Citrus Sinensis ID: 005612

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------69
MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRYRGLLVNENRHHRRLNNHHLKNSSNFNKSKQFSDSVSFNPEDNPYASQNASLFRRSAIDKNSKHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTATNSCTSYWPQNFPKMSGSSSKGKEKIGCDTSKGPDSFLGHGNVIDLSGGSQHKNDKQMSASHHSLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGIIHLSSSSASNDGEVNGNGNAGEWRSTSNYSKKVDHRLRDSTGIHSRRNDDLDQISKPCQVANTATKRQKKQESTSSNRGQCSQTISDDTDIVFLDSSGESSRSRPSRIRSQRHQGILDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRFSNRNHHLLHPNASNRRGAPTQLRSRFLNRSRAAPSRRRNFPFPLDMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT
ccccccccEEEccccccccHHHccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccHHHHHHHHHHccccccccccHHHHHccccEEEccccccccccEEcccccccccccccccccccccccHHHHHcccccccccccccc
cccccccEEEEccccccccEEEEcccHHcccccccccccccccccccccccccccHHHcccccccccccccEccccccccccccccccccccEEccccccccccccccHHEEHHHccccccccccccccccccccccccccccccccHEcccccEEEccccccccccccccccccccccccHHHcccEEEEccccccccccccccccccccccEEEEEcccccccccccccccEEEEccccccccccEccccccccccccccccEEEEEcccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEcccccccEccccccccccccEEccccccccccccccccccccccccccccccccccHccccccccEEEccccccccccccccccccEEEEEccccccccccccccccccccEEEEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHcccccccccccHHHHHccccEEEcccccccccEEEEcccccccEEEEcccccHHHHHcccHHHHccccccccccccc
medmdidrvveipdtpdrpaarhvnagdfggkerklpvggclrnsdimdeerwnqtryrgllvnenrhhrrlnnhhlknssnfnkskqfsdsvsfnpednpyasqnaSLFRRSaidknskhetrntigahhmdrgkqmcskfppkpsafqedHARVELSemngfskmpemalsrgntkdlpakdiregqtatnsctsywpqnfpkmsgssskgkekigcdtskgpdsflghgnvidlsggsqhkndkqmsashhsldlprvnrqkrlvrngcisphnIESKAKQLaegsqngskdveqnhsmdvvssgpftvdisdivaedndhckskgiihlssssasndgevngngnagewrstsnyskkvdhrlrdstgihsrrnddldqiskpcqvantatkrqkkqestssnrgqcsqtisddtdivfldssgessrsrpsrirSQRHQGildiadlspelrncdsqgvdcpnnddsDAIARQLEVDQMLALELQEQlyhesplflsgeIDENLARMLQQEEDALRFsnrnhhllhpnasnrrgaptqLRSRFLnrsraapsrrrnfpfpldmdLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDennhqsgasanqinslplstvqtdnFEEACaicldnpsigdsirhlpclhkfhkdcidpwlsrrpscpvckssit
medmdidrvveipdtpdrpaarhvnagdfggkerklpvggclrnsdimdeerwnqTRYRGLLVnenrhhrrlnnhhlknssnfnkSKQFSDSVSFNPEDNPYASQNASLFRrsaidknskhetrntigahhmdrgKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTAtnsctsywpqnfpkmsgssskgKEKIGCDTSKGPDSFLGHGNVIDLSGGSQHKNDKQMSashhsldlprvnrQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGIIHlssssasndgevngngnagewrstsnyskkvdhrlrdstgihsrrnddldqiskpcqvantatkrqkkqestssnrgqcsqtisddtdiVFLDssgessrsrpsrirsqrhqGILDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRFSNRNHHllhpnasnrrgaptQLRSRflnrsraapsrrrnfpfpldMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKdcidpwlsrrpscpvckssit
MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRYRGllvnenrhhrrlnnhhlknssnfnkskqfsdsVSFNPEDNPYASQNASLFRRSAIDKNSKHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTATNSCTSYWPQNFPkmsgssskgkekigCDTSKGPDSFLGHGNVIDLSGGSQHKNDKQMSASHHSLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGIIHLSSSSASNDGEVNGNGNAGEWRSTSNYSKKVDHRLRDSTGIHSRRNDDLDQISKPCQVANTATKRQKKQESTSSNRGQCSQTISDDTDIVFLDssgessrsrpsrirsqrHQGILDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRFSNRNHHLLHPNASNRRGAPTQLRSRFLnrsraapsrrrnfpfPldmdldmrldilEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT
************************************PVGGCLRNSDIMDEERWNQTRYRGLLVN*****************************************************************************************************************************************************************************************************************************************************FTVDISDIVA**************************************************************************************************************************************************************QLEVDQMLALELQEQLYHESPLFLSGEI**********************************************************FPLDMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLA*******************LSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRP**********
****DIDRVVEIPDTPDRP********************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************MDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLAL************QINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSI*
MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRYRGLLVNENRHHRRLNNHHLKNSSNFNKSKQFSDSVSFNPEDNPYASQNASLFRRSAIDKNSKHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTATNSCTSYWPQNFPK*************CDTSKGPDSFLGHGNVIDLSGG**************SLDLPRVNRQKRLVRNGCISPHNIESK***************EQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGIIHLSSSSASNDGEVNGNGNAGEWRSTSNYSKKVDHRLRDSTGIHSRRNDDLDQISKPCQVA*********************QTISDDTDIVFLD****************RHQGILDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRFSNRNHHLLHPNASNRRGAPTQLRSRFLNRSRAAPSRRRNFPFPLDMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT
***MDIDRVVEIPDTPDRPAARHVNAGDFGG*ER**********S**MD*ERWNQTR*RGLLVNENRHHRR**************************EDNPYASQ**SLFRRSAIDKN*******************MCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTATNSCTSYWPQNFPKMSGSSSKGKEKIGCDTSKGPDSFLGHGNVIDLSGG**************SLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGS**************************D*******HCKSKG*IHLSSSSASNDGEV******GEWR*****S**********************************************************TD*******************SQRHQGILDIADLSPEL*********CPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRF**********************************SRRRNFPFPLDMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKS***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRYRGLLVNENRHHRRLNNHHLKNSSNFNKSKQFSDSVSFNPEDNPYASQNASLFRRSAIDKNSKHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKDLPAKDIREGQTATNSCTSYWPQNFPKMSGSSSKGKEKIGCDTSKGPDSFLGHGNVIDLSGGSQHKNDKQMSASHHSLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQNHSMDVVSSGPFTVDISDIVAEDNDHCKSKGIIHLSSSSASNDGEVNGNGNAGEWRSTSNYSKKVDHRLRDSTGIHSRRNDDLDQISKPCQVANTATKRQKKQESTSSNRGQCSQTISDDTDIVFLDSSGESSRSRPSRIRSQRHQGILDIADLSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLARMLQQEEDALRFSNRNHHLLHPNASNRRGAPTQLRSRFLNRSRAAPSRRRNFPFPLDMDLDMRLDILEALESAVDFGDLETRHVSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query688 2.2.26 [Sep-21-2011]
Q9M2S6273 E3 ubiquitin-protein liga no no 0.133 0.336 0.328 4e-14
Q6IRP0312 RING finger protein 126-B N/A no 0.116 0.256 0.378 6e-11
Q9NVW2624 E3 ubiquitin-protein liga yes no 0.116 0.128 0.312 6e-11
Q9WTV7600 E3 ubiquitin-protein liga no no 0.116 0.133 0.312 1e-10
Q3U2C5394 E3 ubiquitin-protein liga no no 0.085 0.149 0.484 2e-10
Q6DIP3311 RING finger protein 126 O yes no 0.116 0.257 0.365 3e-10
Q90972381 E3 ubiquitin-protein liga yes no 0.094 0.170 0.409 3e-10
Q5RCV8381 E3 ubiquitin-protein liga no no 0.094 0.170 0.409 3e-10
O43567381 E3 ubiquitin-protein liga no no 0.094 0.170 0.409 3e-10
Q0VD51380 E3 ubiquitin-protein liga no no 0.094 0.171 0.409 3e-10
>sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 Back     alignment and function desciption
 Score = 80.5 bits (197), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 63/125 (50%), Gaps = 33/125 (26%)

Query: 593 HVSQLQREFNENDYEMLLALDENN-HQSGASANQINSLPLSTVQTDNFEEACA------- 644
            ++ L REF++ DYE L ALD +N   +  S  +IN+LP+   +  + E  C+       
Sbjct: 128 QLALLDREFDDLDYETLRALDSDNVSTTSMSEEEINALPVHKYKVLDPENGCSLAKQAST 187

Query: 645 -------------------------ICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPS 679
                                    +CL+  ++G+ +R LPCLH+FH  CIDPWL ++ +
Sbjct: 188 SSSAEKMLDSANESKKGTEDELTCSVCLEQVTVGEIVRTLPCLHQFHAGCIDPWLRQQGT 247

Query: 680 CPVCK 684
           CPVCK
Sbjct: 248 CPVCK 252
E3 ubiquitin-protein ligase that acts as a positive regulator of abscisic acid-related stress signal transduction.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q6IRP0|R126B_XENLA RING finger protein 126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 Back     alignment and function description
>sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 Back     alignment and function description
>sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 Back     alignment and function description
>sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=2 SV=3 Back     alignment and function description
>sp|Q6DIP3|RN126_XENTR RING finger protein 126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 Back     alignment and function description
>sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 Back     alignment and function description
>sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 Back     alignment and function description
>sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 Back     alignment and function description
>sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
224075605740 predicted protein [Populus trichocarpa] 0.976 0.908 0.455 1e-143
255554186 791 hypothetical protein RCOM_1020610 [Ricin 0.950 0.826 0.419 1e-129
449433191 803 PREDICTED: uncharacterized protein LOC10 0.973 0.834 0.380 1e-113
356533336735 PREDICTED: uncharacterized protein LOC10 0.899 0.842 0.369 3e-98
359477850363 PREDICTED: uncharacterized protein LOC10 0.425 0.807 0.568 3e-86
18390437634 RING/U-box domain-containing protein [Ar 0.850 0.922 0.360 9e-82
297843286634 zinc finger family protein [Arabidopsis 0.859 0.932 0.341 2e-81
147853050625 hypothetical protein VITISV_037878 [Viti 0.777 0.856 0.369 3e-72
7211986716 Contains similarity to the regulatory pr 0.832 0.800 0.342 4e-70
449487516259 PREDICTED: E3 ubiquitin ligase BIG BROTH 0.319 0.849 0.564 3e-64
>gi|224075605|ref|XP_002304703.1| predicted protein [Populus trichocarpa] gi|222842135|gb|EEE79682.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 344/755 (45%), Positives = 446/755 (59%), Gaps = 83/755 (10%)

Query: 1   MEDMDIDRVVEIPDTPDRPAARHVNAGDFGGKERKLPVGGCLRNSDIMDEERWNQTRY-R 59
           MEDM+ D+V EIPDTP+R AAR +N   F  KE    V GCLR S  +DE+ +N  R  R
Sbjct: 1   MEDMNSDQVFEIPDTPERAAARSINGAQFR-KESISSVPGCLRKSGFVDEKSFNPPRTSR 59

Query: 60  GLLVNENRHHRRLNNHHLKNSSNFNKSKQFSDSVSFNPEDNPYASQNASLFRRSAIDKNS 119
           G + +EN  + RL+ H  K+  N ++    S+S     + +P+  QNA LFRR AI  NS
Sbjct: 60  GRIFSENGLNGRLHLHPQKSPINVDEYDSPSNSAL---DSHPH--QNAPLFRRPAIVNNS 114

Query: 120 KHETRNTIGAHHMDRGKQMCSKFPPKPSAFQEDHARVELSEMNGFSKMPEMALSRGNTKD 179
           + E R++ GA +M++ K   +    K     E     +L+EM+   ++ +       +KD
Sbjct: 115 RPENRHSKGAQYMEKSKAGRATSSSKKPFCMEGDDLFDLTEMSEPDRLLDFVFPHSASKD 174

Query: 180 LPAKDIREGQTATNSCTSYWPQNFP-KMSGSSSKGKEKIGCDTSKGPDSFLGHGNVIDLS 238
           L AK+ REGQ ++N  +S      P ++SGS+SKGKEKI  +T  G  S   +   ID +
Sbjct: 175 LQAKETREGQLSSNGGSSVQLAPLPSRISGSTSKGKEKIDVNTCNGSGSASNNVKEIDHA 234

