Citrus Sinensis ID: 005673


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680----
MGQFQAGGFLVSSNGHAVAEETELSENVYSMNDYADTASLLEQDIRAGPSNQSGLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVTAEMVEKTIFVVFFSGEQARTKILKICEAFGANCYPVSEDLTKQRQIIREVLSRLSELEATLDAGIRHRNKALTSIGFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEVLQRATFDSNSQVGTIFHVMDSMESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYAVITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIRYQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPLQILLLLLATVAVPWMLFPKPFILRKLHTERFQGRTYGILGTSEMDLEVEPDSARQHHEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALINDEED
cccccccHHHHHccccHHHHHHHccHHHccccccccHHHHHHHHccccccccccccEEEEEEccccHHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEECcccHHHHHHHHHHHHccccccccEEEccccccccccccccccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc
**QFQAGGF********************************************GLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVTAEMVEKTIFVVFFSGEQARTKILKICEAFGANCYPVSEDLTKQRQIIREVLSRLSELEATLDAGIRHRNKALTSIGFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEVLQRATFDSNSQVGTIFHVMDSMESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYAVITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIRYQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPLQILLLLLATVAVPWMLFPKPFILRKLHTERF*************************HEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQFQAGGFLVSSNGHAVAEETELSENVYSMNDYADTASLLEQDIRAGPSNQSGLRFISGIICKSKVLRFERMLFRATRGNMLFNQAPADEEIMDPVTAEMVEKTIFVVFFSGEQARTKILKICEAFGANCYPVSEDLTKQRQIIREVLSRLSELEATLDAGIRHRNKALTSIGFHLTKWMNMVRREKAVYDTLNMLNFDVTKKCLVGEGWCPIFAKAQIQEVLQRATFDSNSQVGTIFHVMDSMESPPTYFRTNRFTNAFQEIVDAYGVARYQEANPAVYAVITFPFLFAVMFGDWGHGICLLLGALVLIARERKLGNQKLGSFMEMLFGGRYVLLLMSLFSIYCGLIYNEFFSVPYHIFGGSAYRCRDTTCSDAYTAGLVKYREPYPFGVDPSWRGSRSELPFLNSLKMKMSILLGVTQMNLGIILSYFDARFFGSSLDIRYQFVPQLIFLNSLFGYLSLLIIIKWCTGSQADLYHVMIYMFLSPTDDLGENELFWGQRPLQILLLLLATVAVPWMLFPKPFILRKLHTERFQGRTYGILGTSEMDLEVEPDSARQHHEDFNFSEIFVHQMIHSIEFVLGAVSNTASYLRLWALSLAHSELSTVFYEKVLLLAWGYDNLVIRLVGLAVFAFATAFILLMMETLSAFLHALRLHWVEFQNKFYHGDGYKFRPFSFALINDEED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar proton ATPase a1 Essential component of the vacuolar proton pump (V-ATPase), a multimeric enzyme that catalyzes the translocation of protons across the membranes. Required for assembly and activity of the V-ATPase. Required during cell expansion.confidentQ8RWZ7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RRK, chain A
Confidence level:very confident
Coverage over the Query: 51-85,97-237
View the alignment between query and template
View the model in PyMOL
Template: 2NVJ, chain A
Confidence level:very confident
Coverage over the Query: 578-602
View the alignment between query and template
View the model in PyMOL