Citrus Sinensis ID: 005651

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-----

MTDYRLPSTMNLWTDDNGSVMEAFMSSDLTGIWPPSQSSASTADPMKTHISSSSQQQQQQQQFFNQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEKGKSSKIKTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGGGGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVIIQNSDLMNKVRFLFNFNGSMEIGTWPSAMQNPDQGENDPSSWINDPSPTPAPTAGFIEIKDSTAAATTTTTTTTTTTTPAIGSGSASNLSKGIHFELPSSVSLTESVDLQHQQIPQTQSFFTRELNFSEYAYDHNSVKNGSSRLFKPESGEILNFAESKRSSCTGNGNNSLLSNHSQFVAEDSNKKKRSPTSRGSTEEGMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKELASVKKELAGGGKDSHSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLEVNHASMSVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVGDTQ

cccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHccccccEEEEEEEEcccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEEEccEEcccccccccccccccEEcccccEEEcccccccccccccccccccccccEEEEEEccccEEEEccccEEcccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEccccccHHHHHHHHHHccccEEEEEEEEEcccEEEEEEEEEEccccccHHHHHHHHHHHHHHcc

*******STMNLWTDDNGSVMEAFMSSDLTGIWPPS************************************LQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGE***************************N************DAVDEEVTDTEWFFLISMTQSFYVTGGGGGGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVIIQNSDLMNKVRFLFNFNGSME****************************************************************************************************************************************************************************************************************************************************************QRFYALRAVVPNVSKMDKASLLGDAISYINELR***************************************************IDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLEVNHASMSVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVG***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MTDYRLPSTMNLWTDDNGSVMEAFMSSDLTGIWPPSQSSASTADPMKTHISSSSQQQQQQQQFFNQETLQQRLQQLIEGSREGWTYAIFWQSSCDYSGSSMLGWGDGYYKGEGEKGKSSKIKTSSAAEQEHRKKVLRELNSLISGSTSSPTDDAVDEEVTDTEWFFLISMTQSFYVTGGGGGGGLPGQAYFGNSPVWVSGAERLANSGCDRARQGQVFGLQTLVCIPSANGVVELGSTEVIIQNSDLMNKVRFLFNFNGSMEIGTWPSAMQNPDQGENDPSSWINDPSPTPAPTAGFIEIKDSTAAATTTTTTTTTTTTPAIGSGSASNLSKGIHFELPSSVSLTESVDLQHQQIPQTQSFFTRELNFSEYAYDHNSVKNGSSRLFKPESGEILNFAESKRSSCTGNGNNSLLSNHSQFVAEDSNKKKRSPTSRGSTEEGMLSFTSGVILPSSGVVKSSGGAGDSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYxxxxxxxxxxxxxxxxxxxxxxxxxxxxLAGGGKDSHSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLEVNHASMSVVNDLMIQQATVKMGSRFYTQEQLKNVLAAKVGDTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Transcription factor MYC2	Transcriptional activator. Common transcription factor of light, abscisic acid (ABA), and jasmonic acid (JA) signaling pathways. In cooperation with MYB2 is involved in the regulation of ABA-inducible genes under drought stress conditions. Binds to the MYC recognition site (5'-CACATG-3'), and to the G-box (5'-CACNTG-3') and Z-box (5'-ATACGTGT-3') of light-responsive promoters. Negative regulator of blue light-mediated photomorphogenic growth and blue- and far-red-light regulated gene expression. Positive regulator of lateral root formation.	probable	Q39204

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NKP, chain B
Confidence level:very confident
Coverage over the Query: 502-576
View the alignment between query and template
View the model in PyMOL

Template: 3DBA, chain A
Confidence level:probable
Coverage over the Query: 173-255
View the alignment between query and template
View the model in PyMOL

Template: 3P96, chain A
Confidence level:probable
Coverage over the Query: 614-680
View the alignment between query and template
View the model in PyMOL