Citrus Sinensis ID: 005728

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680

MFACSFLLGACCMEYDSLFLSFYFYTAGITGLKLKTFKDNWFSDYQKTNNAGIPDPNGAVDWSFNALVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREELLTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIANDDILPVLNYFKVAEGREPHIATFFTAFICIGCVIIGNLDLITPTITMFFLLCYSGVNLSCFLLDLLDAPSWRPRWKFHHWSLSLLGSVFCIVIMFLISWSFTVVSLALASLIYYYVCLKGKAGDWGDGLKSAYFQLALRSLRSLGANQVHPKNWYPIPLIFCRPWGKLPENVPCHPKLADFANCMKKKGRGMSIFVSILDGDYHECAEDAKTACKQLATYIDYKRCEGVAEIVVAPNMSEGFRGIVQTMGLGNLKPNIVVMRYPEIWRRENLTEIPATFVGIINDCIVANKAVVIVKGLDEWPNEYQRQYGTIDLYWIVRDGGLMLLLSQLLLTKESFESCKIQVFCIAEEDSDAEVLKADVKKFLYDLRMQAEVIVISMKSWDEQTENGPQQDESLDAFIAAQHRIKNYLAEMKAEAQKSGTPLMADGKPVVVNEQQVEKFLYTTLKLNSTILRHSRMAAVVLVSLPPPPINHPAYCYMEYMDLLVENVPRLLIVRGYRRDVVTLFT

cccccccHHHHHHHHHccccccccccccccccccHHHHHHcccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHcccccccEEHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccEEEEHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccccccccccHHHHHHHHHHHHccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHcccccccccEEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccEEEEccccHHHHHHHHHcccccccccEEEEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEccccEEEEEcc

MFACSFLLGACCMEYDSLFLSFYFYTAGITGLKLKTFKDNWFSDYQKTNNAGIPDPNGAVDWSFNALVGLFFPAVTGIMAGSNRSASLKDTQRSIPIGTLAATLTTTALYVISVLLFGAAATREELLTDRLLTATIAWPFPAVIHIGIILSTLGAALQSLTGAPRLLAAIANDDILPVLNYFKVAEGREPHIATFFTAFICIGCVIIGNLDLITPTITMFFLLCYSGVNLSCFLLDLLDAPSWRPRWKFHHWSLSLLGSVFCIVIMFLISWSFTVVSLALASLIYYYVCLKGKAGDWGDGLKSAYFQLALRSLRSLGANQVHPKNWYPIPLIFCRPWGKLPENVPCHPKLADFANCMKKKGRGMSIFVSILDGDYHECAEDAKTACKQLATYIDYKRCEGVAEIVVAPNMSEGFRGIVQTMGLGNLKPNIVVMRYPEIWRRENLTEIPATFVGIINDCIVANKAVVIVKGLDEWPNEYQRQYGTIDLYWIVRDGGLMLLLSQLLLTKESFESCKIQVFCIAEEDSDAEVLKADVKKFLYDLRMQAEVIVISMKSWDEQTENGP***E*LDAFIAAQHRIKNYLAEMKA**************PVVVNEQQVEKFLYTTLKLNSTILRHSRMAAVVLVSLPPPPINHPAYCYMEYMDLLVENVPRLLIVRGYRRDVVTLFT

xxxxxxHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cation-chloride cotransporter 1	Cation/chloride cotransporter that mediates potassium-chloride and sodium-chloride cotransports. Involved in plant development and Cl(-) homeostasis. May be involved in long distance Cl(-) transport. Does not function as an H(+)-dependent cotransporter.	probable	Q2UVJ5
Cation-chloride cotransporter 1	Probable cation/chloride cotransporter that may mediate potassium-chloride cotransport. Involved in plant development and K(+) and Cl(-) homeostasis. May not be involved in sodium-chloride cotransport.	probable	Q6Z0E2
Cation-chloride cotransporter 2	Probable cation/chloride cotransporter.	probable	Q657W3

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G40, chain A
Confidence level:very confident
Coverage over the Query: 326-556,623-674
View the alignment between query and template
View the model in PyMOL

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 63-297
View the alignment between query and template
View the model in PyMOL