Citrus Sinensis ID: 005633


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680------
MSRQSSQAAAAQMNLLQQQRYLQLQQQHQQQQLLKAMPQQRPQLPQHFVQQQNLPLRSPAKPVYEPGMCARRLTHYMYQQQHRPEVRFSHHDESVVSLWCITIVICNSRVFVQDNNIEFWRKFVAEYFAPNAKKKWCVSMYGSGRQATGVFPQDVWHCEICNRKPGRGFEATVEVLPRLFKIKYESGTLEELLYVDMPREYQNASGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSPDLKICSWEFCARRHEELIPRRLLIPQVSQLGAAAQKYQAATQNASSNLSAPELQNNCNMFVASARQLAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRVTGTGPMESLAKFPRRTSGASGFHSPSQQPEDQLQQQQQQQQTVGQNSNSESSVQANAMQLATSNGVANVNNSLNPASASSTASTIVGLLHQNSMNSRQQNTVNNASSPYGGSSVQMPSPGSSNNIPQAQPNPSPFQSPTPSSSNNPPQTSHSALTAANHMSSASSPANISVQQPALSGEADPRALSGDADPSDSQSAVQKILHEMMLCSHLNGGSGGGGGMVGVGSLGNDVKNVNDIMATGNNTVLNGGNGLVGNGTVNNNPGIGTGGYGNMGGGLGQSAMVNGIRAAMGNNSMMNGRVGMTAMARDQSMNHQQDLGNQLLNGLGAVNGFNNLQFDWKPSP
ccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccEEEEEEccccccccccccccccccccccccccccCEEEccccHHHHHHHHHccccEEEEEEEccccCECcccccEEEEEccEEEEEEEcccEEEEEEEEEEEEcccccEEEEEEEEccECccccccHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHcHHHHHHHHHHcccccHHHHHHcccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccc
***************************************************************YEPGMCARRLTHYMYQQQHRPEVRFSHHDESVVSLWCITIVICNSRVFVQDNNIEFWRKFVAEYFAPNAKKKWCVSMYGSGRQATGVFPQDVWHCEICNRKPGRGFEATVEVLPRLFKIKYESGTLEELLYVDMPREYQNASGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSPDLKICSWEFCARRHEELIPRRLLIPQVS**************************************LAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRVT**************************************************************************************************************************************************************************************************************************************KNVNDIMATGNNTVLNGGNGLVGNGTVNNNPGIGTGGYGNMGGGLGQSAMVNGI*********************************QLLNGLGAVNGFNNLQFDW****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRQSSQAAAAQMNLLQQQRYLQLQQQHQQQQLLKAMPQQRPQLPQHFVQQQNLPLRSPAKPVYEPGMCARRLTHYMYQQQHRPEVRFSHHDESVVSLWCITIVICNSRVFVQDNNIEFWRKFVAEYFAPNAKKKWCVSMYGSGRQATGVFPQDVWHCEICNRKPGRGFEATVEVLPRLFKIKYESGTLEELLYVDMPREYQNASGQIVLDYAKAIQESVFEQLRVVRDGQLRIVFSPDLKICSWEFCARRHEELIPRRLLIPQVSQLGAAAQKYQAATQNASSNLSAPELQNNCNMFVASARQLAKALEVPLVNDLGYTKRYVRCLQISEVVNSMKDLIDYSRVTGTGPMESLAKFPRRTSGASGFHSPSQQPEDQLQQQQQQQQTVGQNSNSESSVQANAMQLATSNGVANVNNSLNPASASSTASTIVGLLHQNSMNSRQQNTVNNASSPYGGSSVQMPSPGSSNNIPQAQPNPSPFQSPTPSSSNNPPQTSHSALTAANHMSSASSPANISVQQPALSGEADPRALSGDADPSDSQSAVQKILHEMMLCSHLNGGSGGGGGMVGVGSLGNDVKNVNDIMATGNNTVLNGGNGLVGNGTVNNNPGIGTGGYGNMGGGLGQSAMVNGIRAAMGNNSMMNGRVGMTAMARDQSMNHQQDLGNQLLNGLGAVNGFNNLQFDWKPSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcriptional corepressor SEUSS DNA-binding adapter subunit of the SEU-LUG transcriptional corepressor of the C class floral homeotic gene AGAMOUS during the early stages of floral meristem development. Is part of the A class cadastral complex that define the boundaries between the A and C class homeotic genes expression and function. Interacts together with APETALA2 and LEUNIG to repress AGAMOUS expression.probableQ8W234

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SYJ, chain A
Confidence level:probable
Coverage over the Query: 362-651
View the alignment between query and template
View the model in PyMOL