Query: 239 GGSQHKNDKQMSASHHSLDLPRVNRQKRLVRNGCISPHNIESKAKQLAEGSQNGSKDVEQ 298
            G QHK +KQ+ A H S+  PRV  +KRLVRNGCISPHNI ++A++LAE SQ+GS   E+
Sbjct: 235 SGHQHKIEKQLPACHLSVTSPRVGGKKRLVRNGCISPHNIATRAQKLAESSQDGSPGDER 294

Query: 299 NHSMDVVSSGPFTVDISDIVAEDNDHCKSKG---IIHLSSSSASNDGEVNGNGN----AG 351
           NH+ + +S GP  +D+ +IVAEDND  ++KG   I+H  S+S  +D  +  +G      G
Sbjct: 295 NHARNKLSDGPPNIDLREIVAEDNDCYRAKGKKAIVH-PSASKEHDANMTRDGCRDALFG 353

Query: 352 EWRSTSNYSKKVDHRL--------------RDSTGIHSRRNDDLDQIS--KPCQVANTAT 395
            WRST   SK  D  L              R ST  H  R  + D  S  K   V N   
Sbjct: 354 GWRSTHKRSKTQDQPLSYMEQGILGRDDHARCSTNEHDDRLVERDSSSGGKLHHVGNLVA 413

Query: 396 KRQKKQESTSSNRGQCSQTISDDTDIVFLDSSGESSRSRPSRIRSQRHQG----ILDIAD 451
                   TS N+G+CS  + DDT+++FL SS ESS SR SR+ + +H G    I +I +
Sbjct: 414 TYGL----TSRNQGECSTIVPDDTEVLFLGSSRESSSSRSSRVHNHQHDGNLEPIYEIDE 469

Query: 452 LSPELRNCDSQGVDCPNNDDSDAIARQLEVDQMLALELQEQLYHESPLFLSGEIDENLAR 511
           L  E+RN D Q +   +N+DSD  ARQ+E D+MLA ELQE+LYHE P F  GEIDEN+A 
Sbjct: 470 LLTEVRNNDPQLIGFRSNEDSDVTARQVEADEMLARELQERLYHEEPTFGGGEIDENIAW 529

Query: 512 MLQQEEDAL-RFSNRNHHLLHP------------------NASNRRGAPTQ--------L 544
           +LQQEEDAL   S  NH + H                   N SNRRG   Q        L
Sbjct: 530 VLQQEEDALPATSGHNHPVPHLRNSLVAHSSRQRLPRSSHNPSNRRGNQVQVTTTRASGL 589

Query: 545 RSRFLNRSRAAPSRRRN-----------FPFPLDMDLDMRLDILEALESAVDFGDLETRH 593
           RSR  NR+    SR RN           F FP  MDL+MRL+ILE LE+++      TR 
Sbjct: 590 RSRLSNRTPVRISRERNPFPTVFPGGLNFQFPSGMDLEMRLNILENLEASM----TATRM 645

Query: 594 VSQLQREFNENDYEMLLALDENNHQSGASANQINSLPLSTVQTDNFEEACAICLDNPSIG 653
           +  +QR+FNENDYEMLLALDENN Q GASANQIN LP S VQTDNF E CA+CL+ P+IG
Sbjct: 646 L-HVQRDFNENDYEMLLALDENNSQHGASANQINCLPESVVQTDNFGETCAVCLEAPTIG 704

Query: 654 DSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 688
           + IRHLPCLHKFHKDCIDPWLSR+ SCP+CKSSIT
Sbjct: 705 EKIRHLPCLHKFHKDCIDPWLSRKTSCPICKSSIT 739

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255554186|ref|XP_002518133.1| hypothetical protein RCOM_1020610 [Ricinus communis] gi|223542729|gb|EEF44266.1| hypothetical protein RCOM_1020610 [Ricinus communis] Back     alignment and taxonomy information
>gi|449433191|ref|XP_004134381.1| PREDICTED: uncharacterized protein LOC101205482 [Cucumis sativus] Back     alignment and taxonomy information
>gi|356533336|ref|XP_003535221.1| PREDICTED: uncharacterized protein LOC100789823 [Glycine max] Back     alignment and taxonomy information
>gi|359477850|ref|XP_002283247.2| PREDICTED: uncharacterized protein LOC100247656 [Vitis vinifera] Back     alignment and taxonomy information
>gi|18390437|ref|NP_563717.1| RING/U-box domain-containing protein [Arabidopsis thaliana] gi|15450836|gb|AAK96689.1| Unknown protein [Arabidopsis thaliana] gi|30725482|gb|AAP37763.1| At1g04790 [Arabidopsis thaliana] gi|332189623|gb|AEE27744.1| RING/U-box domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297843286|ref|XP_002889524.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297335366|gb|EFH65783.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|147853050|emb|CAN82765.1| hypothetical protein VITISV_037878 [Vitis vinifera] Back     alignment and taxonomy information
>gi|7211986|gb|AAF40457.1|AC004809_15 Contains similarity to the regulatory protein (G1) gb|M97204 goliath from D. melanogaster. EST gb|T76547 comes from this gene [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|449487516|ref|XP_004157665.1| PREDICTED: E3 ubiquitin ligase BIG BROTHER-related-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query688
TAIR|locus:2010582634 AT1G04790 [Arabidopsis thalian 0.312 0.339 0.413 1.8e-41
DICTYBASE|DDB_G0282479320 DDB_G0282479 "E3 ubiquitin-pro 0.130 0.281 0.431 5.1e-18
UNIPROTKB|K7GLM9238 LOC100519887 "Uncharacterized 0.111 0.323 0.409 8e-11
RGD|1359698165 Rnf181 "ring finger protein 18 0.126 0.527 0.340 9.4e-11
UNIPROTKB|Q6AXU4165 Rnf181 "E3 ubiquitin-protein l 0.126 0.527 0.340 9.4e-11
ZFIN|ZDB-GENE-060503-608301 si:ch211-81a5.1 "si:ch211-81a5 0.114 0.262 0.395 1.1e-10
UNIPROTKB|Q3T0W3153 RNF181 "E3 ubiquitin-protein l 0.145 0.653 0.330 1.5e-10
UNIPROTKB|E2QUN1153 RNF181 "Uncharacterized protei 0.145 0.653 0.320 1.5e-10
TAIR|locus:2050522180 AT2G44330 [Arabidopsis thalian 0.087 0.333 0.45 1.5e-10
UNIPROTKB|F1SVB7153 RNF181 "Uncharacterized protei 0.145 0.653 0.330 2e-10
TAIR|locus:2010582 AT1G04790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 415 (151.1 bits), Expect = 1.8e-41, Sum P(3) = 1.8e-41
 Identities = 93/225 (41%), Positives = 126/225 (56%)

Query:   473 DAIARQLEVDQMLA--LELQEQLYHESPLFLSGEIDEN---LA---RMLQQEEDALRFSN 524
             +++ R  ++D+++A  +E +E     S    S  I  +   +A   R   + E  L+  +
Sbjct:   411 ESLIRHEQIDEIIARSMEQEENSLRASSSRASTRITRSSNTIAANPRGRSRLEARLQQHS 470

Query:   525 RNHHLLHPNASNRRGAPTQLRSRFLXXXXXXXXXXXXXXXPXXXXXXXXXXXXEALESAV 584
                    P A     AP + R   L               P            E LE+A+
Sbjct:   471 SRRRFNPPQARAPVRAPARGRGYRLGGASASLRTALNFSFPIDMGLDSRMDILEELENAI 530

Query:   585 DFGDLETRHVSQLQREFNENDYEMLLALDENNHQ-SGASANQINSLPLSTVQTDNFEEAC 643
                 + + ++  + R+F E+DYE+LLALDENNH+  GASAN+IN+LP STVQTDNF+E C
Sbjct:   531 GHS-ITSSNLLHMDRDFTEDDYELLLALDENNHRHGGASANRINNLPESTVQTDNFQETC 589

Query:   644 AICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 688
              ICL+ P IGD+IRHLPCLHKFHKDCIDPWL R  SCPVCKSS+T
Sbjct:   590 VICLETPKIGDTIRHLPCLHKFHKDCIDPWLGRSKSCPVCKSSVT 634
GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0006635 "fatty acid beta-oxidation" evidence=RCA
GO:0016558 "protein import into peroxisome matrix" evidence=RCA
DICTYBASE|DDB_G0282479 DDB_G0282479 "E3 ubiquitin-protein ligase DMA2" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLM9 LOC100519887 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359698 Rnf181 "ring finger protein 181" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AXU4 Rnf181 "E3 ubiquitin-protein ligase RNF181" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-608 si:ch211-81a5.1 "si:ch211-81a5.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0W3 RNF181 "E3 ubiquitin-protein ligase RNF181" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUN1 RNF181 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
TAIR|locus:2050522 AT2G44330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1SVB7 RNF181 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
eugene3.00031458
hypothetical protein (740 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-16
cd0016245 cd00162, RING, RING-finger (Really Interesting New 6e-13
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-09
smart0018440 smart00184, RING, Ring finger 1e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-09
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 4e-08
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 1e-05
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 4e-05
COG52191525 COG5219, COG5219, Uncharacterized conserved protei 3e-04
smart0074449 smart00744, RINGv, The RING-variant domain is a C4 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 72.4 bits (178), Expect = 3e-16
 Identities = 20/44 (45%), Positives = 28/44 (63%)

Query: 643 CAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSS 686
           C ICLD    G+ +  LPC H FHK+C+D WL    +CP+C++ 
Sbjct: 3   CPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227544 COG5219, COG5219, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|128983 smart00744, RINGv, The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 688
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.47
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.38
PHA02929238 N1R/p28-like protein; Provisional 99.1
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.08
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.07
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.93
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.8
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.77
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 98.75
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.73
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.7
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.67
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.64
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.6
PHA02926242 zinc finger-like protein; Provisional 98.51
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.5
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.49
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.49
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.46
PF1463444 zf-RING_5: zinc-RING finger domain 98.42
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.41
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.4
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.2
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.16
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.1
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.1
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.98
COG52191525 Uncharacterized conserved protein, contains RING Z 97.95
KOG149384 consensus Anaphase-promoting complex (APC), subuni 97.93
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 97.92
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.89
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 97.82
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.8
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.69
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 97.58
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.54
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.48
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.36
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.29
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 96.82
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 96.81
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.74
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 96.44
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 96.41
KOG1941 518 consensus Acetylcholine receptor-associated protei 96.39
KOG0297 391 consensus TNF receptor-associated factor [Signal t 96.34
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.19
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 96.16
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.1
KOG2660 331 consensus Locus-specific chromosome binding protei 95.85
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.59
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.49
KOG1002 791 consensus Nucleotide excision repair protein RAD16 95.3
COG5152259 Uncharacterized conserved protein, contains RING a 95.24
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 94.92
PHA03096284 p28-like protein; Provisional 94.56
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 94.53
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 94.06
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.06
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 93.98
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 93.89
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 93.8
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.72
COG5222 427 Uncharacterized conserved protein, contains RING Z 93.6
PF04641260 Rtf2: Rtf2 RING-finger 93.56
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 93.35
PF15295132 CCDC50_N: Coiled-coil domain-containing protein 50 92.89
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 92.36
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 92.28
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 92.19
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 92.0
PHA02825 162 LAP/PHD finger-like protein; Provisional 91.24
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 90.69
COG5236 493 Uncharacterized conserved protein, contains RING Z 90.62
KOG3002 299 consensus Zn finger protein [General function pred 90.39
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 90.37
COG5175 480 MOT2 Transcriptional repressor [Transcription] 90.17
KOG1940276 consensus Zn-finger protein [General function pred 90.15
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.94
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.07
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 89.0
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.05
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 87.92
KOG0298 1394 consensus DEAD box-containing helicase-like transc 86.57
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 84.65
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 83.44
KOG03091081 consensus Conserved WD40 repeat-containing protein 82.91
KOG1609 323 consensus Protein involved in mRNA turnover and st 82.33
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.47  E-value=1.9e-14  Score=153.01  Aligned_cols=71  Identities=44%  Similarity=0.947  Sum_probs=62.4

Q ss_pred             CCCCCCHHHHhcCCccccccCCCCC---ccccccCCCCCCCceEEeccCCccchhhHHHHHhcCC-CCCccccCC
Q 005612          617 HQSGASANQINSLPLSTVQTDNFEE---ACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRP-SCPVCKSSI  687 (688)
Q Consensus       617 ~~~GaSke~I~sLP~~~is~~~~de---eC~ICLEeF~~Gd~Vr~LPCgHvFH~sCI~~WLk~k~-SCPVCR~~L  687 (688)
                      ....+.+..+.++|..++.....+.   .|+||||+|..|++++.|||+|.||..||++||.... .||+|+.++
T Consensus       203 ~~~r~~k~~l~~~p~~~f~~~~~~~~~~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di  277 (348)
T KOG4628|consen  203 RRNRLIKRLLKKLPVRTFTKGDDEDATDTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDI  277 (348)
T ss_pred             hhhhhHHHHHhhCCcEEeccccccCCCceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcC
Confidence            3457889999999999987765544   9999999999999999999999999999999999875 599999865

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15295 CCDC50_N: Coiled-coil domain-containing protein 50 N-terminus Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 4e-09
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 1e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 2e-07
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 3e-06
1chc_A68 Structure Of The C3hc4 Domain By 1h-Nuclear Magneti 3e-06
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 3e-06
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 1e-04
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 2e-04
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 33/46 (71%)
Query: 643 CAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLSRRPSCPVCKSSIT 688
           C +C ++ ++G+S+R LPC H FH  CI PWL +  SCPVC+ S+T
Sbjct: 18  CPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCPVCRKSLT 63
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|1CHC|A Chain A, Structure Of The C3hc4 Domain By 1h-Nuclear Magnetic Resonance Spectroscopy; A New Structural Class Of Zinc- Finger Length = 68 Back     alignment and structure
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query688
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-23
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-22
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 4e-22
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 1e-20
2ect_A78 Ring finger protein 126; metal binding protein, st 1e-19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-17
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-17
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 4e-17
2ecm_A55 Ring finger and CHY zinc finger domain- containing 4e-16
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-13
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-13
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-12
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 1e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-09
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 9e-08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 8e-07
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 9e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 2e-06
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 3e-06
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 9e-06
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 2e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 3e-05
3nw0_A238 Non-structural maintenance of chromosomes element 6e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 9e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-04
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 1e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 2e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 3e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 3e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 4e-04
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 4e-04
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
 Score = 94.3 bits (235), Expect = 1e-23
 Identities = 27/72 (37%), Positives = 34/72 (47%), Gaps = 4/72 (5%)

Query: 620 GASANQINSLPLSTVQTDNF----EEACAICLDNPSIGDSIRHLPCLHKFHKDCIDPWLS 675
            AS   I++LP   V  D+     E  C IC      GD    LPC H FHK C+  WL 
Sbjct: 16  PASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQ 75

Query: 676 RRPSCPVCKSSI 687
           +  +CPVC+   
Sbjct: 76  KSGTCPVCRCMF 87
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 688
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-14
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 5e-12
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-11
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-09
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 9e-09
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 5e-08
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 6e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-05
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 8e-05
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 4e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 71.4 bits (175), Expect = 2e-16
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 643 CAICLDNPSIGDSIRHLP-CLHKFHKDCIDPWLSRRPSCPVCKSSIT 688
           CA+CL     G+  R LP C H FH +C+D WL    +CP+C+ ++ 
Sbjct: 8   CAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query688
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.39
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.24
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.24
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.22
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.14
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.04
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.97
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.93
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.82
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.7
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.65
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.61
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.59
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.58
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.57
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.08
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 85.23
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 80.52
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.39  E-value=1e-13  Score=101.54  Aligned_cols=49  Identities=39%  Similarity=1.003  Sum_probs=45.4

Q ss_pred             CCCCCCCCCCCCCCCCCEEEEC-CCCCCCHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             8883432268888999509915-479013451999883499997556679
Q 005612          639 FEEACAICLDNPSIGDSIRHLP-CLHKFHKDCIDPWLSRRPSCPVCKSSI  687 (688)
Q Consensus       639 ~deeCsICLEefe~Ge~VrvLP-C~HiFHkeCI~~WL~rkkTCPVCR~~I  687 (688)
                      ++.+|+|||++|..++.++.+| |+|.||..||.+||..+.+||+||.+|
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i   53 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTV   53 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCS
T ss_pred             CCCCCEEECCCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCCEE
T ss_conf             99998497900107988999089898105999999998499387889784
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure