Citrus Sinensis ID: 005631

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS
cHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHcccccccCCccccccCCcccccccccHHccccccccccccccccHHHHHHHHcccccccccccccHHHccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEcccccccccccccc
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR*************************************************************************SPSDQLAECPDSTCAQVIHSNAEITGSRRVP***************************************************************************************************************************************************TIQDDRNVLRRSDSSA*****************************************************************************************************************************************************************************************************************************************************************RQK*T**CFRKKVRYQS*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Two-component response regulator-like APRR7 Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.probableQ93WK5
Two-component response regulator-like PRR73 Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of PRR73, PRR37, PRR95, PRR59 and PPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.probableQ10N34

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W25, chain A
Confidence level:very confident
Coverage over the Query: 5-116
View the alignment between query and template
View the model in PyMOL
Template: 3EQ2, chain A
Confidence level:very confident
Coverage over the Query: 4-171
View the alignment between query and template
View the model in PyMOL
Template: 1NY5, chain A
Confidence level:confident
Coverage over the Query: 4-143,161-243
View the alignment between query and template
View the model in PyMOL
Template: 3OGL, chain Q
Confidence level:probable
Coverage over the Query: 629-639
View the alignment between query and template
View the model in PyMOL