Citrus Sinensis ID: 005711

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-

MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV

ccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccEEcccccccEEEEEccccccCECccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEcccccccccccccHHHHHccccccEEEEEccccEEEccHHHHccccccEEEccccccccccccccccccEEccccccccccccHHccccccccEEcccccccCCcccccccccccccccccccccccccccHHHHccccccEEcccccccCECccHHHHcccccccccEEEccccccccccccccccccccccccccccEEcccccccccccccccEEEccccccEEccccccccccccccccccccCEcccccccccccccccEEEccccCCcccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccCEEccccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccccccHHcccccccccccccccccCCcccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccc

******LNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVP*****EEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRY******

xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Leucine-rich repeat receptor-like protein CLAVATA2	Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance. Involved in controlling the stem cell population size in shoot and root apical meristems, and during organ development. Promotes the formation of CLV1 multimers.	probable	O80809

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 81-619
View the alignment between query and template
View the model in PyMOL

Template: 2Z81, chain A
Confidence level:very confident
Coverage over the Query: 62-501,519-573
View the alignment between query and template
View the model in PyMOL

Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 40-627
View the alignment between query and template
View the model in PyMOL