Citrus Sinensis ID: 005631

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS
cHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHccccccEEccccccEEccccccccHHHHcccccccccccccccHHHHHHHHcccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccEEEcccccccccccccc
cHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccccEEEEcccccccHHHHHHHHHHccccccccEEEEEccccccHHHHHHHccHHHEEEcHccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccHHHccccccccccEEEcccccccccccccccccccccHccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHccccccccccccccccccccccccccccEEEEcEccccccccccccHHHHHHHccccccHcEEccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHHHccccccEEEEEEcccccccccccc
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMshktrknlpvIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRrchsssgsgsesctqTQKSiksknvensgnntgsndednngsigvnggdgsddgsgtqsswtkkavevdsprhmspsdqlaecpdstcaqvihsnaeitgsrrvpvtaakECQDHEERCENFAKrsrdldvggqrsLDLQLeyqtespiklvgtkktnrldlgssklseqidrgqldlnsespsskLKYEAAKLAGAITKIidsdkedteyeasnkpskildinsksikdskelpsLELSLKRLRgvkdigttiqddrnvlrrsdssafsryntasnvnkgpggnieSASQVVNSLEIIKkgsdcgiqshsngdplnqssnggsnnmdmgsttnnafikpaglknksevsstvnclhsssfqptkndllcsprqvlldkrddLVASSvlvhprstqeqLTQHYDNCHHLVHnmqqqhlphdhdqLSLKKMAEavpqcgssnmlggfvegnagnysingsasgsnhgsngqngsstavnaggmnvesdngiagksgsggasgsgsgsgnridknkfaDREAAVTKYRQKKTERCFRKKVRYQSRKRLAeqrprirgqFVRQTanentsrepecs
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHsssgsgsesctqtqksiksknvensgnntgsndednnGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHsnaeitgsrrvpVTAAKECQDHEERCenfakrsrdldvggQRSLDLQleyqtespiklvgtkktnrldlgssklseqidrgqldlnsespssKLKYEAAKLAGAITKiidsdkedteyeasnkpskildinsksikdskelpslelslkrlrgvkdigttiqddrnvlrrsdssafsryntasnvnkgpggniESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHsssfqptkndllCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNgiagksgsggasgsgsgsgnridknkfadreaavtkyrqkktercfrkkvryqsrkrlaeqrprirgqfvrqtanentsrepecs
mmillamllllCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHsssgsgsesCTQTQKSIKSKNVENSGNNTGSNDEdnngsigvnggdgsddgsgTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSkelpslelslkrlrGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMqqqhlphdhdqlSLKKMAEAVPQCGSSNMLGGFVEGNAGNYsingsasgsnhgsngqngssTAVNAGGMNVESDNgiagksgsggasgsgsgsgNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS
**ILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRC**************************************************************************************************************************************************************************************************AIT************************************************************************************************************************************************************************LLCSPRQVLLDKRDDLVASSVLVH*******LTQHYDNCHHLVHN*****************************************************************************************************************************************************************
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVW***************************************************************************SPSDQLAECPDSTCAQVIHSNAEITGSRRVP***************************************************************************************************************************************************TIQDDRNVLRRSDSSA*****************************************************************************************************************************************************************************************************************************************************************RQK*T**CFRKKVRYQS*******************************
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR**********************NVENSGNNTGSNDEDNNGSIGVNGG***********************************PDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSD**********KPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGL***********CLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSA***********GSSTAVNAGGMNVESDNGIAG***************NRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVR**************
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCH*********************************************************************HMSPSDQLAECPDSTCAQVIHSNAEITGSRRVP**************ENFAKRSRDLDV*G********************************************************************ID*****************************ELPSLELSLKRLRG*****TTIQDDRNVLRRSDSSAFSRYNTAS**********************************************************************************************************************************************************************************************************************************************FADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTA***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGIQSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDNCHHLVHNMQQQHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHGSNGQNGSSTAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQTANENTSREPECS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query687 2.2.26 [Sep-21-2011]
Q93WK5727 Two-component response re yes no 0.883 0.834 0.534 1e-149
Q10N34767 Two-component response re yes no 0.953 0.853 0.473 1e-134
A2XFB7767 Two-component response re N/A no 0.953 0.853 0.473 1e-134
A2YQ93742 Two-component response re N/A no 0.914 0.846 0.486 1e-125
Q0D3B6742 Two-component response re no no 0.918 0.850 0.487 1e-124
Q9LVG4495 Two-component response re no no 0.509 0.707 0.404 8e-55
Q689G6623 Two-component response re no no 0.250 0.276 0.442 3e-33
Q8L500468 Two-component response re no no 0.155 0.228 0.508 3e-31
Q6LA42558 Two-component response re no no 0.237 0.292 0.409 6e-30
Q9LKL2618 Two-component response re no no 0.109 0.121 0.5 2e-16
>sp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana GN=APRR7 PE=2 SV=1 Back     alignment and function desciption
 Score =  528 bits (1361), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 369/691 (53%), Positives = 457/691 (66%), Gaps = 84/691 (12%)

Query: 2   MILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSK 60
            I+ A+L    +E+       EA+NG+QAWK+LEDL NHID+VLTEV MP LSG+ LL K
Sbjct: 91  YIVTALLRNCSYEVV------EASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCK 144

Query: 61  IMSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSS 120
           I++HK+R+N+PVIMMSS DSMGLVFKCLSKGAVDFLVKPIRKNELK LWQHVWRRC SSS
Sbjct: 145 ILNHKSRRNIPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSS 204

Query: 121 GSGSESCT-QTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKA 179
           GSGSES T QTQKS+KSK+++ S  ++GS+DE+ NGSIG+N  DGS DGSG QSSWTKKA
Sbjct: 205 GSGSESGTHQTQKSVKSKSIKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKA 264

Query: 180 VEVD-SPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAK 238
           V+VD SPR +S  D++    DSTCAQV+HSN E   ++ V   A KE Q+H+++ E+   
Sbjct: 265 VDVDDSPRAVSLWDRV----DSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTM 320

Query: 239 RSRDLDVGGQRSLDLQLEYQTESPIKLVGT-KKTNRLDLGSSKLSEQIDRGQLDLNSESP 297
             RDL++  +R+ DL LE + E   K  G  ++ N  +  SSK   ++ +G LDL+SESP
Sbjct: 321 -GRDLEISIRRNCDLALEPKDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESP 379

Query: 298 SSKLKYEAAKLAGAITKIIDSDKEDT-EYEASNKPSKILDINSKSIKDSKELPSLELSLK 356
           SSK  +E     G+  K + S  +D  E EA N   K LD N  S+K S+EL  +E S K
Sbjct: 380 SSKQMHEDG---GSSFKAMSSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSK 436

Query: 357 RLRGVKDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESAS-QVVNSLEIIKK 415
           R RG KD GT ++DDRNVLRRS+ SAFSRYN ASN NK  GGN+ S S Q  NS ++IKK
Sbjct: 437 RHRGTKDDGTLVRDDRNVLRRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKK 496

Query: 416 GSDCGIQSHSNGD---PLNQSSNGGSNNMDMGSTT-NNAFIKPAGLKNKSEVSSTVNCLH 471
            ++     HSN +   P N  S+ GSNN DM STT NNAF KP   K  S  SS+V    
Sbjct: 497 -TEAAYDCHSNMNESLPHNHRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVK--- 552

Query: 472 SSSFQPTKNDLLCSPRQVLLDKRDDLVASSVLVHPRSTQEQLTQHYDN--CHHLVHNMQQ 529
            SSFQP    L C                               H++N   ++LVH  ++
Sbjct: 553 HSSFQP----LPC------------------------------DHHNNHASYNLVHVAER 578

Query: 530 QHLPHDHDQLSLKKMAEAVPQCGSSNMLGGFVEGNAG--NYSINGSASGSNHGSNGQNGS 587
           + LP               PQCGSSN+    +EGN    NYS+NGS SGS HGSNG  GS
Sbjct: 579 KKLP---------------PQCGSSNVYNETIEGNNNTVNYSVNGSVSGSGHGSNGPYGS 623

Query: 588 STAVNAGGMNVESDNGIAGKSGSGGASGSGSGSGNR--IDKNKFADREAAVTKYRQKKTE 645
           S  +NAGGMN+ SDNG AGK+G+G  SGSGSGSG+    D+NK + REAA+TK+RQK+ E
Sbjct: 624 SNGMNAGGMNMGSDNG-AGKNGNGDGSGSGSGSGSGNLADENKISQREAALTKFRQKRKE 682

Query: 646 RCFRKKVRYQSRKRLAEQRPRIRGQFVRQTA 676
           RCFRKKVRYQSRK+LAEQRPR+RGQFVR+TA
Sbjct: 683 RCFRKKVRYQSRKKLAEQRPRVRGQFVRKTA 713
Controls photoperiodic flowering response. Seems to be one of the component of the circadian clock. Expression of several members of the ARR-like family is controlled by circadian rhythm. The particular coordinated sequential expression of APRR9, APRR7, APRR5, APRR3 and APPR1 result to circadian waves that may be at the basis of the endogenous circadian clock.
Arabidopsis thaliana (taxid: 3702)
>sp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR73 OS=Oryza sativa subsp. japonica GN=PRR73 PE=2 SV=1 Back     alignment and function description
>sp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR73 OS=Oryza sativa subsp. indica GN=PRR73 PE=2 SV=2 Back     alignment and function description
>sp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR37 OS=Oryza sativa subsp. indica GN=PRR37 PE=2 SV=2 Back     alignment and function description
>sp|Q0D3B6|PRR37_ORYSJ Two-component response regulator-like PRR37 OS=Oryza sativa subsp. japonica GN=PRR37 PE=2 SV=1 Back     alignment and function description
>sp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR3 OS=Arabidopsis thaliana GN=APRR3 PE=1 SV=1 Back     alignment and function description
>sp|Q689G6|PRR95_ORYSJ Two-component response regulator-like PRR95 OS=Oryza sativa subsp. japonica GN=PRR95 PE=2 SV=1 Back     alignment and function description
>sp|Q8L500|APRR9_ARATH Two-component response regulator-like APRR9 OS=Arabidopsis thaliana GN=APRR9 PE=2 SV=2 Back     alignment and function description
>sp|Q6LA42|APRR5_ARATH Two-component response regulator-like APRR5 OS=Arabidopsis thaliana GN=APRR5 PE=1 SV=2 Back     alignment and function description
>sp|Q9LKL2|APRR1_ARATH Two-component response regulator-like APRR1 OS=Arabidopsis thaliana GN=APRR1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
255568450762 sensory transduction histidine kinase, p 0.946 0.853 0.621 0.0
449524812 794 PREDICTED: two-component response regula 0.965 0.835 0.602 0.0
449448936 797 PREDICTED: two-component response regula 0.954 0.823 0.605 0.0
356545957749 PREDICTED: two-component response regula 0.928 0.851 0.595 0.0
356536913747 PREDICTED: two-component response regula 0.930 0.855 0.600 0.0
225435163785 PREDICTED: two-component response regula 0.943 0.825 0.540 1e-176
157399678784 pseudo-response regulator 7 [Castanea sa 0.946 0.829 0.540 1e-173
224098134711 predicted protein [Populus trichocarpa] 0.912 0.881 0.529 1e-169
224098126766 pseudo response regulator [Populus trich 0.912 0.818 0.529 1e-169
255582079 807 sensory transduction histidine kinase, p 0.973 0.828 0.511 1e-162
>gi|255568450|ref|XP_002525199.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223535496|gb|EEF37165.1| sensory transduction histidine kinase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  785 bits (2027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/693 (62%), Positives = 518/693 (74%), Gaps = 43/693 (6%)

Query: 3   ILLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKI 61
           ++ A+L    +E+       EATNGLQAW+ILEDLTN IDLVLTEV MPCLSG+ LL KI
Sbjct: 102 VVTALLRNCSYEV------IEATNGLQAWRILEDLTNQIDLVLTEVVMPCLSGIGLLYKI 155

Query: 62  MSHKTRKNLPVIMMSSLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSG 121
           MSHKTRKN+PVIMMSS DSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSG
Sbjct: 156 MSHKTRKNVPVIMMSSHDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSG 215

Query: 122 SGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGGDGSDDGSGTQSSWTKKAVE 181
           SGSES T+TQKS+KSK+VE SGN+TGS+DED+NGSIG+N GDGSD+GSGTQSSWTK+AVE
Sbjct: 216 SGSESGTETQKSVKSKSVEKSGNDTGSSDEDDNGSIGLNVGDGSDNGSGTQSSWTKQAVE 275

Query: 182 VDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSR 241
           VDSPR +SP DQ+AECPDSTCAQVIHSNAE++G+++ P+  AKEC++ EE+ ++ A +  
Sbjct: 276 VDSPRPVSPMDQVAECPDSTCAQVIHSNAEVSGTKQTPIITAKECEEQEEQLDSAAAKDL 335

Query: 242 DLDVGGQRSLDLQLEYQTESPIKLVGTKKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKL 301
           +  V G  ++DLQLE Q   PIK VGTK+ N L+ GS    E+ID+ QLD NSE+PSSK 
Sbjct: 336 EKVVPG--NVDLQLECQVADPIKFVGTKQKNLLERGSGNYKEKIDKEQLDQNSENPSSKS 393

Query: 302 KYEAAKLAGAITKIIDSDKEDTEYEASNKPSKILDINSKSIKDSKELPSLELSLKRLRGV 361
           +YEAA L G  T  ID   + TE EA+N+   ILDI +K   D+KE+P+ ELSLKR RG 
Sbjct: 394 RYEAANLTGFTTNTIDPHMDSTEIEATNRHCNILDIKNKPSNDAKEIPTFELSLKRNRGA 453

Query: 362 KDIGTTIQDDRNVLRRSDSSAFSRYNTASNVNKGPGGNIESASQVVNSLEIIKKGSDCGI 421
           KD+GT +Q+DRNVLRRSDSSAFSRYN +SN  K P  N+ S S   +SL++ +KG+ C +
Sbjct: 454 KDVGTVVQEDRNVLRRSDSSAFSRYNASSNAKKAPCANMTSGSHYGSSLDVTEKGTVCDL 513

Query: 422 QSHSNGDPLNQSSNGGSNNMDMGSTTNNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKND 481
           +SHSN +  N  SN GSNN+DMGSTTN+A  K   LKNKS           S+FQ  ++D
Sbjct: 514 KSHSNSNLPNHCSNVGSNNIDMGSTTNHAITKSVVLKNKSGHP-------PSTFQAMRDD 566

Query: 482 LLCSPRQVLLDKRDDLVASSVLVHPRSTQEQL-----TQHYDNCHHLVHNMQQQHLPHDH 536
            LC+ +Q+L +K DD   + +L  P  +  +      T HY++ HHL HNMQ        
Sbjct: 567 PLCATQQILKEKADDTAGAMLLAQPGGSLSECKIQHQTHHYNHYHHLPHNMQTAQ----- 621

Query: 537 DQLSLKKMAEAVPQCGSSNMLGGFVEGNAGNYSINGSASGSNHG----SNGQNGSSTAVN 592
                    ++VP CGSSN+LGG +EGN GNYSINGSASGSNHG    SNGQNGSSTAVN
Sbjct: 622 ---------QSVPHCGSSNVLGGPLEGNGGNYSINGSASGSNHGSNHVSNGQNGSSTAVN 672

Query: 593 AGGMNVESDNGIAGKSGSGGASGSGSGSGNRIDKNKFADREAAVTKYRQKKTERCFRKKV 652
           AGG NVESDNGI GKS     SG GSG GNR D+NKF+ RE A+TK+RQK+ ERCFRKKV
Sbjct: 673 AGGTNVESDNGIGGKS----GSGDGSGEGNRGDQNKFSQREVALTKFRQKRKERCFRKKV 728

Query: 653 RYQSRKRLAEQRPRIRGQFVRQTANENTSREPE 685
           RYQSRKRLAEQRPR+RGQFVRQT N +TS+  E
Sbjct: 729 RYQSRKRLAEQRPRVRGQFVRQTGNGSTSKASE 761

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449524812|ref|XP_004169415.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449448936|ref|XP_004142221.1| PREDICTED: two-component response regulator-like APRR7-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356545957|ref|XP_003541399.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] Back     alignment and taxonomy information
>gi|356536913|ref|XP_003536977.1| PREDICTED: two-component response regulator-like APRR7-like [Glycine max] Back     alignment and taxonomy information
>gi|225435163|ref|XP_002281776.1| PREDICTED: two-component response regulator-like PRR73-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|157399678|gb|ABV53463.1| pseudo-response regulator 7 [Castanea sativa] Back     alignment and taxonomy information
>gi|224098134|ref|XP_002311124.1| predicted protein [Populus trichocarpa] gi|222850944|gb|EEE88491.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098126|ref|XP_002311123.1| pseudo response regulator [Populus trichocarpa] gi|222850943|gb|EEE88490.1| pseudo response regulator [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255582079|ref|XP_002531836.1| sensory transduction histidine kinase, putative [Ricinus communis] gi|223528532|gb|EEF30556.1| sensory transduction histidine kinase, putative [Ricinus communis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
TAIR|locus:2151206727 PRR7 "pseudo-response regulato 0.653 0.617 0.505 1.8e-103
TAIR|locus:2044376468 PRR9 "pseudo-response regulato 0.139 0.205 0.571 4.3e-43
TAIR|locus:2163198618 TOC1 "TIMING OF CAB EXPRESSION 0.109 0.121 0.5 7.1e-26
TAIR|locus:2062749183 AT2G46670 "AT2G46670" [Arabido 0.074 0.278 0.653 3.1e-14
TAIR|locus:2093668690 RR1 "response regulator 1" [Ar 0.133 0.133 0.395 1.6e-09
UNIPROTKB|Q4GZK8131 rr3 "Type A response regulator 0.132 0.694 0.322 1.8e-09
TAIR|locus:2130095664 RR2 "response regulator 2" [Ar 0.133 0.138 0.406 2.6e-09
UNIPROTKB|Q4GZK2201 rr9 "Type A response regulator 0.157 0.537 0.300 8.6e-09
TAIR|locus:2040194596 RR12 "response regulator 12" [ 0.132 0.152 0.389 9.6e-09
TAIR|locus:2116587552 RR10 "response regulator 10" [ 0.128 0.159 0.419 2.3e-08
TAIR|locus:2151206 PRR7 "pseudo-response regulator 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1025 (365.9 bits), Expect = 1.8e-103, P = 1.8e-103
 Identities = 238/471 (50%), Positives = 296/471 (62%)

Query:    21 ITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMSSLD 79
             + EA+NG+QAWK+LEDL NHID+VLTEV MP LSG+ LL KI++HK+R+N+PVIMMSS D
Sbjct:   104 VVEASNGIQAWKVLEDLNNHIDIVLTEVIMPYLSGIGLLCKILNHKSRRNIPVIMMSSHD 163

Query:    80 SMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHXXXXXXXXXCT-QTQKSIKSKN 138
             SMGLVFKCLSKGAVDFLVKPIRKNELK LWQHVWRRC           T QTQKS+KSK+
Sbjct:   164 SMGLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCQSSSGSGSESGTHQTQKSVKSKS 223

Query:   139 VENSGNNTGSNDEXXXXXXXXXXXXXXXXXXXTQSSWTKKAVEVD-SPRHMSPSDQLAEC 197
             ++ S  ++GS+DE                    QSSWTKKAV+VD SPR +S  D++   
Sbjct:   224 IKKSDQDSGSSDENENGSIGLNASDGSSDGSGAQSSWTKKAVDVDDSPRAVSLWDRV--- 280

Query:   198 PDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRDLDVGGQRSLDLQLEY 257
              DSTCAQV+HSN E   ++ V   A KE Q+H+++ E+     RDL++  +R+ DL LE 
Sbjct:   281 -DSTCAQVVHSNPEFPSNQLVAPPAEKETQEHDDKFEDVTM-GRDLEISIRRNCDLALEP 338

Query:   258 QTESPIKLVGT-KKTNRLDLGSSKLSEQIDRGQLDLNSESPSSKLKYEAAKLAGAITKII 316
             + E   K  G  ++ N  +  SSK   ++ +G LDL+SESPSSK  +E     G+  K +
Sbjct:   339 KDEPLSKTTGIMRQDNSFEKSSSKWKMKVGKGPLDLSSESPSSKQMHEDG---GSSFKAM 395

Query:   317 DSDKEDT-EYEASNKPSKILDINSKSIKDSXXXXXXXXXXXXXXGVKDIGTTIQDDRNVL 375
              S  +D  E EA N   K LD N  S+K S              G KD GT ++DDRNVL
Sbjct:   396 SSHLQDNREPEAPNTHLKTLDTNEASVKISEELMHVEHSSKRHRGTKDDGTLVRDDRNVL 455

Query:   376 RRSDSSAFSRYNTASNVNKGPGGNIESAS-QVVNSLEIIKKGSDCGIQSHSNGD---PLN 431
             RRS+ SAFSRYN ASN NK  GGN+ S S Q  NS ++IKK ++     HSN +   P N
Sbjct:   456 RRSEGSAFSRYNPASNANKISGGNLGSTSLQDNNSQDLIKK-TEAAYDCHSNMNESLPHN 514

Query:   432 QSSNGGSNNMDMGSTT-NNAFIKPAGLKNKSEVSSTVNCLHSSSFQPTKND 481
               S+ GSNN DM STT NNAF KP   K  S  SS+V   HSS FQP   D
Sbjct:   515 HRSHVGSNNFDMSSTTENNAFTKPGAPKVSSAGSSSVK--HSS-FQPLPCD 562
GO:0000156 "phosphorelay response regulator activity" evidence=IEA;ISS
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IDA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA;TAS
GO:0007623 "circadian rhythm" evidence=IMP;TAS
GO:0010017 "red or far-red light signaling pathway" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
GO:0009266 "response to temperature stimulus" evidence=IGI
GO:0003677 "DNA binding" evidence=IPI
GO:0045892 "negative regulation of transcription, DNA-dependent" evidence=IDA
GO:0009639 "response to red or far red light" evidence=RCA
GO:0042752 "regulation of circadian rhythm" evidence=RCA
GO:0048574 "long-day photoperiodism, flowering" evidence=RCA
TAIR|locus:2044376 PRR9 "pseudo-response regulator 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2163198 TOC1 "TIMING OF CAB EXPRESSION 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2062749 AT2G46670 "AT2G46670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093668 RR1 "response regulator 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZK8 rr3 "Type A response regulator 3" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2130095 RR2 "response regulator 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q4GZK2 rr9 "Type A response regulator 9" [Oryza sativa Indica Group (taxid:39946)] Back     alignment and assigned GO terms
TAIR|locus:2040194 RR12 "response regulator 12" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2116587 RR10 "response regulator 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q93WK5APRR7_ARATHNo assigned EC number0.53400.88350.8349yesno
Q10N34PRR73_ORYSJNo assigned EC number0.47350.95340.8539yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00024444001
SubName- Full=Chromosome chr6 scaffold_3, whole genome shotgun sequence; (719 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
pfam0620345 pfam06203, CCT, CCT motif 1e-19
cd00156113 cd00156, REC, Signal receiver domain; originally t 6e-18
pfam00072111 pfam00072, Response_reg, Response regulator receiv 9e-18
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal tra 1e-14
PRK00742354 PRK00742, PRK00742, chemotaxis-specific methyleste 8e-11
COG3706435 COG3706, PleD, Response regulator containing a Che 9e-11
COG2204464 COG2204, AtoC, Response regulator containing CheY- 2e-10
COG2197211 COG2197, CitB, Response regulator containing a Che 6e-10
COG0745229 COG0745, OmpR, Response regulators consisting of a 4e-09
COG4753475 COG4753, COG4753, Response regulator containing Ch 5e-08
PRK09581457 PRK09581, pleD, response regulator PleD; Reviewed 6e-08
COG2201350 COG2201, CheB, Chemotaxis response regulator conta 2e-07
PLN03029222 PLN03029, PLN03029, type-a response regulator prot 4e-07
COG3437360 COG3437, COG3437, Response regulator containing a 1e-06
PRK10693303 PRK10693, PRK10693, response regulator of RpoS; Pr 1e-06
TIGR01818463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 5e-06
CHL00148240 CHL00148, orf27, Ycf27; Reviewed 6e-06
TIGR02875262 TIGR02875, spore_0_A, sporulation transcription fa 1e-05
PRK11361457 PRK11361, PRK11361, acetoacetate metabolism regula 3e-05
TIGR02154226 TIGR02154, PhoB, phosphate regulon transcriptional 4e-05
PRK10365441 PRK10365, PRK10365, transcriptional regulatory pro 5e-05
PRK10430239 PRK10430, PRK10430, DNA-binding transcriptional ac 5e-05
PRK12555337 PRK12555, PRK12555, chemotaxis-specific methyleste 2e-04
COG4566202 COG4566, TtrR, Response regulator [Signal transduc 2e-04
COG4565224 COG4565, CitB, Response regulator of citrate/malat 3e-04
PRK10955232 PRK10955, PRK10955, DNA-binding transcriptional re 4e-04
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provision 0.001
PRK09836227 PRK09836, PRK09836, DNA-binding transcriptional ac 0.002
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response re 0.002
PRK15479221 PRK15479, PRK15479, transcriptional regulatory pro 0.003
PRK15115444 PRK15115, PRK15115, response regulator GlrR; Provi 0.004
>gnl|CDD|203407 pfam06203, CCT, CCT motif Back     alignment and domain information 
 Score = 82.3 bits (204), Expect = 1e-19
 Identities = 24/44 (54%), Positives = 36/44 (81%)

Query: 632 REAAVTKYRQKKTERCFRKKVRYQSRKRLAEQRPRIRGQFVRQT 675
           REAA+ +Y++K+  R F KK+RY SRK +AE RPR++G+FV+Q+
Sbjct: 1   REAALLRYKEKRKTRKFDKKIRYASRKAVAESRPRVKGRFVKQS 44

This short motif is found in a number of plant proteins. It is rich in basic amino acids and has been called a CCT motif after Co, Col and Toc1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif. Toc1 mutants have been identified in this region. Length = 45
>gnl|CDD|238088 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|200976 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|223855 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234828 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|226229 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225114 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|225107 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|223816 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|227095 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|236577 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|225111 COG2201, CheB, Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215544 PLN03029, PLN03029, type-a response regulator protein; Provisional Back     alignment and domain information
>gnl|CDD|225971 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|233585 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|214376 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|182454 PRK10430, PRK10430, DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>gnl|CDD|237135 PRK12555, PRK12555, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|226932 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|226931 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 687
COG2204464 AtoC Response regulator containing CheY-like recei 100.0
PRK10923469 glnG nitrogen regulation protein NR(I); Provisiona 99.92
TIGR02915445 PEP_resp_reg putative PEP-CTERM system response re 99.92
PRK11361457 acetoacetate metabolism regulatory protein AtoC; P 99.91
PRK15115444 response regulator GlrR; Provisional 99.91
TIGR01818463 ntrC nitrogen regulation protein NR(I). This model 99.9
PRK10365441 transcriptional regulatory protein ZraR; Provision 99.89
COG0745229 OmpR Response regulators consisting of a CheY-like 99.75
COG3604550 FhlA Transcriptional regulator containing GAF, AAA 99.74
COG3829560 RocR Transcriptional regulator containing PAS, AAA 99.72
PF0620345 CCT: CCT motif; InterPro: IPR010402 The CCT (CONST 99.72
COG4566202 TtrR Response regulator [Signal transduction mecha 99.7
COG4753475 Response regulator containing CheY-like receiver d 99.68
COG4565224 CitB Response regulator of citrate/malate metaboli 99.67
PF00072112 Response_reg: Response regulator receiver domain; 99.62
PRK15424538 propionate catabolism operon regulatory protein Pr 99.54
COG2197211 CitB Response regulator containing a CheY-like rec 99.52
COG3437360 Response regulator containing a CheY-like receiver 99.5
PRK10046225 dpiA two-component response regulator DpiA; Provis 99.48
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 99.47
COG3706435 PleD Response regulator containing a CheY-like rec 99.46
PRK10693303 response regulator of RpoS; Provisional 99.46
TIGR02329526 propionate_PrpR propionate catabolism operon regul 99.45
COG0784130 CheY FOG: CheY-like receiver [Signal transduction 99.45
PLN03029222 type-a response regulator protein; Provisional 99.41
PRK10816223 DNA-binding transcriptional regulator PhoP; Provis 99.41
PRK10529225 DNA-binding transcriptional activator KdpE; Provis 99.41
PRK11173237 two-component response regulator; Provisional 99.41
COG4567182 Response regulator consisting of a CheY-like recei 99.4
PRK09836227 DNA-binding transcriptional activator CusR; Provis 99.4
PRK10766221 DNA-binding transcriptional regulator TorR; Provis 99.39
PRK10643222 DNA-binding transcriptional regulator BasR; Provis 99.39
PRK10161229 transcriptional regulator PhoB; Provisional 99.38
TIGR02154226 PhoB phosphate regulon transcriptional regulatory 99.37
PRK09468239 ompR osmolarity response regulator; Provisional 99.37
PRK10430239 DNA-binding transcriptional activator DcuR; Provis 99.36
PRK10336219 DNA-binding transcriptional regulator QseB; Provis 99.36
TIGR03787227 marine_sort_RR proteobacterial dedicated sortase s 99.35
COG3947361 Response regulator containing CheY-like receiver a 99.35
PRK10701240 DNA-binding transcriptional regulator RstA; Provis 99.34
PRK11475207 DNA-binding transcriptional activator BglJ; Provis 99.34
TIGR01387218 cztR_silR_copR heavy metal response regulator. Mem 99.34
PRK13856241 two-component response regulator VirG; Provisional 99.34
PRK12555337 chemotaxis-specific methylesterase; Provisional 99.33
COG3283511 TyrR Transcriptional regulator of aromatic amino a 99.32
PRK11083228 DNA-binding response regulator CreB; Provisional 99.32
TIGR02875262 spore_0_A sporulation transcription factor Spo0A. 99.32
PRK11517223 transcriptional regulatory protein YedW; Provision 99.32
PRK10841924 hybrid sensory kinase in two-component regulatory 99.31
CHL00148240 orf27 Ycf27; Reviewed 99.31
PRK09958204 DNA-binding transcriptional activator EvgA; Provis 99.31
PRK10955232 DNA-binding transcriptional regulator CpxR; Provis 99.31
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 99.3
PRK10840216 transcriptional regulator RcsB; Provisional 99.3
COG1221403 PspF Transcriptional regulators containing an AAA- 99.3
PRK09581457 pleD response regulator PleD; Reviewed 99.3
TIGR02974329 phageshock_pspF psp operon transcriptional activat 99.29
PRK09483217 response regulator; Provisional 99.28
PRK14084246 two-component response regulator; Provisional 99.28
PRK15347921 two component system sensor kinase SsrA; Provision 99.27
KOG0519786 consensus Sensory transduction histidine kinase [S 99.26
PRK00742354 chemotaxis-specific methylesterase; Provisional 99.26
PRK09935210 transcriptional regulator FimZ; Provisional 99.26
PRK11697238 putative two-component response-regulatory protein 99.23
TIGR02956968 TMAO_torS TMAO reductase sytem sensor TorS. This p 99.22
PRK11466914 hybrid sensory histidine kinase TorS; Provisional 99.22
PRK11608326 pspF phage shock protein operon transcriptional ac 99.22
PRK10710240 DNA-binding transcriptional regulator BaeR; Provis 99.21
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.21
PRK10360196 DNA-binding transcriptional activator UhpA; Provis 99.21
PRK09581457 pleD response regulator PleD; Reviewed 99.19
PRK15479221 transcriptional regulatory protein TctD; Provision 99.19
COG3284606 AcoR Transcriptional activator of acetoin/glycerol 99.18
PRK099591197 hybrid sensory histidine kinase in two-component r 99.17
PRK05022509 anaerobic nitric oxide reductase transcription reg 99.16
PRK11091779 aerobic respiration control sensor protein ArcB; P 99.16
PRK09390202 fixJ response regulator FixJ; Provisional 99.13
PRK10651216 transcriptional regulator NarL; Provisional 99.12
PRK13435145 response regulator; Provisional 99.12
PRK10820520 DNA-binding transcriptional regulator TyrR; Provis 99.11
PRK10403215 transcriptional regulator NarP; Provisional 99.11
PRK11388638 DNA-binding transcriptional regulator DhaR; Provis 99.11
PRK15369211 two component system sensor kinase SsrB; Provision 99.1
TIGR01817534 nifA Nif-specific regulatory protein. This model r 99.08
COG2201350 CheB Chemotaxis response regulator containing a Ch 99.07
PRK10100216 DNA-binding transcriptional regulator CsgD; Provis 99.05
COG3707194 AmiR Response regulator with putative antiterminat 99.03
PRK13558665 bacterio-opsin activator; Provisional 99.02
cd00156113 REC Signal receiver domain; originally thought to 98.98
PRK15429686 formate hydrogenlyase transcriptional activator Fh 98.97
PRK09191261 two-component response regulator; Provisional 98.94
PRK15411207 rcsA colanic acid capsular biosynthesis activation 98.87
PRK13557540 histidine kinase; Provisional 98.76
PRK13837828 two-component VirA-like sensor kinase; Provisional 98.75
COG3279244 LytT Response regulator of the LytR/AlgR family [T 98.65
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 98.58
PRK15029755 arginine decarboxylase; Provisional 98.28
COG3706435 PleD Response regulator containing a CheY-like rec 97.98
PRK11107919 hybrid sensory histidine kinase BarA; Provisional 97.44
TIGR02902531 spore_lonB ATP-dependent protease LonB. Members of 97.13
COG4650531 RtcR Sigma54-dependent transcription regulator con 96.79
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 96.36
TIGR02903615 spore_lon_C ATP-dependent protease, Lon family. Me 96.24
PF03709115 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal 95.8
PF0942527 CCT_2: Divergent CCT motif; InterPro: IPR018467 Th 95.67
PTZ00111915 DNA replication licensing factor MCM4; Provisional 95.49
PRK13531498 regulatory ATPase RavA; Provisional 95.45
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.25
PRK10865857 protein disaggregation chaperone; Provisional 95.14
TIGR03815322 CpaE_hom_Actino helicase/secretion neighborhood Cp 94.78
KOG1601340 consensus GATA-4/5/6 transcription factors [Transc 94.58
cd02071122 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 bin 94.45
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 94.37
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 94.33
PHA02244383 ATPase-like protein 94.27
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 94.24
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 94.08
TIGR02442 633 Cob-chelat-sub cobaltochelatase subunit. A number 93.96
TIGR02031589 BchD-ChlD magnesium chelatase ATPase subunit D. Th 93.59
PRK02261137 methylaspartate mutase subunit S; Provisional 93.25
CHL00195489 ycf46 Ycf46; Provisional 93.2
smart00350509 MCM minichromosome maintenance proteins. 92.78
PF06490109 FleQ: Flagellar regulatory protein FleQ; InterPro: 92.78
PRK08903227 DnaA regulatory inactivator Hda; Validated 92.63
cd02067119 B12-binding B12 binding domain (B12-BD). This doma 92.63
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric en 92.49
PRK00208250 thiG thiazole synthase; Reviewed 92.29
TIGR00382413 clpX endopeptidase Clp ATP-binding regulatory subu 92.01
PRK05342412 clpX ATP-dependent protease ATP-binding subunit Cl 91.96
TIGR01501134 MthylAspMutase methylaspartate mutase, S subunit. 91.66
PRK00043212 thiE thiamine-phosphate pyrophosphorylase; Reviewe 91.19
PRK03992389 proteasome-activating nucleotidase; Provisional 90.67
smart0044855 REC cheY-homologous receiver domain. CheY regulate 89.78
CHL00181287 cbbX CbbX; Provisional 89.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 88.78
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 88.32
PRK12704520 phosphodiesterase; Provisional 88.31
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 88.28
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 84.47
PRK01130221 N-acetylmannosamine-6-phosphate 2-epimerase; Provi 84.46
CHL00176638 ftsH cell division protein; Validated 84.08
cd02072128 Glm_B12_BD B12 binding domain of glutamate mutase 83.86
TIGR00368499 Mg chelatase-related protein. The N-terminal end m 83.84
PF02310121 B12-binding: B12 binding domain; InterPro: IPR0061 83.64
TIGR03151307 enACPred_II putative enoyl-(acyl-carrier-protein) 83.1
PRK09426714 methylmalonyl-CoA mutase; Reviewed 82.95
cd04724242 Tryptophan_synthase_alpha Ttryptophan synthase (TR 82.66
CHL00162267 thiG thiamin biosynthesis protein G; Validated 82.26
PRK13765637 ATP-dependent protease Lon; Provisional 81.97
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 81.94
PRK11840326 bifunctional sulfur carrier protein/thiazole synth 81.72
TIGR00343287 pyridoxal 5'-phosphate synthase, synthase subunit 81.09
cd02070201 corrinoid_protein_B12-BD B12 binding domain of cor 80.91
PF05690247 ThiG: Thiazole biosynthesis protein ThiG; InterPro 80.87
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 80.59
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 80.56
PRK04180293 pyridoxal biosynthesis lyase PdxS; Provisional 80.26
smart00382148 AAA ATPases associated with a variety of cellular 80.24
PLN02591250 tryptophan synthase 80.24
KOG0729435 consensus 26S proteasome regulatory complex, ATPas 80.02
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information 
Probab=100.00  E-value=2.5e-40  Score=364.41  Aligned_cols=202  Identities=21%  Similarity=0.250  Sum_probs=180.4

Q ss_pred             HHHHHHHHHHHhCCCeEEEEeCCHHHHHHHHHhhCCCccEEEEcc-CCCCCHHHHHHHHHhhcCCCCceEEEEecCCChH
Q 005631            4 LLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMG   82 (687)
Q Consensus         4 ~~r~ll~~lLe~~G~~~V~~A~sg~eALe~L~~~~~~pDLVLlDl-MP~mdGleLL~~Ir~~~~~p~iPVIvmTa~~d~~   82 (687)
                      .++.++..+|+..||. |..+.++.+|++.+..  ..|||||+|+ ||++||++++++|++.  .+.+||||||+|++++
T Consensus        15 ~ir~~l~~~L~~~G~~-v~~a~~~~~al~~i~~--~~~~lvl~Di~mp~~~Gl~ll~~i~~~--~~~~pVI~~Tg~g~i~   89 (464)
T COG2204          15 DIRELLEQALELAGYE-VVTAESAEEALEALSE--SPFDLVLLDIRMPGMDGLELLKEIKSR--DPDLPVIVMTGHGDID   89 (464)
T ss_pred             HHHHHHHHHHHHcCCe-EEEeCCHHHHHHHHhc--CCCCEEEEecCCCCCchHHHHHHHHhh--CCCCCEEEEeCCCCHH
Confidence            4688999999999999 7899999999999998  6899999999 9999999999999988  4999999999999999


Q ss_pred             HHHHHHhCCCCEEEeCCCCHHHHHHHHHHHHHHHhcCCCCCCCcchhhhhhhccccccccCCCCCCCCCCCCCccccccC
Q 005631           83 LVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGG  162 (687)
Q Consensus        83 ~av~Am~aGA~DYL~KP~~~eeL~~~L~~alr~~~~~s~s~~~~~~~~q~~l~~k~i~~se~~s~s~~~~d~~~~g~~~~  162 (687)
                      .+++|++.||+|||.|||++++|...|.++++......+....                            .........
T Consensus        90 ~AV~A~k~GA~Dfl~KP~~~~~L~~~v~ral~~~~~~~e~~~~----------------------------~~~~~~~~~  141 (464)
T COG2204          90 TAVEALRLGAFDFLEKPFDLDRLLAIVERALELRELQRENRRS----------------------------LKRAKSLGG  141 (464)
T ss_pred             HHHHHHhcCcceeeeCCCCHHHHHHHHHHHHHHhhhhhhhhhh----------------------------hhccccccC
Confidence            9999999999999999999999999999999876554321100                            000111234


Q ss_pred             CCCCCCcccccchhhhhhhcCCCCccccCCCCCCCChhHHHHHhhhcCcccCCCceecCChhhhhhhhhhhhhhhccCCc
Q 005631          163 DGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRD  242 (687)
Q Consensus       163 D~sG~G~~aqS~~~k~~~ea~S~~~Vli~~GEsGTGKEl~AraIH~~S~R~~~pFV~vn~~~~C~aipe~L~ESelFGh~  242 (687)
                      +++|+++.||.........|.|+++||| +||||||||++||+||.+|.|+++|||+||    |+|||++|+|||||||.
T Consensus       142 ~liG~S~am~~l~~~i~kvA~s~a~VLI-~GESGtGKElvAr~IH~~S~R~~~PFVavN----caAip~~l~ESELFGhe  216 (464)
T COG2204         142 ELVGESPAMQQLRRLIAKVAPSDASVLI-TGESGTGKELVARAIHQASPRAKGPFIAVN----CAAIPENLLESELFGHE  216 (464)
T ss_pred             CceecCHHHHHHHHHHHHHhCCCCCEEE-ECCCCCcHHHHHHHHHhhCcccCCCceeee----cccCCHHHHHHHhhccc
Confidence            6889999999999999999999999999 899999999999999999999999999999    99999999999999997


Q ss_pred             c
Q 005631          243 L  243 (687)
Q Consensus       243 l  243 (687)
                      =
T Consensus       217 k  217 (464)
T COG2204         217 K  217 (464)
T ss_pred             c
Confidence            5

>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>PRK15115 response regulator GlrR; Provisional Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I) Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF06203 CCT: CCT motif; InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF00072 Response_reg: Response regulator receiver domain; InterPro: IPR001789 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] Back     alignment and domain information
>PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PLN03029 type-a response regulator protein; Provisional Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>TIGR03787 marine_sort_RR proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK14084 two-component response regulator; Provisional Back     alignment and domain information
>PRK15347 two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>KOG0519 consensus Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK15479 transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK15369 two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>PRK15411 rcsA colanic acid capsular biosynthesis activation protein A; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02902 spore_lonB ATP-dependent protease LonB Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>PF03709 OKR_DC_1_N: Orn/Lys/Arg decarboxylase, N-terminal domain; InterPro: IPR005308 This domain has a flavodoxin-like fold, and is termed the "wing" domain because of its position in the overall 3D structure Back     alignment and domain information
>PF09425 CCT_2: Divergent CCT motif; InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1 Back     alignment and domain information
>PTZ00111 DNA replication licensing factor MCM4; Provisional Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>TIGR03815 CpaE_hom_Actino helicase/secretion neighborhood CpaE-like protein Back     alignment and domain information
>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription] Back     alignment and domain information
>cd02071 MM_CoA_mut_B12_BD methylmalonyl CoA mutase B12 binding domain Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>TIGR02442 Cob-chelat-sub cobaltochelatase subunit Back     alignment and domain information
>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D Back     alignment and domain information
>PRK02261 methylaspartate mutase subunit S; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>PF06490 FleQ: Flagellar regulatory protein FleQ; InterPro: IPR010518 This domain is found at the N terminus of a subset of sigma54-dependent transcriptional activators that are involved in regulation of flagellar motility e Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) Back     alignment and domain information
>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional Back     alignment and domain information
>TIGR01501 MthylAspMutase methylaspartate mutase, S subunit Back     alignment and domain information
>PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>cd02072 Glm_B12_BD B12 binding domain of glutamate mutase (Glm) Back     alignment and domain information
>TIGR00368 Mg chelatase-related protein Back     alignment and domain information
>PF02310 B12-binding: B12 binding domain; InterPro: IPR006158 The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin) Back     alignment and domain information
>TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II Back     alignment and domain information
>PRK09426 methylmalonyl-CoA mutase; Reviewed Back     alignment and domain information
>cd04724 Tryptophan_synthase_alpha Ttryptophan synthase (TRPS) alpha subunit (TSA) Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>PRK13765 ATP-dependent protease Lon; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>PF05690 ThiG: Thiazole biosynthesis protein ThiG; InterPro: IPR008867 This family consists of several bacterial thiazole biosynthesis protein G sequences Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PLN02591 tryptophan synthase Back     alignment and domain information
>KOG0729 consensus 26S proteasome regulatory complex, ATPase RPT1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
3hzh_A157 Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Comple 3e-05
2wb4_A459 Activated Diguanylate Cyclase Pled In Complex With 5e-05
1w25_A459 Response Regulator Pled In Complex With C-digmp Len 5e-05
3h1f_A129 Crystal Structure Of Chey Mutant D53a Of Helicobact 6e-05
3gwg_A129 Crystal Structure Of Chey Of Helicobacter Pylori Le 8e-05
3h1g_A129 Crystal Structure Of Chey Mutant T84a Of Helicobact 8e-05
3f7a_A394 Structure Of Orthorhombic Crystal Form Of Pseudomon 2e-04
1u0s_Y118 Chemotaxis Kinase Chea P2 Domain In Complex With Re 6e-04
3tmy_A120 Chey From Thermotoga Maritima (Mn-Iii) Length = 120 7e-04
>pdb|3HZH|A Chain A, Crystal Structure Of The Chex-Chey-Bef3-Mg+2 Complex From Borrelia Burgdorferi Length = 157 Back     alignment and structure 
Iteration: 1

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 33/87 (37%), Positives = 49/87 (56%), Gaps = 3/87 (3%)
Query: 20  VITEATNGLQAWKILEDLTNHIDLV-LTEVMPCLSGVALLSKIMSHKTRKNLPVIMMSSL 78
           +I  A +G +A    ++   +ID+V L   MP + G+  LS IM     KN  VIM+S+L
Sbjct: 63  IIDTAADGEEAVIKYKNHYPNIDIVTLXITMPKMDGITCLSNIMEFD--KNARVIMISAL 120
Query: 79  DSMGLVFKCLSKGAVDFLVKPIRKNEL 105
               LV  CL KGA  F+VKP+ + ++
Sbjct: 121 GKEQLVKDCLIKGAKTFIVKPLDRAKV 147
>pdb|2WB4|A Chain A, Activated Diguanylate Cyclase Pled In Complex With C-Di-Gmp Length = 459 Back     alignment and structure
>pdb|1W25|A Chain A, Response Regulator Pled In Complex With C-digmp Length = 459 Back     alignment and structure
>pdb|3H1F|A Chain A, Crystal Structure Of Chey Mutant D53a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter Pylori Length = 129 Back     alignment and structure
>pdb|3F7A|A Chain A, Structure Of Orthorhombic Crystal Form Of Pseudomonas Aeruginosa Rssb Length = 394 Back     alignment and structure
>pdb|1U0S|Y Chain Y, Chemotaxis Kinase Chea P2 Domain In Complex With Response Regulator Chey From The Thermophile Thermotoga Maritima Length = 118 Back     alignment and structure
>pdb|3TMY|A Chain A, Chey From Thermotoga Maritima (Mn-Iii) Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
3luf_A259 Two-component system response regulator/ggdef doma 9e-19
3luf_A259 Two-component system response regulator/ggdef doma 7e-10
3bre_A358 Probable two-component response regulator; protein 8e-17
2qxy_A142 Response regulator; regulation of transcription, N 1e-16
3hdg_A137 Uncharacterized protein; two-component sensor acti 1e-16
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 1e-16
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 2e-16
1srr_A124 SPO0F, sporulation response regulatory protein; as 5e-16
3lua_A140 Response regulator receiver protein; two-component 8e-15
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 9e-15
1w25_A459 Stalked-cell differentiation controlling protein; 1e-14
1w25_A459 Stalked-cell differentiation controlling protein; 8e-12
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 2e-14
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 2e-14
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 4e-14
3cnb_A143 DNA-binding response regulator, MERR family; signa 5e-14
3cfy_A137 Putative LUXO repressor protein; structural genomi 6e-14
3eq2_A394 Probable two-component response regulator; adaptor 9e-14
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 9e-14
3jte_A143 Response regulator receiver protein; structural ge 1e-13
3hdv_A136 Response regulator; PSI-II, structural genomics, P 2e-13
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 3e-13
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 4e-13
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 4e-13
3i42_A127 Response regulator receiver domain protein (CHEY- 5e-13
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 6e-13
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 6e-13
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 8e-13
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 2e-12
3heb_A152 Response regulator receiver domain protein (CHEY); 2e-12
3n53_A140 Response regulator receiver modulated diguanylate; 2e-12
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 3e-12
3grc_A140 Sensor protein, kinase; protein structure initiati 4e-12
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 7e-12
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 8e-12
2rjn_A154 Response regulator receiver:metal-dependent phosph 8e-12
4dad_A146 Putative pilus assembly-related protein; response 1e-11
2zay_A147 Response regulator receiver protein; structural ge 1e-11
3cg0_A140 Response regulator receiver modulated diguanylate 2e-11
3nhm_A133 Response regulator; protein structure initiative I 2e-11
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 2e-11
2qr3_A140 Two-component system response regulator; structura 5e-11
3gt7_A154 Sensor protein; structural genomics, signal receiv 6e-11
3crn_A132 Response regulator receiver domain protein, CHEY-; 7e-11
3c3m_A138 Response regulator receiver protein; structural ge 2e-10
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 3e-10
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 5e-10
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 5e-10
3eqz_A135 Response regulator; structural genomics, unknown f 7e-10
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 8e-10
3cg4_A142 Response regulator receiver domain protein (CHEY-; 1e-09
1s8n_A205 Putative antiterminator; RV1626, structural genomi 3e-09
3rqi_A184 Response regulator protein; structural genomics, s 3e-09
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 3e-09
3h5i_A140 Response regulator/sensory box protein/ggdef domai 4e-09
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 5e-09
1dz3_A130 Stage 0 sporulation protein A; response regulator, 7e-09
3snk_A135 Response regulator CHEY-like protein; P-loop conta 8e-09
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 8e-09
1yio_A208 Response regulatory protein; transcription regulat 1e-08
1mb3_A124 Cell division response regulator DIVK; signal tran 1e-08
2rdm_A132 Response regulator receiver protein; structural ge 2e-08
3a10_A116 Response regulator; phosphoacceptor, signaling pro 3e-08
2qsj_A154 DNA-binding response regulator, LUXR family; struc 1e-07
2ayx_A254 Sensor kinase protein RCSC; two independent struct 1e-07
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 1e-07
3f6c_A134 Positive transcription regulator EVGA; structural 2e-07
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 3e-07
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 4e-07
2gkg_A127 Response regulator homolog; social motility, recei 4e-07
3lte_A132 Response regulator; structural genomics, PSI, prot 6e-07
2qv0_A143 Protein MRKE; structural genomics, transcription, 6e-07
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 1e-06
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 2e-06
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 2e-06
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 2e-06
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 3e-06
3n0r_A286 Response regulator; sigma factor, receiver, two-co 7e-06
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 8e-06
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 2e-05
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 2e-05
2gwr_A238 DNA-binding response regulator MTRA; two-component 3e-05
3r0j_A250 Possible two component system response transcript 3e-05
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 5e-05
3cz5_A153 Two-component response regulator, LUXR family; str 5e-05
1ys7_A233 Transcriptional regulatory protein PRRA; response 6e-05
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 6e-05
3kto_A136 Response regulator receiver protein; PSI-II,struct 6e-05
3q9s_A249 DNA-binding response regulator; DNA binding protei 8e-05
2pln_A137 HP1043, response regulator; signaling protein; 1.8 2e-04
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 5e-04
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 7e-04
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 7e-04
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
 Score = 85.8 bits (213), Expect = 9e-19
 Identities = 29/96 (30%), Positives = 48/96 (50%), Gaps = 2/96 (2%)

Query: 21  ITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMSSLD 79
           + EA++  +A   LE     I LVL +  MP + G++L+  +    +++ L +I +S  D
Sbjct: 151 VHEASHAREALATLEQ-HPAIRLVLVDYYMPEIDGISLVRMLRERYSKQQLAIIGISVSD 209

Query: 80  SMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR 115
             GL  + L +GA DFL +P    EL+    H    
Sbjct: 210 KRGLSARYLKQGANDFLNQPFEPEELQCRVSHNLEA 245
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Length = 358 Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Length = 142 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Length = 129 Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Length = 157 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Length = 140 Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Length = 459 Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Length = 143 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Length = 128 Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Length = 164 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Length = 143 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Length = 137 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Length = 394 Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145 Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Length = 143 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} Length = 136 Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Length = 149 Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Length = 349 Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Length = 149 Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} Length = 127 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} Length = 152 Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} Length = 140 Back     alignment and structure
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Length = 368 Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Length = 140 Back     alignment and structure
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Length = 387 Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Length = 146 Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Length = 154 Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Length = 146 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Length = 147 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Length = 140 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151 Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Length = 140 Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Length = 154 Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Length = 132 Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Length = 138 Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Length = 139 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Length = 130 Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C Length = 122 Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} Length = 135 Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Length = 140 Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Length = 142 Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Length = 205 Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Length = 184 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Length = 140 Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Length = 119 Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Length = 130 Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Length = 135 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Length = 132 Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Length = 116 Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Length = 154 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} Length = 136 Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Length = 126 Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Length = 127 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Length = 143 Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} Length = 144 Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Length = 196 Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Length = 150 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Length = 225 Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Length = 286 Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Length = 121 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Length = 220 Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Length = 138 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Length = 238 Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121 Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Length = 153 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Length = 225 Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} Length = 136 Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Length = 249 Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Length = 137 Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Length = 136 Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Length = 133 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
3dzd_A368 Transcriptional regulator (NTRC family); sigma43 a 99.97
1ny5_A387 Transcriptional regulator (NTRC family); AAA+ ATPa 99.96
3to5_A134 CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, p 99.87
3gl9_A122 Response regulator; beta-sheet, surrounded by alph 99.77
3t6k_A136 Response regulator receiver; flavodoxin-like, stru 99.75
3f6p_A120 Transcriptional regulatory protein YYCF; unphospho 99.73
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHE 99.72
2lpm_A123 Two-component response regulator; transcription re 99.71
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5- 99.71
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like 99.71
3crn_A132 Response regulator receiver domain protein, CHEY-; 99.7
3rqi_A184 Response regulator protein; structural genomics, s 99.7
3gt7_A154 Sensor protein; structural genomics, signal receiv 99.7
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A 99.7
3eq2_A394 Probable two-component response regulator; adaptor 99.69
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer 99.69
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wo 99.69
3kht_A144 Response regulator; PSI-II, 11023K, structural gen 99.68
1zgz_A122 Torcad operon transcriptional regulatory protein; 99.68
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGX 99.68
1p6q_A129 CHEY2; chemotaxis, signal transduction, response r 99.68
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl- 99.68
3heb_A152 Response regulator receiver domain protein (CHEY); 99.67
3cfy_A137 Putative LUXO repressor protein; structural genomi 99.67
3luf_A259 Two-component system response regulator/ggdef doma 99.67
1xhf_A123 DYE resistance, aerobic respiration control protei 99.67
3grc_A140 Sensor protein, kinase; protein structure initiati 99.67
1srr_A124 SPO0F, sporulation response regulatory protein; as 99.67
3jte_A143 Response regulator receiver protein; structural ge 99.67
1mb3_A124 Cell division response regulator DIVK; signal tran 99.67
2a9o_A120 Response regulator; essential protein, YYCF/YYCG h 99.67
2qzj_A136 Two-component response regulator; 11017X, PSI-II, 99.67
1i3c_A149 Response regulator RCP1; phytochrome, signaling pr 99.67
3i42_A127 Response regulator receiver domain protein (CHEY- 99.66
3b2n_A133 Uncharacterized protein Q99UF4; structural genomic 99.66
3kto_A136 Response regulator receiver protein; PSI-II,struct 99.66
3cnb_A143 DNA-binding response regulator, MERR family; signa 99.66
3nhm_A133 Response regulator; protein structure initiative I 99.66
3n0r_A286 Response regulator; sigma factor, receiver, two-co 99.66
3r0j_A250 Possible two component system response transcript 99.66
1dz3_A130 Stage 0 sporulation protein A; response regulator, 99.66
3hdg_A137 Uncharacterized protein; two-component sensor acti 99.66
3eod_A130 Protein HNR; response regulator, phosphoprotein, t 99.65
1zh2_A121 KDP operon transcriptional regulatory protein KDPE 99.65
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatas 99.65
1mvo_A136 PHOP response regulator; phosphate regulon, transc 99.65
2zay_A147 Response regulator receiver protein; structural ge 99.65
3hdv_A136 Response regulator; PSI-II, structural genomics, P 99.64
3f6c_A134 Positive transcription regulator EVGA; structural 99.64
3c3m_A138 Response regulator receiver protein; structural ge 99.64
3mm4_A206 Histidine kinase homolog; receiver domain, CKI1, c 99.64
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 99.64
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 99.64
2jba_A127 Phosphate regulon transcriptional regulatory PROT; 99.64
3snk_A135 Response regulator CHEY-like protein; P-loop conta 99.63
3eul_A152 Possible nitrate/nitrite response transcriptional 99.63
1k68_A140 Phytochrome response regulator RCPA; phosphorylate 99.63
3lua_A140 Response regulator receiver protein; two-component 99.63
3h5i_A140 Response regulator/sensory box protein/ggdef domai 99.63
3cu5_A141 Two component transcriptional regulator, ARAC FAM; 99.62
3cg4_A142 Response regulator receiver domain protein (CHEY-; 99.62
2ayx_A254 Sensor kinase protein RCSC; two independent struct 99.62
1k66_A149 Phytochrome response regulator RCPB; CHEY homologu 99.62
1a04_A215 Nitrate/nitrite response regulator protein NARL; s 99.62
3lte_A132 Response regulator; structural genomics, PSI, prot 99.62
4dad_A146 Putative pilus assembly-related protein; response 99.62
1yio_A208 Response regulatory protein; transcription regulat 99.61
3n53_A140 Response regulator receiver modulated diguanylate; 99.61
3cg0_A140 Response regulator receiver modulated diguanylate 99.61
2rjn_A154 Response regulator receiver:metal-dependent phosph 99.61
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural 99.61
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, 99.61
1w25_A459 Stalked-cell differentiation controlling protein; 99.6
2jk1_A139 HUPR, hydrogenase transcriptional regulatory prote 99.6
3a10_A116 Response regulator; phosphoacceptor, signaling pro 99.6
1s8n_A205 Putative antiterminator; RV1626, structural genomi 99.6
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional r 99.6
2qr3_A140 Two-component system response regulator; structura 99.6
1kgs_A225 DRRD, DNA binding response regulator D; DNA-bindin 99.6
3q9s_A249 DNA-binding response regulator; DNA binding protei 99.59
3cz5_A153 Two-component response regulator, LUXR family; str 99.59
1dcf_A136 ETR1 protein; beta-alpha five sandwich, transferas 99.59
2qv0_A143 Protein MRKE; structural genomics, transcription, 99.58
2qxy_A142 Response regulator; regulation of transcription, N 99.58
2gkg_A127 Response regulator homolog; social motility, recei 99.58
1ys7_A233 Transcriptional regulatory protein PRRA; response 99.57
1a2o_A349 CHEB methylesterase; bacterial chemotaxis, adaptat 99.56
3bre_A358 Probable two-component response regulator; protein 99.56
3sy8_A400 ROCR; TIM barrel phosphodiesterase-A, transcriptio 99.55
3kyj_B145 CHEY6 protein, putative histidine protein kinase; 99.55
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, 99.54
3c3w_A225 Two component transcriptional regulatory protein; 99.54
2oqr_A230 Sensory transduction protein REGX3; response regul 99.53
2qsj_A154 DNA-binding response regulator, LUXR family; struc 99.53
3eqz_A135 Response regulator; structural genomics, unknown f 99.52
3klo_A225 Transcriptional regulator VPST; REC domain, HTH do 99.52
2rdm_A132 Response regulator receiver protein; structural ge 99.52
3t8y_A164 CHEB, chemotaxis response regulator protein-glutam 99.52
2gwr_A238 DNA-binding response regulator MTRA; two-component 99.52
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain 99.51
2j48_A119 Two-component sensor kinase; pseudo-receiver, circ 99.51
3c97_A140 Signal transduction histidine kinase; structural g 99.49
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription 99.49
2pln_A137 HP1043, response regulator; signaling protein; 1.8 99.48
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2 99.44
2hqr_A223 Putative transcriptional regulator; phosporylation 99.39
2b4a_A138 BH3024; flavodoxin-like fold, structural genomics, 99.36
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.31
3luf_A259 Two-component system response regulator/ggdef doma 99.29
1ojl_A304 Transcriptional regulatory protein ZRAR; response 99.03
1w25_A459 Stalked-cell differentiation controlling protein; 98.71
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 98.6
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 98.53
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 98.38
3co5_A143 Putative two-component system transcriptional RES 98.1
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.55
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 97.05
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 97.05
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 96.49
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; 96.2
3q7r_A121 Transcriptional regulatory protein; CHXR, receiver 96.09
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 96.01
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 95.91
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 95.84
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 95.41
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 95.17
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 95.15
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 95.12
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.01
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 94.95
2r62_A268 Cell division protease FTSH homolog; ATPase domain 94.81
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 94.66
3ogl_Q21 JAZ1 incomplete degron peptide; leucine-rich repea 94.29
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 94.21
1wv2_A265 Thiazole moeity, thiazole biosynthesis protein THI 94.17
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 93.76
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 93.69
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 93.6
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 93.51
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 93.49
3m6a_A543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 92.84
3bos_A242 Putative DNA replication factor; P-loop containing 92.77
3nbx_X500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 92.72
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 92.68
3ogk_Q22 JAZ1 incomplete degron peptide; leucine rich repea 92.24
2yxb_A161 Coenzyme B12-dependent mutase; alpha/beta, structu 92.21
2ce7_A476 Cell division protein FTSH; metalloprotease; HET: 91.76
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 91.49
3pvs_A447 Replication-associated recombination protein A; ma 91.45
3f9v_A595 Minichromosome maintenance protein MCM; replicativ 91.31
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 91.17
1ypw_A806 Transitional endoplasmic reticulum ATPase; AAA, P9 90.95
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 90.84
2v1u_A387 Cell division control protein 6 homolog; DNA repli 90.75
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 90.65
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 90.55
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 90.51
2htm_A268 Thiazole biosynthesis protein THIG; thiamin biosyn 90.45
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 90.14
2dhr_A499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 89.63
1ccw_A137 Protein (glutamate mutase); coenzyme B12, radical 89.32
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 89.25
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 89.09
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 88.84
3q58_A229 N-acetylmannosamine-6-phosphate 2-epimerase; TIM b 88.31
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 87.54
3k1j_A604 LON protease, ATP-dependent protease LON; ATP-bind 86.94
3igs_A232 N-acetylmannosamine-6-phosphate 2-epimerase 2; ene 86.7
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 86.26
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 86.21
1xi3_A215 Thiamine phosphate pyrophosphorylase; structural g 85.88
2ekc_A262 AQ_1548, tryptophan synthase alpha chain; structur 85.6
2qgz_A308 Helicase loader, putative primosome component; str 85.47
1yad_A221 Regulatory protein TENI; TIM barrel, transcription 85.32
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.06
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 83.86
2r44_A331 Uncharacterized protein; putative ATPase, structur 83.85
2chg_A226 Replication factor C small subunit; DNA-binding pr 83.66
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 83.5
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 83.11
3vnd_A267 TSA, tryptophan synthase alpha chain; psychrophili 82.86
1geq_A248 Tryptophan synthase alpha-subunit; hyperthermophIl 81.55
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 81.44
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 80.92
1r6b_X758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 80.91
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 80.83
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A Back     alignment and structure
Probab=99.97  E-value=2.1e-30  Score=279.70  Aligned_cols=193  Identities=16%  Similarity=0.144  Sum_probs=166.4

Q ss_pred             HHHHHHHHHHHhCCCeEEEEeCCHHHHHHHHHhhCCCccEEEEcc-CCCCCHHHHHHHHHhhcCCCCceEEEEecCCChH
Q 005631            4 LLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMG   82 (687)
Q Consensus         4 ~~r~ll~~lLe~~G~~~V~~A~sg~eALe~L~~~~~~pDLVLlDl-MP~mdGleLL~~Ir~~~~~p~iPVIvmTa~~d~~   82 (687)
                      ..+..+..+|+..||. |..+.++.+|++.+..  ..|||||+|+ ||+|+|++++++|++.  .+.+||||||++.+.+
T Consensus        11 ~~~~~l~~~L~~~g~~-v~~a~~~~eal~~l~~--~~~DlvllDi~mP~~dG~ell~~lr~~--~~~~pvI~lT~~~~~~   85 (368)
T 3dzd_A           11 SITSSLSAILEEEGYH-PDTAKTLREAEKKIKE--LFFPVIVLDVWMPDGDGVNFIDFIKEN--SPDSVVIVITGHGSVD   85 (368)
T ss_dssp             HHHHHHHHHHHHTTCE-EEEESSHHHHHHHHHH--BCCSEEEEESEETTEETTTHHHHHHHH--CTTCEEEEEECSSCCH
T ss_pred             HHHHHHHHHHHHcCCE-EEEECCHHHHHHHHHh--CCCCEEEEeCCCCCCCHHHHHHHHHhh--CCCCeEEEEeCCCCHH
Confidence            4577888899999998 7899999999999998  8899999999 9999999999999987  4899999999999999


Q ss_pred             HHHHHHhCCCCEEEeCCCCHHHHHHHHHHHHHHHhcCCCCCCCcchhhhhhhccccccccCCCCCCCCCCCCCccccccC
Q 005631           83 LVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRRCHSSSGSGSESCTQTQKSIKSKNVENSGNNTGSNDEDNNGSIGVNGG  162 (687)
Q Consensus        83 ~av~Am~aGA~DYL~KP~~~eeL~~~L~~alr~~~~~s~s~~~~~~~~q~~l~~k~i~~se~~s~s~~~~d~~~~g~~~~  162 (687)
                      .+.+|++.||+|||.||++.++|...|+++++.........                           .         ..
T Consensus        86 ~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~l~~~~~~~~~~---------------------------~---------~~  129 (368)
T 3dzd_A           86 TAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYSKKAPPQ---------------------------E---------EI  129 (368)
T ss_dssp             HHHHHHHHTCCEEEESSCCHHHHHHHHHHHHHHHSCCCCCC---------------------------C---------CC
T ss_pred             HHHHHHhcCcceEEeCCCCHHHHHHHHHHHHHHhhhhhccc---------------------------c---------cc
Confidence            99999999999999999999999999999988764322100                           0         01


Q ss_pred             CCCCCCcccccchhhhhhhcCCCCccccCCCCCCCChhHHHHHhhhcCcccCCCceecCChhhhhhhhhhhhhhhccCCc
Q 005631          163 DGSDDGSGTQSSWTKKAVEVDSPRHMSPSDQLAECPDSTCAQVIHSNAEITGSRRVPVTAAKECQDHEERCENFAKRSRD  242 (687)
Q Consensus       163 D~sG~G~~aqS~~~k~~~ea~S~~~Vli~~GEsGTGKEl~AraIH~~S~R~~~pFV~vn~~~~C~aipe~L~ESelFGh~  242 (687)
                      +++|.+..++.........+.++.+|+| +||+|||||++||+||..|.|... ||+||    |+++|++++|++||||.
T Consensus       130 ~~ig~s~~~~~~~~~~~~~a~~~~~vli-~GesGtGKe~lAr~ih~~s~r~~~-fv~vn----c~~~~~~~~~~~lfg~~  203 (368)
T 3dzd_A          130 EFVGEHPKILEIKRLIPKIAKSKAPVLI-TGESGTGKEIVARLIHRYSGRKGA-FVDLN----CASIPQELAESELFGHE  203 (368)
T ss_dssp             CCCCCSHHHHHHHHHHHHHHTSCSCEEE-ECCTTSSHHHHHHHHHHHHCCCSC-EEEEE----SSSSCTTTHHHHHHEEC
T ss_pred             cccccchHHHHHHhhhhhhhccchhheE-EeCCCchHHHHHHHHHHhccccCC-cEEEE----cccCChHHHHHHhcCcc
Confidence            3455555555555445555689999999 799999999999999999999876 99999    99999999999999996


Q ss_pred             c
Q 005631          243 L  243 (687)
Q Consensus       243 l  243 (687)
                      -
T Consensus       204 ~  204 (368)
T 3dzd_A          204 K  204 (368)
T ss_dssp             S
T ss_pred             c
Confidence            4
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* Back     alignment and structure
>3to5_A CHEY homolog; alpha(5)beta(5), chemotaxis, FLIM, phosphorylation, motor AC signaling protein; 1.65A {Vibrio cholerae} Back     alignment and structure
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} SCOP: c.23.1.0 PDB: 3dgf_C 3dge_C Back     alignment and structure
>3t6k_A Response regulator receiver; flavodoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: MSE; 1.86A {Chloroflexus aurantiacus} SCOP: c.23.1.0 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 2zwm_A Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} SCOP: c.23.1.1 PDB: 3gwg_A 3h1e_A 3h1f_A Back     alignment and structure
>2lpm_A Two-component response regulator; transcription regulator; NMR {Sinorhizobium meliloti} Back     alignment and structure
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B Back     alignment and structure
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Back     alignment and structure
>3crn_A Response regulator receiver domain protein, CHEY-; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1} Back     alignment and structure
>3rqi_A Response regulator protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PHD CIT; 1.70A {Burkholderia pseudomallei} Back     alignment and structure
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB} Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 3olx_A 3olw_A 1cye_A 2che_A 2chf_A ... Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A Back     alignment and structure
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Back     alignment and structure
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixatio regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A* Back     alignment and structure
>3kht_A Response regulator; PSI-II, 11023K, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.10A {Hahella chejuensis} SCOP: c.23.1.0 Back     alignment and structure
>1zgz_A Torcad operon transcriptional regulatory protein; two-component system, gene regulation, transcription factor, respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Back     alignment and structure
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, structure initiative, structural genomics; 2.40A {Rhodospirillum rubrum} SCOP: c.23.1.0 Back     alignment and structure
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A Back     alignment and structure
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP} Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 3q15_C 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Back     alignment and structure
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver DOM target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Back     alignment and structure
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A* Back     alignment and structure
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics; 2.89A {Clostridium difficile} Back     alignment and structure
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A Back     alignment and structure
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT} SCOP: c.23.1.0 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Staphylococcus aureus} Back     alignment and structure
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C} SCOP: c.23.1.0 Back     alignment and structure
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structu initiative, PSI-2; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Back     alignment and structure
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides} PDB: 3t0y_A Back     alignment and structure
>3r0j_A Possible two component system response transcript positive regulator PHOP; beta-alpha fold, winged helix-turn-helix; 2.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A* Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} SCOP: c.23.1.0 Back     alignment and structure
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12} Back     alignment and structure
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A Back     alignment and structure
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi} Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Back     alignment and structure
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, protein structure initiative; 2.00A {Desulfuromonas acetoxidans} Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 2.09A {Pseudomonas putida} SCOP: c.23.1.0 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, PSI-2, protein structure initiative, PO transcription regulator EVGA; 1.45A {Escherichia coli k-12} Back     alignment and structure
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1} Back     alignment and structure
>3mm4_A Histidine kinase homolog; receiver domain, CKI1, cytokinin signaling, ROS fold, CHEY-like, transferase; 2.00A {Arabidopsis thaliana} PDB: 3mmn_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory PROT; transcription factor, sensory transduction, phosphate regula transcription regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Back     alignment and structure
>3snk_A Response regulator CHEY-like protein; P-loop containing nucleoside triphosphate hydrolases, struct genomics; 2.02A {Mesorhizobium loti} Back     alignment and structure
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum} Back     alignment and structure
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901} Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC FAM; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Back     alignment and structure
>3cg4_A Response regulator receiver domain protein (CHEY-; structural genomics, unknown function; HET: MSE; 1.61A {Methanospirillum hungatei jf-1} Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Back     alignment and structure
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, NYSG YORK structural genomix research consortium, nysgxrc; 2.00A {Bermanella marisrubri} Back     alignment and structure
>4dad_A Putative pilus assembly-related protein; response regulator receiver domain, CHEY-related protein, ST genomics; 2.50A {Burkholderia pseudomallei} PDB: 4dn6_A Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Back     alignment and structure
>3n53_A Response regulator receiver modulated diguanylate; diguanylate cyclase, protein structure I II(PSI II), NYSGXRC, structural genomics; 2.20A {Pelobacter carbinolicus} SCOP: c.23.1.0 Back     alignment and structure
>3cg0_A Response regulator receiver modulated diguanylate with PAS/PAC sensor; signal receiver domain, diguanylate cyclase; 2.15A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92; 2.10A {Neptuniibacter caesariensis} Back     alignment and structure
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Back     alignment and structure
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein S initiative, structural genomics; 2.59A {Cytophaga hutchinsonii} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HU; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B Back     alignment and structure
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A* Back     alignment and structure
>1s8n_A Putative antiterminator; RV1626, structural genomics, transcriptional antiterminator, component system, PSI; 1.48A {Mycobacterium tuberculosis} SCOP: c.23.1.1 PDB: 1sd5_A Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Back     alignment and structure
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structu initiative; 1.80A {Bacteroides fragilis} Back     alignment and structure
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nnn_A* Back     alignment and structure
>3q9s_A DNA-binding response regulator; DNA binding protein; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP} Back     alignment and structure
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2 Back     alignment and structure
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae} Back     alignment and structure
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima} Back     alignment and structure
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Back     alignment and structure
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1 Back     alignment and structure
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa} PDB: 3i5a_A* Back     alignment and structure
>3sy8_A ROCR; TIM barrel phosphodiesterase-A, transcription regulator; HET: EPE; 2.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Back     alignment and structure
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein; response regulator, two-component regulatory system, DNA-BIN protein; 2.20A {Mycobacterium tuberculosis} Back     alignment and structure
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D swapping, two component system; 2.03A {Mycobacterium tuberculosis H37RV} Back     alignment and structure
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein struct initiative; 2.15A {Colwellia psychrerythraea} SCOP: c.23.1.0 Back     alignment and structure
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A* Back     alignment and structure
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein struct initiative; HET: MSE; 1.76A {Sinorhizobium medicae} Back     alignment and structure
>3t8y_A CHEB, chemotaxis response regulator protein-glutamate methylesterase; CHEA, hydrolase; 1.90A {Thermotoga maritima} Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Back     alignment and structure
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus} Back     alignment and structure
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 PDB: 3nns_A* Back     alignment and structure
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A Back     alignment and structure
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, SY dimer, signaling protein; NMR {Helicobacter pylori} Back     alignment and structure
>2b4a_A BH3024; flavodoxin-like fold, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.42A {Bacillus halodurans} SCOP: c.23.1.1 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, ggdef domain, cyclic dinucleotide, cyclic-digmp; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A* Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima} PDB: 2lle_A Back     alignment and structure
>3q7r_A Transcriptional regulatory protein; CHXR, receiver domain, transcription factor, OMPR, chlamydia transcription; 1.60A {Chlamydia trachomatis} PDB: 3q7s_A* 3q7t_A Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3ogk_Q JAZ1 incomplete degron peptide; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM-barrel rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A* Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 Back     alignment and structure
>2ekc_A AQ_1548, tryptophan synthase alpha chain; structural genomics, lyase, NPPSFA, national project on PROT structural and functional analyses; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3vnd_A TSA, tryptophan synthase alpha chain; psychrophilic enzyme, cold adaptation; HET: PE8; 2.60A {Shewanella frigidimarina} Back     alignment and structure
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, pyrococ furiosus, X-RAY analysis, stability, calorimetry, lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 687
d1dz3a_123 c.23.1.1 (A:) Sporulation response regulator Spo0A 4e-17
d1jbea_128 c.23.1.1 (A:) CheY protein {Escherichia coli [TaxI 9e-17
d1k68a_140 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-15
d1u0sy_118 c.23.1.1 (Y:) CheY protein {Thermotoga maritima [T 1e-15
d1p6qa_129 c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti 8e-15
d1zesa1121 c.23.1.1 (A:3-123) PhoB receiver domain {Escherich 9e-15
d2r25b1128 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Ba 6e-14
d1a04a2138 c.23.1.1 (A:5-142) Nitrate/nitrite response regula 1e-13
d1a2oa1140 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal 3e-13
d1peya_119 c.23.1.1 (A:) Sporulation response regulator Spo0F 4e-13
d1i3ca_144 c.23.1.1 (A:) Response regulator for cyanobacteria 6e-13
d1mb3a_123 c.23.1.1 (A:) Cell division response regulator Div 7e-13
d1s8na_190 c.23.1.1 (A:) Probable two-component system transc 1e-12
d1zgza1120 c.23.1.1 (A:2-121) TorCAD operon transcriptional r 1e-12
d1krwa_123 c.23.1.1 (A:) NTRC receiver domain {Salmonella typ 5e-12
d2a9pa1117 c.23.1.1 (A:2-118) DNA-binding response regulator 5e-12
d1xhfa1121 c.23.1.1 (A:2-122) Aerobic respiration control pro 7e-12
d1dcfa_134 c.23.1.2 (A:) Receiver domain of the ethylene rece 2e-11
d1p2fa2120 c.23.1.1 (A:1-120) Response regulator DrrB {Thermo 3e-11
d1qkka_140 c.23.1.1 (A:) Transcriptional regulatory protein D 7e-11
d2b4aa1118 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Ba 1e-10
d1k66a_149 c.23.1.1 (A:) Response regulator for cyanobacteria 1e-10
d1dbwa_123 c.23.1.1 (A:) Transcriptional regulatory protein F 7e-10
d2ayxa1133 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C 8e-10
d1ny5a1137 c.23.1.1 (A:1-137) Transcriptional activator sigm5 1e-09
d1ys7a2121 c.23.1.1 (A:7-127) Transcriptional regulatory prot 2e-09
d1mvoa_121 c.23.1.1 (A:) PhoP receiver domain {Bacillus subti 4e-09
d2pl1a1119 c.23.1.1 (A:1-119) PhoP receiver domain {Escherich 6e-09
d1zh2a1119 c.23.1.1 (A:2-120) Transcriptional regulatory prot 8e-09
d1w25a2153 c.23.1.1 (A:141-293) Response regulator PleD, rece 2e-08
d1yioa2128 c.23.1.1 (A:3-130) Response regulatory protein Sty 2e-08
d1w25a1139 c.23.1.1 (A:2-140) Response regulator PleD, receiv 3e-08
d1kgsa2122 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotog 1e-07
d1qo0d_189 c.23.1.3 (D:) Positive regulator of the amidase op 4e-05
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Length = 123 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: Sporulation response regulator Spo0A
species: Bacillus stearothermophilus [TaxId: 1422]

 Score = 75.6 bits (186), Expect = 4e-17
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 4/99 (4%)

Query: 18  MKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMS 76
           M+VI  A NG    ++LE+     D++L ++ MP L G+A+L +I +        VIM++
Sbjct: 27  MEVIGTAYNGQDCLQMLEE--KRPDILLLDIIMPHLDGLAVLERIRAG-FEHQPNVIMLT 83

Query: 77  SLDSMGLVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR 115
           +     +  K +  GA  F++KP     L +  + V+ +
Sbjct: 84  AFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGK 122
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Length = 140 Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Length = 118 Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Length = 129 Back     information, alignment and structure
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 128 Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 140 Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Length = 119 Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Length = 144 Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Length = 123 Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 190 Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Length = 123 Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Length = 117 Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 134 Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Length = 120 Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Length = 140 Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Length = 118 Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Length = 149 Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Length = 123 Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 133 Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Length = 137 Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 121 Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Length = 121 Back     information, alignment and structure
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 119 Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 153 Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Length = 128 Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Length = 139 Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Length = 122 Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Length = 189 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
d2pl1a1119 PhoP receiver domain {Escherichia coli [TaxId: 562 99.86
d1zesa1121 PhoB receiver domain {Escherichia coli [TaxId: 562 99.85
d1zh2a1119 Transcriptional regulatory protein KdpE, N-termina 99.85
d1ys7a2121 Transcriptional regulatory protein PrrA, N-termina 99.85
d1dbwa_123 Transcriptional regulatory protein FixJ, receiver 99.84
d1qkka_140 Transcriptional regulatory protein DctD, receiver 99.84
d1krwa_123 NTRC receiver domain {Salmonella typhimurium [TaxI 99.84
d1peya_119 Sporulation response regulator Spo0F {Bacillus sub 99.84
d1ny5a1137 Transcriptional activator sigm54 (NtrC1), N-termin 99.84
d2a9pa1117 DNA-binding response regulator MicA, N-terminal do 99.84
d1kgsa2122 PhoB receiver domain {Thermotoga maritima [TaxId: 99.84
d1jbea_128 CheY protein {Escherichia coli [TaxId: 562]} 99.84
d1xhfa1121 Aerobic respiration control protein ArcA, N-termin 99.83
d1mvoa_121 PhoP receiver domain {Bacillus subtilis [TaxId: 14 99.83
d1w25a1139 Response regulator PleD, receiver domain {Caulobac 99.83
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 99.83
d2ayxa1133 Sensor kinase protein RcsC, C-terminal domain {Esc 99.82
d1mb3a_123 Cell division response regulator DivK {Caulobacter 99.82
d1zgza1120 TorCAD operon transcriptional regulator TorD, N-te 99.82
d1s8na_190 Probable two-component system transcriptional regu 99.82
d1p6qa_129 CheY protein {Sinorhizobium meliloti, CheY2 [TaxId 99.81
d1k66a_149 Response regulator for cyanobacterial phytochrome 99.81
d1i3ca_144 Response regulator for cyanobacterial phytochrome 99.81
d2r25b1128 Response regulator Sin1 {Baker's yeast (Saccharomy 99.81
d1yioa2128 Response regulatory protein StyR, N-terminal domai 99.8
d1k68a_140 Response regulator for cyanobacterial phytochrome 99.8
d1dz3a_123 Sporulation response regulator Spo0A {Bacillus ste 99.8
d1p2fa2120 Response regulator DrrB {Thermotoga maritima [TaxI 99.79
d1w25a2153 Response regulator PleD, receiver domain {Caulobac 99.78
d1a04a2138 Nitrate/nitrite response regulator (NarL), receive 99.77
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 99.76
d2b4aa1118 Hypothetical protein BH3024 {Bacillus halodurans [ 99.68
d1a2oa1140 Methylesterase CheB, N-terminal domain {Salmonella 99.65
d1qo0d_189 Positive regulator of the amidase operon AmiR {Pse 99.62
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 98.8
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 91.94
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 90.81
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 89.9
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 89.26
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 84.01
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 83.83
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 82.68
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 81.58
d1xi3a_206 Thiamin phosphate synthase {Archaeon (Pyrococcus f 81.44
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 81.2
d1xm3a_251 Thiazole biosynthesis protein ThiG {Bacillus subti 80.9
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 80.39
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 80.32
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 80.19
d1wv2a_243 Thiazole biosynthesis protein ThiG {Pseudomonas ae 80.08
>d2pl1a1 c.23.1.1 (A:1-119) PhoP receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Flavodoxin-like
superfamily: CheY-like
family: CheY-related
domain: PhoP receiver domain
species: Escherichia coli [TaxId: 562]

Probab=99.86  E-value=4.4e-21  Score=173.24  Aligned_cols=107  Identities=24%  Similarity=0.369  Sum_probs=101.6

Q ss_pred             HHHHHHHHHHHhCCCeEEEEeCCHHHHHHHHHhhCCCccEEEEcc-CCCCCHHHHHHHHHhhcCCCCceEEEEecCCChH
Q 005631            4 LLAMLLLLCFEIAVMKVITEATNGLQAWKILEDLTNHIDLVLTEV-MPCLSGVALLSKIMSHKTRKNLPVIMMSSLDSMG   82 (687)
Q Consensus         4 ~~r~ll~~lLe~~G~~~V~~A~sg~eALe~L~~~~~~pDLVLlDl-MP~mdGleLL~~Ir~~~~~p~iPVIvmTa~~d~~   82 (687)
                      ..+.++..+|+..||+ |..|.++.+|++++++  ..|||||+|+ ||+++|++++++|++.  .+.+|||++|++.+.+
T Consensus        11 ~~~~~l~~~L~~~G~~-v~~a~~g~eal~~l~~--~~~dliilD~~mP~~~G~e~~~~i~~~--~~~~pvi~lt~~~~~~   85 (119)
T d2pl1a1          11 LLRHHLKVQIQDAGHQ-VDDAEDAKEADYYLNE--HIPDIAIVDLGLPDEDGLSLIRRWRSN--DVSLPILVLTARESWQ   85 (119)
T ss_dssp             HHHHHHHHHHHHTTCE-EEEESSHHHHHHHHHH--SCCSEEEECSCCSSSCHHHHHHHHHHT--TCCSCEEEEESCCCHH
T ss_pred             HHHHHHHHHHHHCCCE-EEEECCHHHHHHHHHh--cccceeehhccCCCchhHHHHHHHHhc--CcccceEeeeccCCHH
Confidence            4678889999999999 7899999999999999  8999999999 9999999999999987  4799999999999999


Q ss_pred             HHHHHHhCCCCEEEeCCCCHHHHHHHHHHHHHH
Q 005631           83 LVFKCLSKGAVDFLVKPIRKNELKNLWQHVWRR  115 (687)
Q Consensus        83 ~av~Am~aGA~DYL~KP~~~eeL~~~L~~alr~  115 (687)
                      .+.+|++.||+|||.|||+.++|..+|+++++|
T Consensus        86 ~~~~a~~~Ga~~yl~KP~~~~~L~~~v~~~lrR  118 (119)
T d2pl1a1          86 DKVEVLSAGADDYVTKPFHIEEVMARMQALMRR  118 (119)
T ss_dssp             HHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHcCCCEEEECCCCHHHHHHHHHHHHcc
Confidence            999999999999999999999999999999876
>d1zesa1 c.23.1.1 (A:3-123) PhoB receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh2a1 c.23.1.1 (A:2-120) Transcriptional regulatory protein KdpE, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ys7a2 c.23.1.1 (A:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1qkka_ c.23.1.1 (A:) Transcriptional regulatory protein DctD, receiver domain {Sinorhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1krwa_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1peya_ c.23.1.1 (A:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2a9pa1 c.23.1.1 (A:2-118) DNA-binding response regulator MicA, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhfa1 c.23.1.1 (A:2-122) Aerobic respiration control protein ArcA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mvoa_ c.23.1.1 (A:) PhoP receiver domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w25a1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mb3a_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]} Back     information, alignment and structure
>d1k66a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpB [TaxId: 1188]} Back     information, alignment and structure
>d1i3ca_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Synechocystis sp. PCC 6803, RCP1 [TaxId: 1148]} Back     information, alignment and structure
>d2r25b1 c.23.1.1 (B:1087-1214) Response regulator Sin1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yioa2 c.23.1.1 (A:3-130) Response regulatory protein StyR, N-terminal domain {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k68a_ c.23.1.1 (A:) Response regulator for cyanobacterial phytochrome {Calothrix sp. pcc 7601, RcpA [TaxId: 1188]} Back     information, alignment and structure
>d1dz3a_ c.23.1.1 (A:) Sporulation response regulator Spo0A {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p2fa2 c.23.1.1 (A:1-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w25a2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]} Back     information, alignment and structure
>d1a04a2 c.23.1.1 (A:5-142) Nitrate/nitrite response regulator (NarL), receiver domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1a2oa1 c.23.1.1 (A:1-140) Methylesterase CheB, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1qo0d_ c.23.1.3 (D:) Positive regulator of the amidase operon AmiR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1xi3a_ c.1.3.1 (A:) Thiamin phosphate synthase {Archaeon (Pyrococcus furiosus) [TaxId: 2261]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xm3a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wv2a_ c.1.31.1 (A:) Thiazole biosynthesis protein ThiG {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure