Citrus Sinensis ID: 005711


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-
MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
ccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccEEcccccccEEEEEccccccEEEccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccEEcccccccccccccHHHHHccccccEEEEEccccEEEccHHHHccccccEEEccccccccccccccccccEEccccccccccccHHccccccccEEcccccccEEcccccccccccccccccccccccccccHHHHccccccEEcccccccEEEccHHHHcccccccccEEEccccccccccccccccccccccccccccEEcccccccccccccccEEEccccccEEccccccccccccccccccccEEcccccccccccccccEEEccccEEcccccHHccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccccccccccccccccEEEccccccccccccHHHHccccccEEEccccccccccccccccccccccccccccccccccHHcccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHHHHHHHHHHHHHHHccccHHcccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccccEEEEEEcccccEEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccccEEEEEccccccccccHHHHHHccHcccEEEcccccccccccHHHcccccccEEEccccccccccccccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccccEEEEccccccEEcccHHHHHcccccEEEccccEEEEEccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccccccccccEEEccccccEEcccHHHHHcccccEEEccccEEEEEcccHcccccccEEEcccccccccccHHHcccccccEEEEcccccccccccccccccccHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc
melkrdlnVHSCRALKLQMLPLLLFLLLLcsnpseslelnLEDKASLLLFKSLvqdptqklsswvgsnctnwtgvacnfqtghvvsinltdtslsgqvhprlckLSFLEFLVLSsnaftgristcfgglsglktldlsynkfvgVVPDAIMKLRNLRELILkgnpelggvfpgwvgnfsmnleklDFSFNSFCGEIPESLYYLKslkhldleknnltgnvHDFYQSLLVLNlgsnrfsgtlpCFAASAMSLTVLkldnnsvvggIPTCIASLQALTHLnlshnhlnyeispRLVFFEKLLLLDLsfndlsgplpskiaqTTEKAGLVLLDlshnrfsgeipLKITELKSLQALFLsnnlligeiparignLTYLQVIDLShnmlsgsiplniVGCFQLLALIVnnnnlsgeiqpeldaldslkildisnnqisgeipltlaglksleivdfssnnlsgslnDAITKWTNLKYFSIARNKlsgnlpnwLFSFQAIQMMDfstnkfmgfipdavgmdlsdnllhgtipkglfqlqgleylnlsfnfldgqvpglyrlrslraldlshnsltgqipgnisSLQELTLLNLsynsfsgfvpwkqgyqkfpgafagnpnlclesshgecnrtslplvpgktlreemtegpISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
melkrdlnVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
MELKRDLNVHSCRAlklqmlplllfllllCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALThlnlshnhlnYEISPRLVFFEKlllldlsfndlsGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
******LNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYIL****
**************LKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSH*************************SIWAFCLSFFVSFYLGVVALFCSART**Y******
MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVP*****EEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRR*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDAVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFCSARTRRYILQTKV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query681 2.2.26 [Sep-21-2011]
O80809720 Leucine-rich repeat recep yes no 0.945 0.894 0.612 0.0
Q8VZG8 1045 Probable LRR receptor-lik no no 0.870 0.567 0.314 1e-73
Q9FL28 1173 LRR receptor-like serine/ no no 0.787 0.456 0.327 1e-70
Q42371 976 LRR receptor-like serine/ no no 0.769 0.536 0.341 4e-70
Q9LHP4 1141 Receptor-like protein kin no no 0.778 0.464 0.350 9e-68
Q9LVP0 1102 Probable leucine-rich rep no no 0.823 0.509 0.341 2e-67
O49545 1003 Leucine-rich repeat recep no no 0.817 0.555 0.357 5e-67
O82318 960 Probably inactive leucine no no 0.869 0.616 0.332 8e-67
Q9SSL9 1123 Leucine-rich repeat recep no no 0.753 0.456 0.327 5e-65
P93194 1109 Receptor-like protein kin N/A no 0.863 0.530 0.308 5e-65
>sp|O80809|CLV2_ARATH Leucine-rich repeat receptor-like protein CLAVATA2 OS=Arabidopsis thaliana GN=CLV2 PE=1 SV=1 Back     alignment and function desciption
 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/692 (61%), Positives = 521/692 (75%), Gaps = 48/692 (6%)

Query: 38  ELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQ 97
           +L+ +DKASLL+F+  + D  + LS+W GS+C+NWTG+AC   TG V+S+ L+  +LS Q
Sbjct: 29  DLDPQDKASLLIFRVSIHDLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLNLSSQ 88

Query: 98  VHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLR 157
           +HP LCKLS L+ L LS N F+G I +CFG L  L+TL+LS N+FVG +P   + L+ LR
Sbjct: 89  IHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSLKELR 148

Query: 158 ELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLT 217
           E++L  N +LGGV P W GNFSMNLE++DFSF SF GE+PESL YLKSLK+L+LE NN+T
Sbjct: 149 EVVLSENRDLGGVVPHWFGNFSMNLERVDFSFCSFVGELPESLLYLKSLKYLNLESNNMT 208

Query: 218 GNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTH 277
           G + DF Q L+VLNL SN+FSGTLPCF AS  SL++L +  NS+VGG+P+C+ SL+ L+H
Sbjct: 209 GTLRDFQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLPSCLGSLKELSH 268

Query: 278 LNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFS 337
           LNLS N  NYEISPRL+F EKL++LDLS N  SG LPS+I++TTEK GLVLLDLSHN FS
Sbjct: 269 LNLSFNGFNYEISPRLMFSEKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLDLSHNSFS 328

Query: 338 GEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQ 397
           G+IPL+ITELKSLQAL LS+NLL G+IPARIGNLTYLQVIDLSHN L+GSIPLNIVGCFQ
Sbjct: 329 GDIPLRITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIVGCFQ 388

Query: 398 LLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLS 457
           LLAL+++NNNLSGEIQPELDALDSLKILDISNN ISGEIPLTLAGLKSLEIVD SSNNLS
Sbjct: 389 LLALMISNNNLSGEIQPELDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISSNNLS 448

Query: 458 GSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPD------- 510
           G+LN+AITKW+NLKY S+ARNK SG LP+WLF F  IQM+D+S+N+F  FIPD       
Sbjct: 449 GNLNEAITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSNRFSWFIPDDNLNSTR 508

Query: 511 -----------------------------------------AVGMDLSDNLLHGTIPKGL 529
                                                     VG+DLSDNLLHG IP+ L
Sbjct: 509 FKDFQTGGGEGFAEPPGKVEIKISAAVVAKDELSFSYNLLSMVGIDLSDNLLHGEIPEAL 568

Query: 530 FQLQGLEYLNLSFNFLDGQVPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSY 589
           F+ + +EYLNLS+NFL+GQ+P L +L  L+ALDLSHNSL+GQ+ GNIS+   LTLLNLS+
Sbjct: 569 FRQKNIEYLNLSYNFLEGQLPRLEKLPRLKALDLSHNSLSGQVIGNISAPPGLTLLNLSH 628

Query: 590 NSFSGFVPWKQGYQKFPGAFAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIW 649
           N FSG +  K+G  KFPGA AGNP LC+E+   +C+  ++     +  + E+ EGPISIW
Sbjct: 629 NCFSGIITEKEGLGKFPGALAGNPELCVETPGSKCDPANIDASQEEIYQNELVEGPISIW 688

Query: 650 AFCLSFFVSFYLGVVALFCSARTRRYILQTKV 681
            FCLS F+SF  GV+ +FCSAR R YILQTK 
Sbjct: 689 IFCLSAFISFDFGVLGIFCSARARSYILQTKA 720




Involved in the perception of CLV3 and CLV3-like peptides, that act as extracellular signals regulating meristems maintenance. Involved in controlling the stem cell population size in shoot and root apical meristems, and during organ development. Promotes the formation of CLV1 multimers.
Arabidopsis thaliana (taxid: 3702)
>sp|Q8VZG8|Y4885_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g08850 OS=Arabidopsis thaliana GN=At4g08850 PE=1 SV=3 Back     alignment and function description
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q42371|ERECT_ARATH LRR receptor-like serine/threonine-protein kinase ERECTA OS=Arabidopsis thaliana GN=ERECTA PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LVP0|Y5639_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g63930 OS=Arabidopsis thaliana GN=At5g63930 PE=1 SV=1 Back     alignment and function description
>sp|O49545|BAME1_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1 OS=Arabidopsis thaliana GN=BAM1 PE=1 SV=1 Back     alignment and function description
>sp|O82318|Y2579_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At2g25790 OS=Arabidopsis thaliana GN=At2g25790 PE=1 SV=1 Back     alignment and function description
>sp|Q9SSL9|PEPR1_ARATH Leucine-rich repeat receptor-like protein kinase PEPR1 OS=Arabidopsis thaliana GN=PEPR1 PE=1 SV=1 Back     alignment and function description
>sp|P93194|RPK1_IPONI Receptor-like protein kinase OS=Ipomoea nil GN=INRPK1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query681
255543116730 serine-threonine protein kinase, plant-t 0.995 0.928 0.687 0.0
224128812725 predicted protein [Populus trichocarpa] 0.948 0.891 0.690 0.0
225431007740 PREDICTED: leucine-rich repeat receptor- 0.951 0.875 0.659 0.0
307135992754 serine-threonine protein kinase [Cucumis 0.982 0.887 0.649 0.0
449449617754 PREDICTED: leucine-rich repeat receptor- 0.955 0.863 0.653 0.0
449485363754 PREDICTED: LOW QUALITY PROTEIN: leucine- 0.955 0.863 0.652 0.0
356530025717 PREDICTED: leucine-rich repeat receptor- 0.967 0.919 0.639 0.0
356566941717 PREDICTED: leucine-rich repeat receptor- 0.967 0.919 0.636 0.0
357507683719 Receptor-like protein kinase [Medicago t 0.967 0.916 0.631 0.0
336088213724 leucine-rich repeat receptor-like protei 0.953 0.896 0.638 0.0
>gi|255543116|ref|XP_002512621.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223548582|gb|EEF50073.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/733 (68%), Positives = 581/733 (79%), Gaps = 55/733 (7%)

Query: 1   MELKRDLNVHSCRALKLQMLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQK 60
           MELK  L +  C+ LKL +L   L  LLLCS  S  ++L+ ED+ASL+ F++ +Q+P + 
Sbjct: 1   MELKWVLAIGHCKILKLHLL-PFLISLLLCSYQSHCIDLHPEDRASLIKFRAHIQEPNRY 59

Query: 61  L-SSWVGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFT 119
           L S+WVGSNCTNWTG+AC  QTG V+SINLT+ +LSG +HP LC+L  LE LVLS N FT
Sbjct: 60  LLSTWVGSNCTNWTGIACENQTGRVISINLTNMNLSGYIHPNLCRLISLESLVLSENGFT 119

Query: 120 GRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFS 179
           G+I  CFG L  LK LDLS+N+F G VPD +M+L  LREL L GN +LGG  P WVGNFS
Sbjct: 120 GQIPLCFGWLQNLKVLDLSHNRFGGAVPDTLMRLSQLRELNLNGNHDLGGPLPLWVGNFS 179

Query: 180 MNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSG 239
            +LEKLD SFNSF GEIPESL++L SLK+LDL  N L+GN+HDFYQSL+VLNLGSN FSG
Sbjct: 180 SSLEKLDMSFNSFQGEIPESLFHLNSLKYLDLRNNFLSGNLHDFYQSLVVLNLGSNTFSG 239

Query: 240 TLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKL 299
           TLPCF+AS  SL VL L NNS++GGIPTCI+SL+ L HLNLS NHLN+ ISPRLVF E+L
Sbjct: 240 TLPCFSASVQSLNVLNLANNSIMGGIPTCISSLKELRHLNLSFNHLNHAISPRLVFSEEL 299

Query: 300 LLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNL 359
           L LDLSFNDLSGPLP+KIA+TTEK+GLVLLDLSHNRFSG IPLKITELKSLQALFLS+NL
Sbjct: 300 LELDLSFNDLSGPLPTKIAETTEKSGLVLLDLSHNRFSGGIPLKITELKSLQALFLSHNL 359

Query: 360 LIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDAL 419
           L GEIPARIGNLTYLQVIDLSHN LSGSIPLNIVGCFQLLAL++NNNNLSGEIQPELDAL
Sbjct: 360 LSGEIPARIGNLTYLQVIDLSHNSLSGSIPLNIVGCFQLLALVLNNNNLSGEIQPELDAL 419

Query: 420 DSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNK 479
           DSLKILDI+NN+ISGEIPLTLAG +SLEIVDFSSNNLSG+LNDAITKW+NL+Y S+ARNK
Sbjct: 420 DSLKILDINNNKISGEIPLTLAGCRSLEIVDFSSNNLSGNLNDAITKWSNLRYLSLARNK 479

Query: 480 LSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDA---------------------------- 511
            +G+LP+WLF+F AIQ+MDFS NKF GFIPD                             
Sbjct: 480 FTGSLPSWLFTFDAIQLMDFSGNKFSGFIPDGNFNISLNFNNGDIVQRLPTESFILLQAV 539

Query: 512 -----------------------VGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQ 548
                                  VG+DLSDNLLHG IP+ LF LQGLEYLNLS+NFLDG+
Sbjct: 540 EIKISVLVVDSNELSFSYHLSSVVGIDLSDNLLHGEIPESLFGLQGLEYLNLSYNFLDGE 599

Query: 549 VPGLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGA 608
           +PGL ++ SLRALDLSHNSL+GQIPGNISSL+ LTLLNLSYNSFSGFVP K+GY+KFPGA
Sbjct: 600 IPGLEKMSSLRALDLSHNSLSGQIPGNISSLKGLTLLNLSYNSFSGFVPKKEGYRKFPGA 659

Query: 609 FAGNPNLCLESSHGECNRTSLPLVPGKTLREEMTEGPISIWAFCLSFFVSFYLGVVALFC 668
           FAGNP+LC+ESS G C+  SLP VPGK+  EEM EGPIS+W FCL  F+SFY GV+ L C
Sbjct: 660 FAGNPDLCVESSGGRCDAASLPAVPGKS-SEEM-EGPISVWVFCLGAFISFYFGVMVLCC 717

Query: 669 SARTRRYILQTKV 681
           SAR R+YILQTKV
Sbjct: 718 SARARKYILQTKV 730




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224128812|ref|XP_002328973.1| predicted protein [Populus trichocarpa] gi|222839207|gb|EEE77558.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225431007|ref|XP_002272643.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2 [Vitis vinifera] gi|297735293|emb|CBI17655.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|307135992|gb|ADN33850.1| serine-threonine protein kinase [Cucumis melo subsp. melo] Back     alignment and taxonomy information
>gi|449449617|ref|XP_004142561.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449485363|ref|XP_004157145.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like protein CLAVATA2-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356530025|ref|XP_003533585.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2-like [Glycine max] Back     alignment and taxonomy information
>gi|356566941|ref|XP_003551683.1| PREDICTED: leucine-rich repeat receptor-like protein CLAVATA2-like [Glycine max] Back     alignment and taxonomy information
>gi|357507683|ref|XP_003624130.1| Receptor-like protein kinase [Medicago truncatula] gi|355499145|gb|AES80348.1| Receptor-like protein kinase [Medicago truncatula] Back     alignment and taxonomy information
>gi|336088213|dbj|BAK39955.1| leucine-rich repeat receptor-like protein [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query681
TAIR|locus:2206245720 CLV2 "clavata 2" [Arabidopsis 0.826 0.781 0.590 1.2e-170
UNIPROTKB|Q940E8613 fea2 "Fasciated ear2" [Zea may 0.571 0.634 0.451 4.5e-82
TAIR|locus:2043540 960 AT2G25790 [Arabidopsis thalian 0.889 0.631 0.322 1e-68
TAIR|locus:4515102753598 AT1G73066 [Arabidopsis thalian 0.810 0.923 0.337 2.1e-68
TAIR|locus:2005540 999 HAE "HAESA" [Arabidopsis thali 0.850 0.579 0.337 2.8e-68
TAIR|locus:2025545 1029 AT1G08590 [Arabidopsis thalian 0.842 0.557 0.329 2.1e-66
TAIR|locus:2160791 1102 AT5G63930 [Arabidopsis thalian 0.819 0.506 0.328 2.1e-66
TAIR|locus:2169965 1003 BAM1 "BARELY ANY MERISTEM 1" [ 0.837 0.568 0.344 5.8e-66
TAIR|locus:2139885 1013 AT4G28650 [Arabidopsis thalian 0.832 0.559 0.325 1.4e-65
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.797 0.477 0.338 2.4e-65
TAIR|locus:2206245 CLV2 "clavata 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1659 (589.1 bits), Expect = 1.2e-170, P = 1.2e-170
 Identities = 334/566 (59%), Positives = 418/566 (73%)

Query:    34 SESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSNCTNWTGVACNFQTGHVVSINLTDTS 93
             S+  +L+ +DKASLL+F+  + D  + LS+W GS+C+NWTG+AC   TG V+S+ L+  +
Sbjct:    25 SQLPDLDPQDKASLLIFRVSIHDLNRSLSTWYGSSCSNWTGLACQNPTGKVLSLTLSGLN 84

Query:    94 LSGQVHPRLCKLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKL 153
             LS Q+HP LCKLS L+ L LS N F+G I +CFG L  L+TL+LS N+FVG +P   + L
Sbjct:    85 LSSQIHPSLCKLSSLQSLDLSHNNFSGNIPSCFGSLRNLRTLNLSRNRFVGSIPATFVSL 144

Query:   154 RNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDLEK 213
             + LRE++L  N +LGGV P W GNFSMNLE++DFSF SF GE+PESL YLKSLK+L+LE 
Sbjct:   145 KELREVVLSENRDLGGVVPHWFGNFSMNLERVDFSFCSFVGELPESLLYLKSLKYLNLES 204

Query:   214 NNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQ 273
             NN+TG + DF Q L+VLNL SN+FSGTLPCF AS  SL++L +  NS+VGG+P+C+ SL+
Sbjct:   205 NNMTGTLRDFQQPLVVLNLASNQFSGTLPCFYASRPSLSILNIAENSLVGGLPSCLGSLK 264

Query:   274 ALTXXXXXXXXXXYEISPRLVFFEKXXXXXXXXXXXXGPLPSKIAQTTEKAGLVLLDLSH 333
              L+          YEISPRL+F EK            G LPS+I++TTEK GLVLLDLSH
Sbjct:   265 ELSHLNLSFNGFNYEISPRLMFSEKLVMLDLSHNGFSGRLPSRISETTEKLGLVLLDLSH 324

Query:   334 NRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIV 393
             N FSG+IPL+ITELKSLQAL LS+NLL G+IPARIGNLTYLQVIDLSHN L+GSIPLNIV
Sbjct:   325 NSFSGDIPLRITELKSLQALRLSHNLLTGDIPARIGNLTYLQVIDLSHNALTGSIPLNIV 384

Query:   394 GCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSS 453
             GCFQLLAL+++NNNLSGEIQPELDALDSLKILDISNN ISGEIPLTLAGLKSLEIVD SS
Sbjct:   385 GCFQLLALMISNNNLSGEIQPELDALDSLKILDISNNHISGEIPLTLAGLKSLEIVDISS 444

Query:   454 NNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPDA-V 512
             NNLSG+LN+AITKW+NLKY S+ARNK SG LP+WLF F  IQM+D+S+N+F  FIPD  +
Sbjct:   445 NNLSGNLNEAITKWSNLKYLSLARNKFSGTLPSWLFKFDKIQMIDYSSNRFSWFIPDDNL 504

Query:   513 GMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFL-DGQVPGLYRLRSLRALDLSHNSLTGQ 571
                   +   G   +G  +  G   + +S   +   ++   Y L S+  +DLS N L G+
Sbjct:   505 NSTRFKDFQTGG-GEGFAEPPGKVEIKISAAVVAKDELSFSYNLLSMVGIDLSDNLLHGE 563

Query:   572 IPGNISSLQELTLLNLSYNSFSGFVP 597
             IP  +   + +  LNLSYN   G +P
Sbjct:   564 IPEALFRQKNIEYLNLSYNFLEGQLP 589


GO:0005886 "plasma membrane" evidence=ISM
GO:0007165 "signal transduction" evidence=TAS
GO:0016020 "membrane" evidence=ISS
GO:0048507 "meristem development" evidence=RCA;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0033612 "receptor serine/threonine kinase binding" evidence=IPI
GO:0009855 "determination of bilateral symmetry" evidence=RCA
GO:0009886 "post-embryonic morphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=IMP;RCA
GO:0009965 "leaf morphogenesis" evidence=RCA
GO:0010014 "meristem initiation" evidence=RCA
GO:0010073 "meristem maintenance" evidence=RCA
GO:0016570 "histone modification" evidence=RCA
GO:0048449 "floral organ formation" evidence=RCA
GO:0048481 "ovule development" evidence=RCA
GO:0009653 "anatomical structure morphogenesis" evidence=IMP
GO:0040008 "regulation of growth" evidence=IMP
UNIPROTKB|Q940E8 fea2 "Fasciated ear2" [Zea mays (taxid:4577)] Back     alignment and assigned GO terms
TAIR|locus:2043540 AT2G25790 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102753 AT1G73066 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005540 HAE "HAESA" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025545 AT1G08590 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2160791 AT5G63930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2169965 BAM1 "BARELY ANY MERISTEM 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139885 AT4G28650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O80809CLV2_ARATHNo assigned EC number0.61270.94560.8944yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00870064
hypothetical protein (725 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query681
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-92
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-15
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-14
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-11
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 5e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 8e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 2e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam0826342 pfam08263, LRRNT_2, Leucine rich repeat N-terminal 3e-07
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 3e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
PLN032101153 PLN03210, PLN03210, Resistant to P 2e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 4e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.002
PLN032101153 PLN03210, PLN03210, Resistant to P 0.004
COG5238388 COG5238, RNA1, Ran GTPase-activating protein (RanG 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  306 bits (786), Expect = 3e-92
 Identities = 208/591 (35%), Positives = 296/591 (50%), Gaps = 49/591 (8%)

Query: 19  MLPLLLFLLLLCSNPSESLELNLEDKASLLLFKSLVQDPTQKLSSWVGSN-CTNWTGVAC 77
            L  +LF L L  +   + EL L     LL FKS + DP + LS+W  S     W G+ C
Sbjct: 11  YLIFMLFFLFLNFSMLHAEELEL-----LLSFKSSINDPLKYLSNWNSSADVCLWQGITC 65

Query: 78  NFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGRI-STCFGGLSGLKTLD 136
           N  +  VVSI+L+  ++SG++   + +L +++ + LS+N  +G I    F   S L+ L+
Sbjct: 66  N-NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLN 124

Query: 137 LSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEI 196
           LS N F G +P                                 NLE LD S N   GEI
Sbjct: 125 LSNNNFTGSIP----------------------------RGSIPNLETLDLSNNMLSGEI 156

Query: 197 PESLYYLKSLKHLDLEKNNLTGNVHDF---YQSLLVLNLGSNRFSGTLPCFAASAMSLTV 253
           P  +    SLK LDL  N L G + +      SL  L L SN+  G +P       SL  
Sbjct: 157 PNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKW 216

Query: 254 LKLDNNSVVGGIPTCIASLQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPL 313
           + L  N++ G IP  I  L +L HL+L +N+L   I   L   + L  L L  N LSGP+
Sbjct: 217 IYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPI 276

Query: 314 PSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTY 373
           P  I    +   L+ LDLS N  SGEIP  + +L++L+ L L +N   G+IP  + +L  
Sbjct: 277 PPSIFSLQK---LISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPR 333

Query: 374 LQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQIS 433
           LQV+ L  N  SG IP N+     L  L ++ NNL+GEI   L +  +L  L + +N + 
Sbjct: 334 LQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLE 393

Query: 434 GEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQA 493
           GEIP +L   +SL  V    N+ SG L    TK   + +  I+ N L G + +  +   +
Sbjct: 394 GEIPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPS 453

Query: 494 IQMMDFSTNKFMGFIPDAVG------MDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDG 547
           +QM+  + NKF G +PD+ G      +DLS N   G +P+ L  L  L  L LS N L G
Sbjct: 454 LQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQLKLSENKLSG 513

Query: 548 QVPG-LYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVP 597
           ++P  L   + L +LDLSHN L+GQIP + S +  L+ L+LS N  SG +P
Sbjct: 514 EIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIP 564


Length = 968

>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215633 PLN03210, PLN03210, Resistant to P Back     alignment and domain information
>gnl|CDD|227563 COG5238, RNA1, Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 681
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
PLN032101153 Resistant to P. syringae 6; Provisional 99.91
KOG4237498 consensus Extracellular matrix protein slit, conta 99.87
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
KOG4237498 consensus Extracellular matrix protein slit, conta 99.85
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.83
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.74
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.65
KOG0617264 consensus Ras suppressor protein (contains leucine 99.63
PLN03150623 hypothetical protein; Provisional 99.58
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.23
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.16
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.11
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.1
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.04
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.97
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.96
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.93
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.89
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.88
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.87
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.81
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.78
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.77
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.74
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.6
PF0826343 LRRNT_2: Leucine rich repeat N-terminal domain; In 98.4
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.36
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.31
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.23
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.19
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.17
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.02
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.01
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.84
KOG2982418 consensus Uncharacterized conserved protein [Funct 97.84
PRK15386 426 type III secretion protein GogB; Provisional 97.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.66
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.59
PRK15386426 type III secretion protein GogB; Provisional 97.59
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.24
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.2
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.12
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.11
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.03
KOG4341483 consensus F-box protein containing LRR [General fu 96.82
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.76
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 96.72
KOG4341483 consensus F-box protein containing LRR [General fu 96.61
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 95.66
KOG2123388 consensus Uncharacterized conserved protein [Funct 95.23
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.21
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 95.18
KOG2123388 consensus Uncharacterized conserved protein [Funct 93.89
KOG1947482 consensus Leucine rich repeat proteins, some prote 93.68
KOG0473326 consensus Leucine-rich repeat protein [Function un 93.15
KOG1947482 consensus Leucine rich repeat proteins, some prote 92.73
KOG4308478 consensus LRR-containing protein [Function unknown 92.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.48
KOG4308478 consensus LRR-containing protein [Function unknown 90.03
KOG3864221 consensus Uncharacterized conserved protein [Funct 90.01
KOG0473 326 consensus Leucine-rich repeat protein [Function un 87.6
smart0037026 LRR Leucine-rich repeats, outliers. 84.9
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.9
smart0037026 LRR Leucine-rich repeats, outliers. 84.89
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 84.89
KOG3864221 consensus Uncharacterized conserved protein [Funct 83.02
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 80.86
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.7e-75  Score=689.59  Aligned_cols=570  Identities=37%  Similarity=0.581  Sum_probs=537.0

Q ss_pred             HHhHHHHHHHHhcCCCCCCCCCCC-CCCCCCCCCceeecCCCCcEEEEEcCCCCCcccccccccCCCCCCEEECCCCcCC
Q 005711           41 LEDKASLLLFKSLVQDPTQKLSSW-VGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFT  119 (681)
Q Consensus        41 ~~~~~~l~~~~~~~~~~~~~~~~w-~~~~cc~w~gv~c~~~~~~v~~L~L~~~~l~g~~~~~l~~l~~L~~L~Ls~n~l~  119 (681)
                      ++|+.||++||+.+.+|.+.+.+| ..++||.|+||+|+ ..++|++|+|+++.+.|.+++.+..+++|++|+|++|.+.
T Consensus        28 ~~~~~~l~~~~~~~~~~~~~~~~w~~~~~~c~w~gv~c~-~~~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~  106 (968)
T PLN00113         28 AEELELLLSFKSSINDPLKYLSNWNSSADVCLWQGITCN-NSSRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLS  106 (968)
T ss_pred             HHHHHHHHHHHHhCCCCcccCCCCCCCCCCCcCcceecC-CCCcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccC
Confidence            467789999999998887778999 56799999999998 4679999999999999999999999999999999999999


Q ss_pred             cccccccc-CCCCCCEEEccCCCCCCcCCccccCCCCCCEeeCCCCCCCCccCCchhccccCCccEEEccCCcCccccCc
Q 005711          120 GRISTCFG-GLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPE  198 (681)
Q Consensus       120 ~~~~~~~~-~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~~~~~~~p~~l~~l~~~L~~L~L~~n~l~~~~p~  198 (681)
                      +.+|..+. .+++|++|+|++|++++.+|.  +.+++|++|++++| .+.+.+|..++++ ++|++|++++|.+.+.+|.
T Consensus       107 ~~ip~~~~~~l~~L~~L~Ls~n~l~~~~p~--~~l~~L~~L~Ls~n-~~~~~~p~~~~~l-~~L~~L~L~~n~l~~~~p~  182 (968)
T PLN00113        107 GPIPDDIFTTSSSLRYLNLSNNNFTGSIPR--GSIPNLETLDLSNN-MLSGEIPNDIGSF-SSLKVLDLGGNVLVGKIPN  182 (968)
T ss_pred             CcCChHHhccCCCCCEEECcCCccccccCc--cccCCCCEEECcCC-cccccCChHHhcC-CCCCEEECccCcccccCCh
Confidence            88887655 999999999999999998886  56899999999999 5678899999999 8999999999999999999


Q ss_pred             cccCCCCCCEEEccCccCcccccCcC---CcccEEECCCCCCccccchhhccCCCCCEEEccCCccccCCChhhcccCcc
Q 005711          199 SLYYLKSLKHLDLEKNNLTGNVHDFY---QSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIASLQAL  275 (681)
Q Consensus       199 ~l~~l~~L~~L~L~~n~l~~~~~~~~---~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~l~~L  275 (681)
                      .++++++|++|++++|.+.+.+|..+   .+|++|++++|.+++.+|..++.+++|++|++++|.+.+.+|..++++++|
T Consensus       183 ~~~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L  262 (968)
T PLN00113        183 SLTNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNL  262 (968)
T ss_pred             hhhhCcCCCeeeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCC
Confidence            99999999999999999999888755   459999999999999999999999999999999999999999999999999


Q ss_pred             cEEecCCCccccccCccccCCCCCcEEeccCCCccCCCChhhhhcccCCCccEEEccCCCCcCCCcccccCCCCCCEEec
Q 005711          276 THLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFL  355 (681)
Q Consensus       276 ~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~L  355 (681)
                      ++|++++|.+.+.+|..+..+++|+.|++++|.+.+.+|..+..+.   +|+.|++++|.+++.+|..+..+++|+.|++
T Consensus       263 ~~L~L~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~---~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L  339 (968)
T PLN00113        263 QYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQ---NLEILHLFSNNFTGKIPVALTSLPRLQVLQL  339 (968)
T ss_pred             CEEECcCCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcCCC---CCcEEECCCCccCCcCChhHhcCCCCCEEEC
Confidence            9999999999999999999999999999999999999999888776   8999999999999999999999999999999


Q ss_pred             cCCccccccccccCCCCCCCEEEccCCcCccccCcccccCCCcceeecccccccccCccccCCCCCccEEEcccCcceec
Q 005711          356 SNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGE  435 (681)
Q Consensus       356 ~~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~  435 (681)
                      ++|.+.+.+|..++.+++|+.|++++|.+.+.+|..+..+.+|+.+++++|.+.+.+|..+..+++|+.|++++|.+++.
T Consensus       340 ~~n~l~~~~p~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~  419 (968)
T PLN00113        340 WSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGE  419 (968)
T ss_pred             cCCCCcCcCChHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCCcEEECCCCcCCCcchhhhhcCCCCCEEEccCCcCcccCCcccccCCccceeecccCccccCCCC-----
Q 005711          436 IPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPD-----  510 (681)
Q Consensus       436 ~p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~n~~~~~~p~-----  510 (681)
                      +|..+..++.|+.|++++|.+++.++..+..+++|++|++++|++.+.+|..+ ...+|+.||+++|++++.+|.     
T Consensus       420 ~p~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l  498 (968)
T PLN00113        420 LPSEFTKLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSL  498 (968)
T ss_pred             CChhHhcCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhh
Confidence            99999999999999999999999999999999999999999999999888765 468999999999999988764     


Q ss_pred             --CcccccCCccccccCCcccccccccceeecCCCcCcccCCC-cCCCCCCCEEECCCCcCcccCCccccCCCCCCeEec
Q 005711          511 --AVGMDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPG-LYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNL  587 (681)
Q Consensus       511 --~~~L~Ls~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~~~ip~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~l  587 (681)
                        ...|+|++|+++|.+|..+.++++|++|+|++|.+++.+|. +..+++|+.|||++|+++|.+|..+..+++|+.+++
T Consensus       499 ~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~l  578 (968)
T PLN00113        499 SELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNI  578 (968)
T ss_pred             hccCEEECcCCcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEec
Confidence              45799999999999999999999999999999999999998 999999999999999999999999999999999999


Q ss_pred             ccCcceeeCCCCCCCCCccc-cccCCCCCCCCC
Q 005711          588 SYNSFSGFVPWKQGYQKFPG-AFAGNPNLCLES  619 (681)
Q Consensus       588 s~N~l~~~~p~~~~~~~~~~-~~~gn~~lc~~~  619 (681)
                      ++|++.|.+|..+++.++.. ++.||+.+||.+
T Consensus       579 s~N~l~~~~p~~~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        579 SHNHLHGSLPSTGAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             cCCcceeeCCCcchhcccChhhhcCCccccCCc
Confidence            99999999999999988877 899999999864



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query681
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 6e-43
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 1e-18
3rgx_A768 Structural Insight Into Brassinosteroid Perception 8e-43
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 1e-18
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-19
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 1e-19
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 3e-05
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 5e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-04
4b8c_D 727 Nuclease Module Of The Yeast Ccr4-Not Complex Lengt 3e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-04
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 6e-04
3zyj_A 440 Netring1 In Complex With Ngl1 Length = 440 7e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 172 bits (436), Expect = 6e-43, Method: Compositional matrix adjust. Identities = 191/598 (31%), Positives = 268/598 (44%), Gaps = 62/598 (10%) Query: 63 SWVGSNCTNWT-GVACNFQTGHVVSINLTDTSLSGQVHPRLCKLSFLEFLVLSSNAFTGR 121 S G+N W C G + + ++ +SG V C LEFL +SSN F+ Sbjct: 159 SISGANVVGWVLSDGC----GELKHLAISGNKISGDVDVSRCV--NLEFLDVSSNNFSTG 212 Query: 122 ISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMN 181 I G S L+ LD+S NK G AI L+ L + N +G + P + + Sbjct: 213 I-PFLGDCSALQHLDISGNKLSGDFSRAISTCTELKLLNISSNQFVGPIPPLPL----KS 267 Query: 182 LEKLDFSFNSFCGEIPESLY-YLKSLKHLDLEKNNLTGNVHDFY---QSLLVLNLGSNRF 237 L+ L + N F GEIP+ L +L LDL N+ G V F+ L L L SN F Sbjct: 268 LQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSNNF 327 Query: 238 SGTLPCFAASAM-SLTVLKLDNNSVVGGIPTCIASLQA-LTXXXXXXXXXXYEISPRLVF 295 SG LP M L VL L N G +P + +L A L I P L Sbjct: 328 SGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPILPNLCQ 387 Query: 296 FEKXXXXXXXXXXX--XGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQAL 353 K G +P ++ +E LV L LS N SG IP + L L+ L Sbjct: 388 NPKNTLQELYLQNNGFTGKIPPTLSNCSE---LVSLHLSFNYLSGTIPSSLGSLSKLRDL 444 Query: 354 FLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQ 413 L N+L GEIP + + L+ + L N L+G IP + C L + ++NN L+GEI Sbjct: 445 KLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLTGEIP 504 Query: 414 PELDALDSLKILDISNNQISGEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNL--- 470 + L++L IL +SNN SG IP L +SL +D ++N +G++ A+ K + Sbjct: 505 KWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAA 564 Query: 471 ------KYFSIARNKL------SGNLPNWLFSFQAI---QMMDFSTNKFMGFIPDAVG-- 513 +Y I + + +GNL FQ I Q+ ST G Sbjct: 565 NFIAGKRYVYIKNDGMKKECHGAGNL----LEFQGIRSEQLNRLSTRNPCNITSRVYGGH 620 Query: 514 -------------MDLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPG-LYRLRSLR 559 +D+S N+L G IPK + + L LNL N + G +P + LR L Sbjct: 621 TSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLN 680 Query: 560 ALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPWKQGYQKFPGA-FAGNPNLC 616 LDLS N L G+IP +S+L LT ++LS N+ SG +P ++ FP A F NP LC Sbjct: 681 ILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLC 738
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|4B8C|D Chain D, Nuclease Module Of The Yeast Ccr4-Not Complex Length = 727 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query681
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-124
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-121
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-112
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-79
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-22
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-81
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-73
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-58
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-77
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-76
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-73
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 7e-66
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-56
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-55
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-29
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-72
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-57
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-41
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-69
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-56
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-51
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-69
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-54
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-21
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-68
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-67
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-64
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-53
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-61
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-47
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-42
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-45
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-34
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-23
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-23
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-18
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-45
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-37
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-36
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-41
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-40
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-33
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-31
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-29
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-12
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-40
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-37
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-32
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-38
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-37
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-25
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-37
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-36
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-28
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 3e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-35
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 9e-28
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 6e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-35
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-32
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-31
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-24
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-15
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-11
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-34
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-29
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 4e-12
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-33
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-30
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-29
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-30
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-27
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-19
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-12
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-18
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-15
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-10
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-06
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-31
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-27
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-26
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-13
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-11
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 5e-27
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-12
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-26
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 7e-26
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-22
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-19
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-25
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-24
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-14
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-24
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-22
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-21
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-24
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-20
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-14
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-11
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-22
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-22
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 2e-21
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-21
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-22
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-19
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-13
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-20
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-19
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 4e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-19
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-14
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-13
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-08
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-16
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-16
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-15
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-13
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 5e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-16
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-12
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-15
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 7e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 6e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 5e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-10
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-13
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-10
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-07
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-12
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 6e-11
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 3e-07
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 5e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 9e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 7e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-06
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-04
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 7e-07
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-07
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 2e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 2e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 6e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 9e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 6e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 3e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 9e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  386 bits (994), Expect = e-124
 Identities = 159/530 (30%), Positives = 253/530 (47%), Gaps = 23/530 (4%)

Query: 83  HVVSINLTDTSLSGQVHPRLC---KLSFLEFLVLSSNAFTGRISTCFGGLSGLKTLDLSY 139
            +  ++L+  S+SG              L+ L +S N  +G +         L+ LD+S 
Sbjct: 152 SLEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSS 209

Query: 140 NKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPES 199
           N F   +P  +     L+ L + GN +L G F   +   +  L+ L+ S N F G IP  
Sbjct: 210 NNFSTGIP-FLGDCSALQHLDISGN-KLSGDFSRAISTCT-ELKLLNISSNQFVGPIPPL 266

Query: 200 LYYLKSLKHLDLEKNNLTGNVHDFY----QSLLVLNLGSNRFSGTLPCFAASAMSLTVLK 255
              LKSL++L L +N  TG + DF      +L  L+L  N F G +P F  S   L  L 
Sbjct: 267 P--LKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLA 324

Query: 256 LDNNSVVGGIPT-CIASLQALTHLNLSHNHLNYEISPRLV-FFEKLLLLDLSFNDLSGPL 313
           L +N+  G +P   +  ++ L  L+LS N  + E+   L      LL LDLS N+ SGP+
Sbjct: 325 LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFSGPI 384

Query: 314 PSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTY 373
              + Q   K  L  L L +N F+G+IP  ++    L +L LS N L G IP+ +G+L+ 
Sbjct: 385 LPNLCQNP-KNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSK 443

Query: 374 LQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQIS 433
           L+ + L  NML G IP  ++    L  LI++ N+L+GEI   L    +L  + +SNN+++
Sbjct: 444 LRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNRLT 503

Query: 434 GEIPLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQA 493
           GEIP  +  L++L I+  S+N+ SG++   +    +L +  +  N  +G +P  +F    
Sbjct: 504 GEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSG 563

Query: 494 IQMMDFSTNKFMGFIPDAVGM-----DLSDNLLHGTIPKGLFQLQGLEYLNLSFNFLDGQ 548
               +F   K   +I +           +     G   + L +L      N++     G 
Sbjct: 564 KIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGH 623

Query: 549 VP-GLYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVP 597
                    S+  LD+S+N L+G IP  I S+  L +LNL +N  SG +P
Sbjct: 624 TSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIP 673


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query681
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 100.0
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.95
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.94
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.88
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.88
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.87
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.87
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.85
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.84
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.82
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.81
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.76
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.74
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.73
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.73
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.73
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.73
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.72
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.72
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.7
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.7
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.66
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.62
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.59
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.58
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.55
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.51
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.5
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.47
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.44
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.43
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.43
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.41
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.37
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.26
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.19
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.19
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.16
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.13
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.82
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.79
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 98.74
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.7
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.62
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.88
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.68
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.04
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.59
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.57
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 95.33
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=6.2e-83  Score=737.25  Aligned_cols=580  Identities=34%  Similarity=0.505  Sum_probs=480.8

Q ss_pred             CHHhHHHHHHHHhcCCCCCCCCCCC-CCCCCCCCCceeecCCCCcEEEEEcCCCCCccc---cc----------------
Q 005711           40 NLEDKASLLLFKSLVQDPTQKLSSW-VGSNCTNWTGVACNFQTGHVVSINLTDTSLSGQ---VH----------------   99 (681)
Q Consensus        40 ~~~~~~~l~~~~~~~~~~~~~~~~w-~~~~cc~w~gv~c~~~~~~v~~L~L~~~~l~g~---~~----------------   99 (681)
                      ..+|++||++||+++.||. .+++| .+.+||.|+||+|+  .+||++|+|+++.+.|.   ++                
T Consensus        10 ~~~~~~all~~k~~~~~~~-~l~~W~~~~~~C~w~gv~C~--~~~v~~L~L~~~~l~g~~~~l~~~l~~L~~L~~l~~~~   86 (768)
T 3rgz_A           10 LYREIHQLISFKDVLPDKN-LLPDWSSNKNPCTFDGVTCR--DDKVTSIDLSSKPLNVGFSAVSSSLLSLTGLESLFLSN   86 (768)
T ss_dssp             HHHHHHHHHHHHTTCSCTT-SSTTCCTTSCGGGSTTEEEE--TTEEEEEECTTSCCCEEHHHHHHHTTTCTTCCEEECTT
T ss_pred             CHHHHHHHHHHHhhCCCcc-cccCCCCCCCCcCCcceEEC--CCcEEEEECCCCCcCCccCccChhHhccCcccccCCcC
Confidence            4467779999999999888 89999 57899999999998  68999999999999886   44                


Q ss_pred             -------ccccCCCCCCEEECCCCcCCccccc--cccCCCCCCEEEccCCCCCCcCCccc-cCCCCCCEeeCCCCCC---
Q 005711          100 -------PRLCKLSFLEFLVLSSNAFTGRIST--CFGGLSGLKTLDLSYNKFVGVVPDAI-MKLRNLRELILKGNPE---  166 (681)
Q Consensus       100 -------~~l~~l~~L~~L~Ls~n~l~~~~~~--~~~~l~~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~L~~n~~---  166 (681)
                             ..++++++|++|||++|.++|.+|.  .++++++|++|+|++|.+.+.+|..+ .++++|++|++++|.+   
T Consensus        87 ~~~~~l~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~  166 (768)
T 3rgz_A           87 SHINGSVSGFKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGA  166 (768)
T ss_dssp             SCEEECCCCCCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEE
T ss_pred             CCcCCCchhhccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCc
Confidence                   4678889999999999999988888  88999999999999988887777654 5566666666665532   


Q ss_pred             ---------------------------------------------CCccCCchhccccCCccEEEccCCcCccccCcccc
Q 005711          167 ---------------------------------------------LGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLY  201 (681)
Q Consensus       167 ---------------------------------------------~~~~~p~~l~~l~~~L~~L~L~~n~l~~~~p~~l~  201 (681)
                                                                   +.+.+|. ++++ ++|++|++++|.+++.+|..++
T Consensus       167 ~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~Ls~n~l~~~~~~-l~~l-~~L~~L~Ls~n~l~~~~~~~l~  244 (768)
T 3rgz_A          167 NVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNLEFLDVSSNNFSTGIPF-LGDC-SALQHLDISGNKLSGDFSRAIS  244 (768)
T ss_dssp             THHHHHHTTCCTTCCEEECCSSEEESCCBCTTCTTCCEEECCSSCCCSCCCB-CTTC-CSCCEEECCSSCCCSCHHHHTT
T ss_pred             CChhhhhhccCCCCCEEECCCCcccccCCcccCCcCCEEECcCCcCCCCCcc-cccC-CCCCEEECcCCcCCCcccHHHh
Confidence                                                         1122222 3333 4444444444444444444444


Q ss_pred             CCCCCCEEEccCccCcccccC-cCCcccEEECCCCCCccccchhhccC-CCCCEEEccCCccccCCChhhcccCcccEEe
Q 005711          202 YLKSLKHLDLEKNNLTGNVHD-FYQSLLVLNLGSNRFSGTLPCFAASA-MSLTVLKLDNNSVVGGIPTCIASLQALTHLN  279 (681)
Q Consensus       202 ~l~~L~~L~L~~n~l~~~~~~-~~~~L~~L~L~~n~l~~~~~~~~~~~-~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~  279 (681)
                      ++++|++|++++|.+++.+|. .+.+|++|++++|.+++.+|..+... ++|++|++++|.+++.+|..++.+++|++|+
T Consensus       245 ~l~~L~~L~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~  324 (768)
T 3rgz_A          245 TCTELKLLNISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLA  324 (768)
T ss_dssp             TCSSCCEEECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEE
T ss_pred             cCCCCCEEECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEE
Confidence            445555555555544443333 23446666666666666777766654 7788888888888877888888888888888


Q ss_pred             cCCCccccccCcc-ccCCCCCcEEeccCCCccCCCChhhhhcccCCCccEEEccCCCCcCCCcccccC--CCCCCEEecc
Q 005711          280 LSHNHLNYEISPR-LVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITE--LKSLQALFLS  356 (681)
Q Consensus       280 L~~n~l~~~~~~~-l~~l~~L~~L~L~~n~l~~~~p~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~l~~--l~~L~~L~L~  356 (681)
                      +++|.+++.+|.. +..+++|++|++++|.+++.+|..+..+..  +|+.|++++|.+++.+|..+..  +++|++|+++
T Consensus       325 L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~--~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~  402 (768)
T 3rgz_A          325 LSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSA--SLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQ  402 (768)
T ss_dssp             CCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTT--TCSEEECCSSEEEEECCTTTTCSTTCCCCEEECC
T ss_pred             CCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhc--CCcEEEccCCCcCCCcChhhhhcccCCccEEECC
Confidence            8888887777765 777888888888888888788877766542  6888888888888877777766  7889999999


Q ss_pred             CCccccccccccCCCCCCCEEEccCCcCccccCcccccCCCcceeecccccccccCccccCCCCCccEEEcccCcceecc
Q 005711          357 NNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPLNIVGCFQLLALIVNNNNLSGEIQPELDALDSLKILDISNNQISGEI  436 (681)
Q Consensus       357 ~n~l~~~~~~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~  436 (681)
                      +|.+++.+|..++++++|++|++++|.+++.+|..+..+++|+.|++++|.+.+.+|..+..+++|+.|++++|++++.+
T Consensus       403 ~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~  482 (768)
T 3rgz_A          403 NNGFTGKIPPTLSNCSELVSLHLSFNYLSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEI  482 (768)
T ss_dssp             SSEEEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCC
T ss_pred             CCccccccCHHHhcCCCCCEEECcCCcccCcccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcC
Confidence            99999889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCCCCcEEECCCCcCCCcchhhhhcCCCCCEEEccCCcCcccCCcccccCCccceeecccCccccCCCC------
Q 005711          437 PLTLAGLKSLEIVDFSSNNLSGSLNDAITKWTNLKYFSIARNKLSGNLPNWLFSFQAIQMMDFSTNKFMGFIPD------  510 (681)
Q Consensus       437 p~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~ls~n~~~~~~p~------  510 (681)
                      |..+.++++|++|++++|++++.+|.+++.+++|++|++++|+++|.+|..+..+++|+.|++++|+++|.+|.      
T Consensus       483 p~~l~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~  562 (768)
T 3rgz_A          483 PSGLSNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQS  562 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTT
T ss_pred             CHHHhcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999998877663      


Q ss_pred             -----------------------------------------------------------------------CcccccCCc
Q 005711          511 -----------------------------------------------------------------------AVGMDLSDN  519 (681)
Q Consensus       511 -----------------------------------------------------------------------~~~L~Ls~N  519 (681)
                                                                                             .+.|||++|
T Consensus       563 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N  642 (768)
T 3rgz_A          563 GKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYN  642 (768)
T ss_dssp             TCBCCSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSS
T ss_pred             chhhhhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCC
Confidence                                                                                   235899999


Q ss_pred             cccccCCcccccccccceeecCCCcCcccCCC-cCCCCCCCEEECCCCcCcccCCccccCCCCCCeEecccCcceeeCCC
Q 005711          520 LLHGTIPKGLFQLQGLEYLNLSFNFLDGQVPG-LYRLRSLRALDLSHNSLTGQIPGNISSLQELTLLNLSYNSFSGFVPW  598 (681)
Q Consensus       520 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~~~ip~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~ls~N~l~~~~p~  598 (681)
                      +++|.+|.+++++++|+.|+|++|+++|.+|. ++++++|+.|||++|+++|.+|..++.+++|++||+++|+++|.||.
T Consensus       643 ~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~  722 (768)
T 3rgz_A          643 MLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPE  722 (768)
T ss_dssp             CCBSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCS
T ss_pred             cccccCCHHHhccccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCC
Confidence            99999999999999999999999999999999 99999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCccc-cccCCCCCCCCCCCCCCCCC
Q 005711          599 KQGYQKFPG-AFAGNPNLCLESSHGECNRT  627 (681)
Q Consensus       599 ~~~~~~~~~-~~~gn~~lc~~~~~~~c~~~  627 (681)
                      .+++.+++. +|.|||.+||.|.. .|...
T Consensus       723 ~~~~~~~~~~~~~gN~~Lcg~~l~-~C~~~  751 (768)
T 3rgz_A          723 MGQFETFPPAKFLNNPGLCGYPLP-RCDPS  751 (768)
T ss_dssp             SSSGGGSCGGGGCSCTEEESTTSC-CCCSC
T ss_pred             chhhccCCHHHhcCCchhcCCCCc-CCCCC
Confidence            999999988 89999999999987 88644



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 681
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-21
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-18
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-16
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-19
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-16
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-15
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 0.001
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 7e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-04
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-18
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-08
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 9e-06
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-10
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-08
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-05
d2astb2 284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 4e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 3e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 4e-09
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 5e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 3e-05
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 7e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 6e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 3e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 2e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_ 353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 2e-06
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 5e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-05
d2ca6a1 344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 0.004
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-05
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
 Score = 94.4 bits (233), Expect = 1e-21
 Identities = 82/359 (22%), Positives = 125/359 (34%), Gaps = 61/359 (16%)

Query: 40  NLEDKASLLLFKSLVQDPTQKLSSWV-GSNCTN--WTGVACN--FQTGHVVSINLTDTSL 94
           N +DK +LL  K  + +PT  LSSW+  ++C N  W GV C+   QT  V +++L+  +L
Sbjct: 4   NPQDKQALLQIKKDLGNPTT-LSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNL 62

Query: 95  SG--QVHPRLCKLSFLEFLVLSSNA-FTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIM 151
                +   L  L +L FL +       G I      L+ L  L +++            
Sbjct: 63  PKPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVS-------- 114

Query: 152 KLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSFCGEIPESLYYLKSLKHLDL 211
                                    +    L  LDFS+N+  G +P S+  L +L  +  
Sbjct: 115 ------------------GAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITF 156

Query: 212 EKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIAS 271
           + N ++G + D Y S   L          L        +   L   + S           
Sbjct: 157 DGNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLNLAFVDLSRNMLEGDASVL 216

Query: 272 LQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDL 331
             +  +    H   N              L                           LDL
Sbjct: 217 FGSDKNTQKIHLAKNSLAFDLGKVGLSKNLN-------------------------GLDL 251

Query: 332 SHNRFSGEIPLKITELKSLQALFLSNNLLIGEIPARIGNLTYLQVIDLSHNMLSGSIPL 390
            +NR  G +P  +T+LK L +L +S N L GEIP   GNL    V   ++N      PL
Sbjct: 252 RNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPL 309


>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query681
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 100.0
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.85
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.78
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.74
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.67
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.65
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.65
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.62
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.51
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.44
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.38
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.36
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.15
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.11
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.06
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.17
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.87
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.46
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.19
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.72
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.36
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00  E-value=4e-40  Score=336.69  Aligned_cols=289  Identities=29%  Similarity=0.474  Sum_probs=225.7

Q ss_pred             HHhHHHHHHHHhcCCCCCCCCCCC-CCCCCCC--CCceeecCCC--CcEEEEEcCCCCCcc--cccccccCCCCCCEEEC
Q 005711           41 LEDKASLLLFKSLVQDPTQKLSSW-VGSNCTN--WTGVACNFQT--GHVVSINLTDTSLSG--QVHPRLCKLSFLEFLVL  113 (681)
Q Consensus        41 ~~~~~~l~~~~~~~~~~~~~~~~w-~~~~cc~--w~gv~c~~~~--~~v~~L~L~~~~l~g--~~~~~l~~l~~L~~L~L  113 (681)
                      ++|++||++||+++.+|. .+++| .+.|||.  |+||+|+...  +||++|+|+++++.|  .+|+.++++++|++|+|
T Consensus         5 ~~e~~aLl~~k~~~~~~~-~l~sW~~~~d~C~~~w~gv~C~~~~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~L~~L~L   83 (313)
T d1ogqa_           5 PQDKQALLQIKKDLGNPT-TLSSWLPTTDCCNRTWLGVLCDTDTQTYRVNNLDLSGLNLPKPYPIPSSLANLPYLNFLYI   83 (313)
T ss_dssp             HHHHHHHHHHHHHTTCCG-GGTTCCTTSCTTTTCSTTEEECCSSSCCCEEEEEEECCCCSSCEECCGGGGGCTTCSEEEE
T ss_pred             HHHHHHHHHHHHHCCCCC-cCCCCCCCCCCCCCcCCCeEEeCCCCcEEEEEEECCCCCCCCCCCCChHHhcCcccccccc
Confidence            466679999999998874 68899 6789994  9999998543  489999999999988  57899999999999999


Q ss_pred             CC-CcCCccccccccCCCCCCEEEccCCCCCCcCCccccCCCCCCEeeCCCCCCCCccCCchhccccCCccEEEccCCcC
Q 005711          114 SS-NAFTGRISTCFGGLSGLKTLDLSYNKFVGVVPDAIMKLRNLRELILKGNPELGGVFPGWVGNFSMNLEKLDFSFNSF  192 (681)
Q Consensus       114 s~-n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n~~~~~~~p~~l~~l~~~L~~L~L~~n~l  192 (681)
                      ++ |.++|.+|..|+++++|++|+|++|++.+..|..+..+.+|+++++++| ...+.+|..++++ ++|+++++++|.+
T Consensus        84 s~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N-~~~~~~p~~l~~l-~~L~~l~l~~n~l  161 (313)
T d1ogqa_          84 GGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYN-ALSGTLPPSISSL-PNLVGITFDGNRI  161 (313)
T ss_dssp             EEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSS-EEESCCCGGGGGC-TTCCEEECCSSCC
T ss_pred             ccccccccccccccccccccchhhhccccccccccccccchhhhcccccccc-cccccCchhhccC-cccceeecccccc
Confidence            97 8999999999999999999999999999999999999999999999999 5667888999998 8999999999999


Q ss_pred             ccccCccccCCCCC-CEEEccCccCcccccCcCCcccEEECCCCCCccccchhhccCCCCCEEEccCCccccCCChhhcc
Q 005711          193 CGEIPESLYYLKSL-KHLDLEKNNLTGNVHDFYQSLLVLNLGSNRFSGTLPCFAASAMSLTVLKLDNNSVVGGIPTCIAS  271 (681)
Q Consensus       193 ~~~~p~~l~~l~~L-~~L~L~~n~l~~~~~~~~~~L~~L~L~~n~l~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~~  271 (681)
                      .+.+|..+..+.++ +.+++++|++++..+.                     .+..+. ...++++.+...+.+|..+..
T Consensus       162 ~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~---------------------~~~~l~-~~~l~l~~~~~~~~~~~~~~~  219 (313)
T d1ogqa_         162 SGAIPDSYGSFSKLFTSMTISRNRLTGKIPP---------------------TFANLN-LAFVDLSRNMLEGDASVLFGS  219 (313)
T ss_dssp             EEECCGGGGCCCTTCCEEECCSSEEEEECCG---------------------GGGGCC-CSEEECCSSEEEECCGGGCCT
T ss_pred             ccccccccccccccccccccccccccccccc---------------------cccccc-ccccccccccccccccccccc
Confidence            99999988888776 7777877777655444                     333332 234666666666666666666


Q ss_pred             cCcccEEecCCCccccccCccccCCCCCcEEeccCCCccCCCChhhhhcccCCCccEEEccCCCCcCCCcccccCCCCCC
Q 005711          272 LQALTHLNLSHNHLNYEISPRLVFFEKLLLLDLSFNDLSGPLPSKIAQTTEKAGLVLLDLSHNRFSGEIPLKITELKSLQ  351 (681)
Q Consensus       272 l~~L~~L~L~~n~l~~~~~~~l~~l~~L~~L~L~~n~l~~~~p~~~~~~~~~~~L~~L~Ls~n~l~~~~p~~l~~l~~L~  351 (681)
                      +++++.+++++|.+.+.++ .+..+++|+.|++++|+++|.+|+.++.++   +|++|++++|+++|.+|. ++++++|+
T Consensus       220 ~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~---~L~~L~Ls~N~l~g~iP~-~~~L~~L~  294 (313)
T d1ogqa_         220 DKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLK---FLHSLNVSFNNLCGEIPQ-GGNLQRFD  294 (313)
T ss_dssp             TSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCT---TCCEEECCSSEEEEECCC-STTGGGSC
T ss_pred             ccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCC---CCCEEECcCCcccccCCC-cccCCCCC
Confidence            6666666666666655433 455666666677777777666676666655   677777777777766663 45666777


Q ss_pred             EEeccCCc
Q 005711          352 ALFLSNNL  359 (681)
Q Consensus       352 ~L~L~~n~  359 (681)
                      .+++++|+
T Consensus       295 ~l~l~~N~  302 (313)
T d1ogqa_         295 VSAYANNK  302 (313)
T ss_dssp             GGGTCSSS
T ss_pred             HHHhCCCc
Confidence            77777776



>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure