 kDa subunit; clamp loader, processi	5e-05
3trf_A		185	Shikimate kinase, SK; amino acid biosynthesis, tra	5e-05
3vaa_A		199	Shikimate kinase, SK; structural genomics, center	7e-05
3t15_A		293	Ribulose bisphosphate carboxylase/oxygenase activ	1e-04
3kb2_A		173	SPBC2 prophage-derived uncharacterized protein YOR	1e-04
1e6c_A		173	Shikimate kinase; phosphoryl transfer, ADP, shikim	1e-04
3hu3_A		489	Transitional endoplasmic reticulum ATPase; VCP, tr	2e-04
3iij_A		180	Coilin-interacting nuclear ATPase protein; alpha a	4e-04
2rhm_A		193	Putative kinase; P-loop containing nucleoside trip	5e-04
2bdt_A		189	BH3686; alpha-beta protein, structural genomics, P	6e-04
2qgz_A		308	Helicase loader, putative primosome component; str	8e-04
1zp6_A		191	Hypothetical protein ATU3015; alpha-beta protein.,	9e-04

>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Length = 543	Back alignment and structure

 Score =  458 bits (1180), Expect = e-155
 Identities = 140/281 (49%), Positives = 197/281 (70%), Gaps = 2/281 (0%)

Query: 396 ETDDKTALSAKFRERIEQYKDKCPRHVLQVIEEELTKLQLLEASSSEFNVTRNYLDWLTA 455
           + + KT       E+IE  +   P HV +   +EL + + + +SS+E +V RNY+DWL A
Sbjct: 2   DKEGKTGEVQTLTEKIE--EAGMPDHVKETALKELNRYEKIPSSSAESSVIRNYIDWLVA 59

Query: 456 LPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSGPPGV 515
           LPW + +D+  D+  A ++LDE+H+GL  VKERILE++AV KL    +G I+CL+GPPGV
Sbjct: 60  LPWTDETDDKLDLKEAGRLLDEEHHGLEKVKERILEYLAVQKLTKSLKGPILCLAGPPGV 119

Query: 516 GKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTANPLV 575
           GKTS+ +SIA++L RKF R S+GG+ D +EI+GHRRTY+GAMPG+++Q +K  G  NP+ 
Sbjct: 120 GKTSLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVF 179

Query: 576 LIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTANVVENIPN 635
           L+DEIDK+     GDP+SA+LE+LDPEQN++F DHY++   DLSKVLF+ TAN +  IP 
Sbjct: 180 LLDEIDKMSSDFRGDPSSAMLEVLDPEQNSSFSDHYIEETFDLSKVLFIATANNLATIPG 239

Query: 636 PLLDRMEVIAIAGYITDEKMHIARDYLEKTTREACGIKPEQ 676
           PL DRME+I IAGY   EK+ I +D+L     +  G+K   
Sbjct: 240 PLRDRMEIINIAGYTEIEKLEIVKDHLLPKQIKEHGLKKSN 280

PyMOL of 3m6a

>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Length = 604	Back alignment and structure

>3ljc_A ATP-dependent protease LA; LON N-domain, allosteric enzyme, ATP-binding, DNA-binding, H nucleotide-binding, serine protease, stress respo; 2.60A {Escherichia coli} Length = 252	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>3m65_A ATP-dependent protease LA 1; coiled-coil, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; 2.60A {Bacillus subtilis} Length = 209	Back alignment and structure

>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Length = 309	Back alignment and structure

>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Length = 173	Back alignment and structure

>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Length = 272	Back alignment and structure

>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Length = 456	Back alignment and structure

>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Length = 447	Back alignment and structure

>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Length = 168	Back alignment and structure

>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Length = 175	Back alignment and structure

>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Length = 250	Back alignment and structure

>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Length = 168	Back alignment and structure

>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Length = 178	Back alignment and structure

>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Length = 184	Back alignment and structure

>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Length = 516	Back alignment and structure

>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Length = 185	Back alignment and structure

>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Length = 199	Back alignment and structure

>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Length = 293	Back alignment and structure

>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} PDB: 2axp_A* Length = 173	Back alignment and structure

>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Length = 173	Back alignment and structure

>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* 2pjh_B Length = 489	Back alignment and structure

>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Length = 180	Back alignment and structure

>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Length = 193	Back alignment and structure

>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Length = 189	Back alignment and structure

>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Length = 308	Back alignment and structure

>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Length = 191	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		691
d1svma_		362	c.37.1.20 (A:) Papillomavirus large T antigen heli	9e-39
d1gvnb_		273	c.37.1.21 (B:) Plasmid maintenance system epsilon/	1e-23
d1ofha_		309	c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId	1e-23
d1lv7a_		256	c.37.1.20 (A:) AAA domain of cell division protein	4e-21
d1np6a_		170	c.37.1.10 (A:) Molybdopterin-guanine dinucleotide	1e-18
d1ixza_		247	c.37.1.20 (A:) AAA domain of cell division protein	1e-17
d1r6bx3		315	c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, A	2e-14
d1w5sa2		287	c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-t	2e-13
d1r7ra3		265	c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p	4e-13
d2anea1		110	b.122.1.10 (A:8-117) ATP-dependent protease La (Lo	6e-09
d1ixsb2		239	c.37.1.20 (B:4-242) Holliday junction helicase Ruv	5e-08
d1w44a_		321	c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [Ta	2e-07
d1in4a2		238	c.37.1.20 (A:17-254) Holliday junction helicase Ru	2e-06
d1fnna2		276	c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrob	2e-06
d1s96a_		205	c.37.1.1 (A:) Guanylate kinase {Escherichia coli [	4e-06
d1zp6a1		176	c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {	9e-06
d1qhxa_		178	c.37.1.3 (A:) Chloramphenicol phosphotransferase {	1e-05
d1e6ca_		170	c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chr	1e-05
d1kaga_		169	c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia	2e-05
d1e32a2		258	c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p	3e-05
d1rkba_		173	c.37.1.1 (A:) Adenylate kinase {Human (Homo sapien	3e-05
d1m8pa3		183	c.37.1.15 (A:391-573) ATP sulfurylase C-terminal d	3e-05
d2iyva1		165	c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycoba	4e-05
d1viaa_		161	c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobact	4e-05
d2bdta1		176	c.37.1.25 (A:1-176) Hypothetical protein BH3686 {B	7e-05
d1y63a_		174	c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishma	8e-05
d1zboa1		197	b.122.1.10 (A:2-198) Hypothetical protein BPP1347	2e-04
d1knqa_		171	c.37.1.17 (A:) Gluconate kinase {Escherichia coli	3e-04
d1nksa_		194	c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobu	3e-04
d2i3ba1		189	c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57	4e-04
d1xjca_		165	c.37.1.10 (A:) Molybdopterin-guanine dinucleotide	5e-04
d1znwa1		182	c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu	5e-04
d1qvra3		315	c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus	6e-04
d1sxja2		253	c.37.1.20 (A:295-547) Replication factor C1 {Baker	7e-04
d1d2na_		246	c.37.1.20 (A:) Hexamerization domain of N-ethylmal	7e-04
d1x6va3		195	c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kin	7e-04
d1khta_		190	c.37.1.1 (A:) Adenylate kinase {Archaeon Methanoco	7e-04
d1teva_		194	c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens)	8e-04
d1ckea_		225	c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId:	0.001
d1qzma_		94	c.37.1.20 (A:) ATPase domain of protease Lon (La)	0.001
d1ye8a1		178	c.37.1.11 (A:1-178) Hypothetical kinase-like prote	0.002
d2awna2		232	c.37.1.12 (A:4-235) Maltose transport protein MalK	0.002
d1lw7a2		192	c.37.1.1 (A:220-411) Transcriptional regulator Nad	0.002
d2pmka1		241	c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro	0.003
d1sxjd2		237	c.37.1.20 (D:26-262) Replication factor C2 {Baker'	0.003
d2i1qa2		258	c.37.1.11 (A:65-322) DNA repair protein Rad51, cat	0.003
d1qf9a_		194	c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoi	0.003
d3adka_		194	c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [	0.003
d1sgwa_		200	c.37.1.12 (A:) Putative ABC transporter PF0895 {Py	0.003
d1n0wa_		242	c.37.1.11 (A:) DNA repair protein Rad51, catalytic	0.003

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Length = 362	Back information, alignment and structure


class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Papillomavirus large T antigen helicase domain
species: Simian virus 40 [TaxId: 10633]

 Score =  145 bits (366), Expect = 9e-39
 Identities = 42/334 (12%), Positives = 91/334 (27%), Gaps = 39/334 (11%)

Query: 333 QQVLEELDVYKRLKLTLELVKKEMEISKIQESIAKAIEEKISGEQRRYLLNEQLKAIKKE 392
            +++ E  +  +    L L+   +E     E   K I+++      +Y       A    
Sbjct: 5   WKLVTEYAMETKCDDVLLLLGMYLEFQYSFEMCLKCIKKEQP-SHYKYHEKHYANA---- 59

Query: 393 LGLETDDKTALSAKFRERIEQYKDKCPRHVLQVIE-EELTKLQLLEASSSEFNVTRNYLD 451
                       A F +   Q          Q ++     K       + E  +T  + D
Sbjct: 60  ------------AIFADSKNQKT-----ICQQAVDTVLAKKRVDSLQLTREQMLTNRFND 102

Query: 452 WLTALPWGNYSDENFDVIRAQKILDEDHYGLNDVKERILEFIAVGKLRGISQGKIICLSG 511
            L  +     S  + D+      +   H  L  +   + +F+    +  I + +     G
Sbjct: 103 LLDRMDIMFGSTGSADIEEWMAGVAWLHCLLPKMDSVVYDFLKC-MVYNIPKKRYWLFKG 161

Query: 512 PPGVGKTSIGRSIARALNRKFFRFSVGGLADVAEIKGHRRTYIGAMPGKMVQCLKNVGTA 571
           P   GKT++  ++      K    ++       E+      ++  +   +          
Sbjct: 162 PIDSGKTTLAAALLELCGGKALNVNLPLDRLNFELGVAIDQFLV-VFEDVKGTGGESRDL 220

Query: 572 NPLVLIDEIDKLGRGHAGDPASALLELLDPEQNANFLDHYLDVPIDLSKVLFVCTAN-VV 630
                I+ +D L     G     L +    ++   F                + T N   
Sbjct: 221 PSGQGINNLDNLRDYLDGSVKVNLEKKHLNKRTQIFPP-------------GIVTMNEYS 267

Query: 631 ENIPNPLLDRMEVIAIAGYITDEKMHIARDYLEK 664
                      ++           +  +   LEK
Sbjct: 268 VPKTLQARFVKQIDFRPKDYLKHCLERSEFLLEK 301

PyMOL of d1svma_

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Length = 273	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Length = 309	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Length = 256	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Length = 170	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Length = 247	Back information, alignment and structure

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Length = 315	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Length = 287	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 265	Back information, alignment and structure

>d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]} Length = 110	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Length = 239	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Length = 238	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 276	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Length = 170	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Length = 169	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Length = 258	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Length = 173	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Length = 183	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 165	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Length = 161	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Length = 176	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Length = 174	Back information, alignment and structure

>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]} Length = 197	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Length = 171	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 194	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Length = 189	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Length = 165	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Length = 315	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 253	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 246	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Length = 195	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 190	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 194	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Length = 225	Back information, alignment and structure

>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]} Length = 94	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Length = 192	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 237	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Length = 258	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Length = 194	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Length = 194	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		691
d1zboa1		197	Hypothetical protein BPP1347 {Bordetella parapertu	100.0
d1r6bx3		315	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	99.9
d1lv7a_		256	AAA domain of cell division protein FtsH {Escheric	99.88
d1ixza_		247	AAA domain of cell division protein FtsH {Thermus	99.86
d1qvra3		315	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	99.84
d2anea1		110	ATP-dependent protease La (Lon), N-terminal domain	99.82
d1ofha_		309	HslU {Haemophilus influenzae [TaxId: 727]}	99.82
d1e32a2		258	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	99.81
d1r7ra3		265	Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu	99.81
d1um8a_		364	ClpX {Helicobacter pylori [TaxId: 210]}	99.74
d1in4a2		238	Holliday junction helicase RuvB {Thermotoga mariti	99.69
d1ixsb2		239	Holliday junction helicase RuvB {Thermus thermophi	99.67
d1svma_		362	Papillomavirus large T antigen helicase domain {Si	99.67
d1iqpa2		231	Replication factor C {Archaeon Pyrococcus furiosus	99.67
d1sxjc2		227	Replication factor C3 {Baker's yeast (Saccharomyce	99.66
d1sxjb2		224	Replication factor C4 {Baker's yeast (Saccharomyce	99.66
d1sxja2		253	Replication factor C1 {Baker's yeast (Saccharomyce	99.64
d1njfa_		239	delta prime subunit of DNA polymerase III, N-domai	99.61
d1d2na_		246	Hexamerization domain of N-ethylmalemide-sensitive	99.6
d1sxjd2		237	Replication factor C2 {Baker's yeast (Saccharomyce	99.59
d1sxje2		252	Replication factor C5 {Baker's yeast (Saccharomyce	99.54
d1w44a_		321	NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	99.54
d1g41a_		443	HslU {Haemophilus influenzae [TaxId: 727]}	99.52
d1r6bx2		268	ClpA, an Hsp100 chaperone, AAA+ modules {Escherich	99.48
d1qvra2		387	ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2	99.39
d1g8pa_		333	ATPase subunit of magnesium chelatase, BchI {Rhodo	99.37
d1a5ta2		207	delta prime subunit of DNA polymerase III, N-domai	99.3
d2awna2		232	Maltose transport protein MalK, N-terminal domain	99.23
d1v43a3		239	Hypothetical protein PH0022, N-terminal domain {Py	99.22
d1jbka_		195	ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	99.19
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	99.18
d1fnna2		276	CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T	99.17
d1g2912		240	Maltose transport protein MalK, N-terminal domain	99.17
d3d31a2		229	Sulfate/molybdate ABC transporter, ATP-binding pro	99.16
d1l2ta_		230	MJ0796 {Archaeon Methanococcus jannaschii [TaxId:	99.1
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	99.07
d1oxxk2		242	Glucose transport protein GlcV, N-terminal domain	99.06
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	99.06
d3dhwc1		240	Methionine import ATP-binding protein MetN {Escher	99.04
d1l8qa2		213	Chromosomal replication initiation factor DnaA {Aq	99.04
d1ji0a_		240	Branched chain aminoacid ABC transporter {Thermoto	99.03
d1w5sa2		287	CDC6-like protein APE0152, N-terminal domain {Aero	99.03
d1ny5a2		247	Transcriptional activator sigm54 (NtrC1), C-termin	99.02
d3b60a1		253	Multidrug resistance ABC transporter MsbA, C-termi	99.0
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	99.0
d1jj7a_		251	Peptide transporter Tap1, C-terminal ABC domain {H	98.99
d2gnoa2		198	gamma subunit of DNA polymerase III, N-domain {The	98.95
d2hyda1		255	Putative multidrug export ATP-binding/permease pro	98.95
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	98.92
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	98.85
d1sgwa_		200	Putative ABC transporter PF0895 {Pyrococcus furios	98.82
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	98.81
d1l7vc_		231	ABC transporter involved in vitamin B12 uptake, Bt	98.68
d1ye8a1		178	Hypothetical kinase-like protein Aq_1292 {Aquifex	98.54
d2fnaa2		283	Archaeal ATPase SSO1545 {Sulfolobus solfataricus [	98.5
d1gvnb_		273	Plasmid maintenance system epsilon/zeta, toxin zet	98.43
d2a5yb3		277	CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI	97.93
d1kaga_		169	Shikimate kinase (AroK) {Escherichia coli [TaxId:	97.6
d1zp6a1		176	Hypothetical protein Atu3015 {Agrobacterium tumefa	97.57
d1qhxa_		178	Chloramphenicol phosphotransferase {Streptomyces v	97.54
d1lw7a2		192	Transcriptional regulator NadR, ribosylnicotinamid	97.51
d1knqa_		171	Gluconate kinase {Escherichia coli [TaxId: 562]}	97.5
d1rkba_		173	Adenylate kinase {Human (Homo sapiens), isoenzyme	97.48
d1viaa_		161	Shikimate kinase (AroK) {Campylobacter jejuni [Tax	97.43
d1g6oa_		323	Hexameric traffic ATPase, HP0525 {Helicobacter pyl	97.43
d1e6ca_		170	Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax	97.41
d2iyva1		165	Shikimate kinase (AroK) {Mycobacterium tuberculosi	97.4
d1m8pa3		183	ATP sulfurylase C-terminal domain {Fungus (Penicil	97.39
d1y63a_		174	Probable kinase LmjF30.1890 {Leishmania major [Tax	97.38
d1ak2a1		190	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.34
d1qf9a_		194	UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4	97.33
d2bdta1		176	Hypothetical protein BH3686 {Bacillus halodurans [	97.29
d1x6va3		195	Adenosine-5'phosphosulfate kinase (APS kinase) {Hu	97.26
d1ukza_		196	Uridylate kinase {Baker's yeast (Saccharomyces cer	97.24
d3adka_		194	Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	97.19
d1u0ja_		267	Rep 40 protein helicase domain {Adeno-associated v	97.19
d2i3ba1		189	Cancer-related NTPase, C1orf57 {Human (Homo sapien	97.18
d1zina1		182	Adenylate kinase {Bacillus stearothermophilus [Tax	97.17
d1tuea_		205	Replication protein E1 helicase domain {Human papi	97.12
d1p9ra_		401	Extracellular secretion NTPase EpsE {Vibrio choler	97.11
d2cdna1		181	Adenylate kinase {Mycobacterium tuberculosis [TaxI	97.09
d1ckea_		225	CMP kinase {Escherichia coli [TaxId: 562]}	97.09
d2ak3a1		189	Adenylate kinase {Cow (Bos taurus), mitochondrial	97.07
d1teva_		194	UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]	97.06
d1zaka1		189	Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	97.05
d1s3ga1		182	Adenylate kinase {Bacillus globisporus [TaxId: 145	97.04
d1wb9a2		234	DNA repair protein MutS, the C-terminal domain {Es	97.01
d1q3ta_		223	CMP kinase {Streptococcus pneumoniae [TaxId: 1313]	96.99
d1np6a_		170	Molybdopterin-guanine dinucleotide biosynthesis pr	96.91
d1e4va1		179	Adenylate kinase {Escherichia coli [TaxId: 562]}	96.89
d1khta_		190	Adenylate kinase {Archaeon Methanococcus voltae [T	96.83
d1akya1		180	Adenylate kinase {Baker's yeast (Saccharomyces cer	96.82
d1ly1a_		152	Polynucleotide kinase, kinase domain {Bacteriophag	96.77
d1yj5a2		172	5' polynucleotide kinase-3' phosphatase, C-termina	96.75
d1rz3a_		198	Hypothetical protein rbstp0775 {Bacillus stearothe	96.75
d1bifa1		213	6-phosphofructo-2-kinase/fructose-2,6-bisphosphata	96.74
d2qy9a2		211	GTPase domain of the signal recognition particle r	96.74
d1j8yf2		211	GTPase domain of the signal sequence recognition p	96.69
d1odfa_		286	Hypothetical protein Ygr205W {Baker's yeast (Sacch	96.69
d1sq5a_		308	Pantothenate kinase PanK {Escherichia coli [TaxId:	96.62
d1znwa1		182	Guanylate kinase {Mycobacterium tuberculosis [TaxI	96.59
d1ewqa2		224	DNA repair protein MutS, the C-terminal domain {Th	96.5
d1nksa_		194	Adenylate kinase {Archaeon Sulfolobus acidocaldari	96.5
d1nlfa_		274	Hexameric replicative helicase repA {Escherichia c	96.49
d1lvga_		190	Guanylate kinase {Mouse (Mus musculus) [TaxId: 100	96.41
d1s96a_		205	Guanylate kinase {Escherichia coli [TaxId: 562]}	96.38
d1m7ga_		208	Adenosine-5'phosphosulfate kinase (APS kinase) {Fu	96.37
d1vmaa2		213	GTPase domain of the signal recognition particle r	96.36
d1gkya_		186	Guanylate kinase {Baker's yeast (Saccharomyces cer	96.35
d1ls1a2		207	GTPase domain of the signal sequence recognition p	96.29
d1okkd2		207	GTPase domain of the signal recognition particle r	96.22
d1w36d1		359	Exodeoxyribonuclease V alpha chain (RecD) {Escheri	96.08
d1htwa_		158	Hypothetical protein HI0065 {Haemophilus influenza	96.07
d1v5wa_		258	Meiotic recombination protein DMC1/LIM15 homolog {	96.05
d1szpa2		251	DNA repair protein Rad51, catalytic domain {Baker'	96.04
d1n0wa_		242	DNA repair protein Rad51, catalytic domain {Human	96.02
d1xjca_		165	Molybdopterin-guanine dinucleotide biosynthesis pr	96.02
d1uj2a_		213	Uridine-cytidine kinase 2 {Human (Homo sapiens) [T	96.0
d1pzna2		254	DNA repair protein Rad51, catalytic domain {Archae	95.98
d1xp8a1		268	RecA protein, ATPase-domain {Deinococcus radiodura	95.89
d1tf7a2		242	Circadian clock protein KaiC {Synechococcus sp. st	95.88
d1qzma_		94	ATPase domain of protease Lon (La) {Escherichia co	95.83
d1kgda_		178	Guanylate kinase-like domain of Cask {Human (Homo	95.69
d2p67a1		327	LAO/AO transport system kinase ArgK {Escherichia c	95.68
d1u0la2		225	Probable GTPase EngC (YjeQ), C-terminal domain {Th	95.48
d1nn5a_		209	Thymidylate kinase {Human (Homo sapiens) [TaxId: 9	95.38
d2qm8a1		323	Metallochaperone MeaB {Methylobacterium extorquens	95.38
d2i1qa2		258	DNA repair protein Rad51, catalytic domain {Archae	95.3
g1f2t.1		292	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	95.16
d1yrba1		244	ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss	95.13
d1tf7a1		242	Circadian clock protein KaiC {Synechococcus sp. st	95.09
g1xew.1		329	Smc head domain {Pyrococcus furiosus [TaxId: 2261]	94.92
d1uf9a_		191	Dephospho-CoA kinase {Thermus thermophilus [TaxId:	94.9
d1u94a1		263	RecA protein, ATPase-domain {Escherichia coli [Tax	94.9
d1cr2a_		277	Gene 4 protein (g4p, DNA primase), helicase domain	94.82
d1a1va1		136	HCV helicase domain {Human hepatitis C virus (HCV)	94.81
d4tmka_		210	Thymidylate kinase {Escherichia coli [TaxId: 562]}	94.79
g1ii8.1		369	Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]}	94.76
d1tmka_		214	Thymidylate kinase {Baker's yeast (Saccharomyces c	94.76
d2fh5b1		207	Signal recognition particle receptor beta-subunit	94.68
d1nrjb_		209	Signal recognition particle receptor beta-subunit	94.56
d1r8sa_		160	ADP-ribosylation factor {Human (Homo sapiens), ARF	94.47
d1a7ja_		288	Phosphoribulokinase {Rhodobacter sphaeroides [TaxI	94.44
d1e69a_		308	Smc head domain {Thermotoga maritima [TaxId: 2336]	94.33
d1w1wa_		427	Smc head domain {Baker's yeast (Saccharomyces cere	94.3
d1t9ha2		231	Probable GTPase EngC (YjeQ), C-terminal domain {Ba	94.25
d2vp4a1		197	Deoxyribonucleoside kinase {Fruit fly (Drosophila	94.24
d1svia_		195	Probable GTPase EngB {Bacillus subtilis [TaxId: 14	94.07
d1mo6a1		269	RecA protein, ATPase-domain {Mycobacterium tubercu	93.94
d1upta_		169	ADP-ribosylation factor {Human (Homo sapiens), ARL	93.85
d1uaaa1		306	DEXX box DNA helicase {Escherichia coli, RepD [Tax	93.83
d2qtvb1		166	SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta	93.82
d1kkma_		176	HPr kinase HprK C-terminal domain {Lactobacillus c	93.64
d2cxxa1		184	GTP-binding protein engB {Pyrococcus horikoshii [T	93.56
d1pjra1		318	DEXX box DNA helicase {Bacillus stearothermophilus	93.45
d1jjva_		205	Dephospho-CoA kinase {Haemophilus influenzae [TaxI	93.45
d1mkya1		171	Probable GTPase Der, N-terminal and middle domains	93.41
d1f6ba_		186	SAR1 {Chinese hamster (Cricetulus griseus) [TaxId:	93.36
d2a5ja1		173	Rab2b {Human (Homo sapiens) [TaxId: 9606]}	93.33
d1ksha_		165	ADP-ribosylation factor {Mouse (Mus musculus), ARL	93.29
d1gsia_		208	Thymidylate kinase {Mycobacterium tuberculosis [Ta	93.17
d1wf3a1		178	GTPase Era, N-terminal domain {Thermus thermophilu	93.12
d1z2aa1		164	Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	93.11
d3raba_		169	Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	93.1
d1knxa2		177	HPr kinase HprK C-terminal domain {Mycoplasma pneu	93.08
d1egaa1		179	GTPase Era, N-terminal domain {Escherichia coli [T	93.05
d2f9la1		175	Rab11b {Human (Homo sapiens) [TaxId: 9606]}	93.0
d1vhta_		208	Dephospho-CoA kinase {Escherichia coli [TaxId: 562	92.99
d1zd9a1		164	ADP-ribosylation factor {Human (Homo sapiens), ARL	92.97
d2ocpa1		241	Deoxyguanosine kinase {Human (Homo sapiens) [TaxId	92.95
d2f7sa1		186	Rab27b {Human (Homo sapiens) [TaxId: 9606]}	92.9
d1kaoa_		167	Rap2a {Human (Homo sapiens) [TaxId: 9606]}	92.89
d1ky3a_		175	Rab-related protein ypt7p {Baker's yeast (Saccharo	92.85
d2gj8a1		161	Probable tRNA modification GTPase TrmE (MnmE), G d	92.83
d1z0fa1		166	Rab14 {Human (Homo sapiens) [TaxId: 9606]}	92.71
d1ko7a2		169	HPr kinase HprK C-terminal domain {Staphylococcus	92.7
d1deka_		241	Deoxynucleoside monophosphate kinase {Bacteriophag	92.7
d1ctqa_		166	cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9	92.67
d1p5zb_		241	Deoxycytidine kinase {Human (Homo sapiens) [TaxId:	92.66
d2p6ra3		202	Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22	92.65
d2atva1		168	Ras-like estrogen-regulated growth inhibitor, RERG	92.64
d2ew1a1		171	Rab30 {Human (Homo sapiens) [TaxId: 9606]}	92.62
d1qhla_		222	Cell division protein MukB {Escherichia coli [TaxI	92.6
d1zj6a1		177	ADP-ribosylation factor {Human (Homo sapiens), ARL	92.48
d2erya1		171	r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	92.34
d1vg8a_		184	Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	92.3
d1mkya2		186	Probable GTPase Der, N-terminal and middle domains	92.28
d1lnza2		185	Obg GTP-binding protein middle domain {Bacillus su	92.27
d2bmea1		174	Rab4a {Human (Homo sapiens) [TaxId: 9606]}	92.24
d1h65a_		257	Chloroplast protein translocon GTPase Toc34 {Garde	92.24
d1g16a_		166	Rab-related protein Sec4 {Baker's yeast (Saccharom	92.2
d1xpua3		289	Transcription termination factor Rho, ATPase domai	92.11
d1x3sa1		177	Rab18 {Human (Homo sapiens) [TaxId: 9606]}	92.07
d1fzqa_		176	ADP-ribosylation factor {Mouse (Mus musculus), ARL	91.99
d1r2qa_		170	Rab5a {Human (Homo sapiens) [TaxId: 9606]}	91.99
d1z08a1		167	Rab21 {Human (Homo sapiens) [TaxId: 9606]}	91.97
d2fn4a1		173	r-Ras {Human (Homo sapiens) [TaxId: 9606]}	91.94
d1xtqa1		167	GTP-binding protein RheB {Human (Homo sapiens) [Ta	91.93
d2bcgy1		194	GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi	91.87
d2erxa1		171	di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	91.85
d1e9ra_		433	Bacterial conjugative coupling protein TrwB {Esche	91.81
d2g6ba1		170	Rab26 {Human (Homo sapiens) [TaxId: 9606]}	91.76
d1z06a1		165	Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	91.76
d1wmsa_		174	Rab9a {Human (Homo sapiens) [TaxId: 9606]}	91.65
d1kmqa_		177	RhoA {Human (Homo sapiens) [TaxId: 9606]}	91.64
d1ihua1		296	Arsenite-translocating ATPase ArsA {Escherichia co	91.53
d1z0ja1		167	Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	91.52
d2gjsa1		168	Rad {Human (Homo sapiens) [TaxId: 9606]}	91.51
d1yzqa1		164	Rab6 {Human (Homo sapiens) [TaxId: 9606]}	91.51
d1mh1a_		183	Rac {Human (Homo sapiens) [TaxId: 9606]}	91.47
d1c1ya_		167	Rap1A {Human (Homo sapiens) [TaxId: 9606]}	91.35
d1ek0a_		170	Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T	91.24
d1u8za_		168	Ras-related protein RalA {Cotton-top tamarin (Sagu	91.23
d2g3ya1		172	GTP-binding protein GEM {Human (Homo sapiens) [Tax	91.19
d1udxa2		180	Obg GTP-binding protein middle domain {Thermus the	91.14
d1m7ba_		179	RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	90.93
d2atxa1		185	RhoQ {Human (Homo sapiens) [TaxId: 9606]}	90.76
d2ngra_		191	CDC42 {Human (Homo sapiens) [TaxId: 9606]}	90.75
d1moza_		182	ADP-ribosylation factor {Baker's yeast (Saccharomy	90.75
d1x1ra1		169	Ras-related protein M-Ras (XRas) {Mouse (Mus muscu	90.69
d1e0sa_		173	ADP-ribosylation factor {Human (Homo sapiens), ARF	90.6
d1tq4a_		400	Interferon-inducible GTPase {Mouse (Mus musculus)	90.47
d1puia_		188	Probable GTPase EngB {Escherichia coli [TaxId: 562	90.21
d1xzpa2		160	TrmE GTPase domain {Thermotoga maritima [TaxId: 23	90.2
d2fu5c1		173	Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	89.98
d1p6xa_		333	Thymidine kinase {Equine herpesvirus type 4 [TaxId	89.77
d1azta2		221	Transducin (alpha subunit) {Cow (Bos taurus) [TaxI	89.7
d1nija1		222	Hypothetical protein YjiA, N-terminal domain {Esch	89.62
d1i2ma_		170	Ran {Human (Homo sapiens) [TaxId: 9606]}	89.55
d1wb1a4		179	Elongation factor SelB, N-terminal domain {Methano	89.33
d1zcba2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	89.28
d2bmja1		175	Centaurin gamma 1, G domain {Human (Homo sapiens)	89.2
d1g7sa4		227	Initiation factor IF2/eIF5b, N-terminal (G) domain	88.79
d2dy1a2		267	Elongation factor G (EF-G), N-terminal (G) domain	88.65
d2bv3a2		276	Elongation factor G (EF-G), N-terminal (G) domain	88.3
d2bcjq2		200	Transducin (alpha subunit) {Mouse (Mus musculus) [	86.65
d2jdid3		276	Central domain of beta subunit of F1 ATP synthase	85.97
d1yksa1		140	YFV helicase domain {Yellow fever virus [TaxId: 11	85.11
d1osna_		331	Thymidine kinase {Varicella-zoster virus [TaxId: 1	84.86
d1ihua2		279	Arsenite-translocating ATPase ArsA {Escherichia co	84.4
d1e2ka_		329	Thymidine kinase {Herpes simplex virus type 1, dif	84.38
d1j3ba1		318	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	84.09
d2c78a3		204	Elongation factor Tu (EF-Tu), N-terminal (G) domai	83.64
d2olra1		313	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	83.52
d1svsa1		195	Transducin (alpha subunit) {Rat (Rattus norvegicus	83.47
d1ni3a1		296	YchF GTP-binding protein N-terminal domain {Fissio	82.32
d1wxqa1		319	GTP-binding protein PH0525 {Pyrococcus horikoshii	81.56
d1ii2a1		323	Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo	81.14
d1d0xa2		712	Myosin S1, motor domain {Dictyostelium discoideum	81.03
d1lkxa_		684	Myosin S1, motor domain {Dictyostelium discoideum,	80.94
g1qhh.1		623	DEXX box DNA helicase {Bacillus stearothermophilus	80.93
d1wp9a1		200	putative ATP-dependent RNA helicase PF2015 {Pyroco	80.84
d2fz4a1		206	DNA repair protein RAD25 {Archaeoglobus fulgidus [	80.28

>d1zboa1 b.122.1.10 (A:2-198) Hypothetical protein BPP1347 {Bordetella parapertussis [TaxId: 519]}	Back information, alignment and structure

class: All beta proteins
fold: PUA domain-like
superfamily: PUA domain-like
family: LON domain-like
domain: Hypothetical protein BPP1347
species: Bordetella parapertussis [TaxId: 519]

Probab=100.00  E-value=5.4e-31  Score=224.60  Aligned_cols=189  Identities=13%  Similarity=0.097  Sum_probs=151.0

Q ss_pred             CEEEEEECCCCCCCCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             72799754998635793002883897689999999861999699998517998898876533223223433333442412
Q 005548          147 LSVLALPLPHRPLFPGFYMPIYVKDPKLLAALQESRKRQAPYAGAFLLKDDSLTDASTDTEKSVSDLKGKELFNRLHEVG  226 (691)
Q Consensus       147 ~~lPlfPL~~~vLfPg~~lpL~Ife~ry~~~v~~~~~~~~~~~~v~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~l~~vG  226 (691)
                      .++|+||| ++|+|||+++||+||||||++|+++|++++..+++++..+......+.              ..+++|+||
T Consensus         1 ~elPlfpL-~~VlfP~~~~PL~Ife~ry~~~i~~~l~~~~~~~~v~~~~~~~~~~~~--------------~~~~l~~vG   65 (197)
T d1zboa1           1 AEIPLFPL-SNALFPAGVLRLRVFEIRYLDMVRRCIADGSEFGVVVLEQGTEVRRPD--------------GREVLARAG   65 (197)
T ss_dssp             CEEEEEEE-SSCCCTTBEEEEEECSTTTHHHHHHHHHTTCCEEEEEESSSCSSCCSS--------------CCCCEEEEE
T ss_pred             CCCCEEEC-CCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCC--------------CCCCCCCEE
T ss_conf             99777848-875679953546758569999999998549970231123565311235--------------655401345


Q ss_pred             EEEEEEEE-----CCEEEEEEEEEEEEEEEEEECC-CE-EEEEEECCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCH
Q ss_conf             39999786-----0859999966689997753239-84-99999548999999917899979999999999998285422
Q 005548          227 TLAQISSI-----QGDQVILIGHRRLRITEMVSED-PL-TVKVDHLKDKPYDKDDDVIKATSFEVISTLRDVLKTSSLWR  299 (691)
Q Consensus       227 t~a~I~~~-----g~~~Ilv~G~~R~rI~~~~~~~-p~-~aev~~l~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~  299 (691)
                      |+|+|+++     |+++|+++|.+||+|.++++++ +| .+++++.+++.......+..++...+...+.++........
T Consensus        66 t~~~I~~~~~~~dG~~~i~v~G~~R~~i~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~  145 (197)
T d1zboa1          66 TMARIDHWEAPMPALLELACTGTGRFRLHACTQGKYGLWTGQAEPVPDDAPLEVPPELARSASALGRLIARLQREGVPPH  145 (197)
T ss_dssp             EEEEEEEEECSSTTCEEEEEEEEEEEEEEEEEECGGGCEEEEEEEECCCCCCCCCGGGHHHHHHHHHHHHHHHHTTCCTT
T ss_pred             EEEEEEEECCCCCCCEEEEEEECCCEEEEEEEECCCCEEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCH
T ss_conf             78887520236777536765220003333466136753788987426667756739999999999999999997357850


Q ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHHHHHHHHHH
Q ss_conf             558887300389995579999998089994448899710399999999999999
Q 005548          300 DHVQTYTQHIGDFSFPRLADFGAAISGANKLQCQQVLEELDVYKRLKLTLELVK  353 (691)
Q Consensus       300 ~~~~~~~~~~~~~d~~~Lad~~a~~l~l~~~~KQ~lLe~~d~~~Rl~~l~~~L~  353 (691)
                      .........++  |+.|++|++|++++++.++||++||. |..+|++.+.++|.
T Consensus       146 ~~~~~~~~~~~--~~~~l~~~la~~l~l~~~~kQ~lLE~-~~~~RL~~l~~~L~  196 (197)
T d1zboa1         146 IMPMAAPFRLD--DCGWVADRWAEMLSLPPADKARLLLL-PPLDRLREIDAVLA  196 (197)
T ss_dssp             TCSBCSCCCTT--CHHHHHHHHHHHSCCCHHHHHHHHHS-CHHHHHHHHHHHHH
T ss_pred             HHHHHHHHCCC--CHHHHHHHHHHHCCCCHHHHHHHHCC-CHHHHHHHHHHHHC
T ss_conf             65553123127--89999999998289999999998779-98999999999976

PyMOL of d1zboa1

>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2anea1 b.122.1.10 (A:8-117) ATP-dependent protease La (Lon), N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]}	Back information, alignment and structure

>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]}	Back information, alignment and structure

>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]}	Back information, alignment and structure

>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]}	Back information, alignment and structure

>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]}	Back information, alignment and structure

>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]}	Back information, alignment and structure

>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]}	Back information, alignment and structure

>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]}	Back information, alignment and structure

>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]}	Back information, alignment and structure

>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]}	Back information, alignment and structure

>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]}	Back information, alignment and structure

>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]}	Back information, alignment and structure

>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure

>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]}	Back information, alignment and structure

>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}	Back information, alignment and structure

>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]}	Back information, alignment and structure

>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]}	Back information, alignment and structure

>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]}	Back information, alignment and structure

>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]}	Back information, alignment and structure

>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]}	Back information, alignment and structure

>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}	Back information, alignment and structure

>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]}	Back information, alignment and structure

>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]}	Back information, alignment and structure

>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]}	Back information, alignment and structure

>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]}	Back information, alignment and structure

>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]}	Back information, alignment and structure

>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]}	Back information, alignment and structure

>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]}	Back information, alignment and structure

>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]}	Back information, alignment and structure

>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]}	Back information, alignment and structure

>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}	Back information, alignment and structure

>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]}	Back information, alignment and structure

>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]}	Back information, alignment and structure

>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1qzma_ c.37.1.20 (A:) ATPase domain of protease Lon (La) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]}	Back information, alignment and structure

>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]}	Back information, alignment and structure

>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]}	Back information, alignment and structure

>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]}	Back information, alignment and structure

>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]}	Back information, alignment and structure

>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]}	Back information, alignment and structure

>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]}	Back information, alignment and structure

>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]}	Back information, alignment and structure

>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]}	Back information, alignment and structure

>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]}	Back information, alignment and structure

>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]}	Back information, alignment and structure

>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]}	Back information, alignment and structure

>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]}	Back information, alignment and structure

>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}	Back information, alignment and structure

>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]}	Back information, alignment and structure

>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]}	Back information, alignment and structure

>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]}	Back information, alignment and structure

>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]}	Back information, alignment and structure

>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]}	Back information, alignment and structure

>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]}	Back information, alignment and structure

>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]}	Back information, alignment and structure

>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]}	Back information, alignment and structure

>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]}	Back information, alignment and structure

>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]}	Back information, alignment and structure

>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]}	Back information, alignment and structure

>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]}	Back information, alignment and structure

>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]}	Back information, alignment and structure

>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]}	Back information, alignment and structure

>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}	Back information, alignment and structure

>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]}	Back information, alignment and structure

>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}	Back information, alignment and structure

>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]}	Back information, alignment and structure

>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]}	Back information, alignment and structure

>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]}	Back information, alignment and structure

>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}	Back information, alignment and structure

>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]}	Back information, alignment and structure

>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]}	Back information, alignment and structure

>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]}	Back information, alignment and structure

>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]}	Back information, alignment and structure

>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]}	Back information, alignment and structure

>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure