Citrus Sinensis ID: 005737

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680

MKSMNNDDTNNNNINNDNWLGFSLSPDIKMEVPQDPHPQTQPSSPSTSAVMPPPSVPSSLFQCLPYGFYYGFEGENSSLYSPLPVMPLKSDGSLCIMEALSRSQQPQGMVSTTATTTSTPKLEDFFGGATMGTHHYESNDREAMALSLDSMYYHHNPENEPSSQNCLNQLEENSRHQQQQIQDQQYQYYTTGFRSHEMLLGDKGKEIQVADCNLQLPAMADDGMHGMKNWVSRNYATEQAMQQKLLGCMSHNGGESGDISAMPYGDLQSLSLSMSPASQSSCVTGSQQVSHAVSNCAAVERKKRGSEKMDQKQVAHRKSLDTFGQRTSQYRGVTRHRWTGRYEAHLWDNSCKKEGQSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHINFPLENYQKELEEMKNMNRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFSTQEEAAEAYDIAAIKFRGVTAVTNFDITRYDVERIMASSNLLAGELARRNKEMGPGNDAPNQNPSAHTGNGDLILSQKDNESDPPDWKLVSYQSSQQLEHKAPNMSIINNYNAHLFSLAPDSVIAMDAMGSAQQEVESSAKMGNHLSNASSLVTSLSSSKEGSPDGSSVPIPFAMPRTASKLLTSPTNTVNSWIPSAELRPALSVPHMPVFAAWTDA

ccccccccccccccccccCEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccHHHccccccccccccccccccEEEccccccEEEEEcccccccccccccccEEEccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHcccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*************INNDNWLGFSL*********************************SSLFQCLPYGFYYGFEGENSSLYSPLPVMPLKSDGSLCIMEAL********************KLEDFFGGATMGT***************************************************QYQYYTTGFRSHEMLLGDKGKEIQVADCNLQLPAMADDGMHGMKNWVSRNYAT*******LL**********************************************************************************QYRGVTRHRWTGRYEAHLWDNSCKKEGQSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHINFPLENYQKELEEMKNMNRQEYVAHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFSTQEEAAEAYDIAAIKFRGVTAVTNFDITRYDVERIMASSNLL***************************************************************SIINNYNAHLFSLAPDSVI******************************************************************NSWIPSAELRPALSVPHMPVFAAWTDA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKSMNNDDTNNNNINNDNWLGFSLSPDIKMEVPQDPHPQTQPSSPSTSAVMPPPSVPSSLFQCLPYGFYYGFEGENSSLYSPLPVMPLKSDGSLCIMEALSRSQQPQGMVSTTATTTSTPKLEDFFGGATMGTHHYESNDREAMALSLDSMYYHHNPENEPSSQNCxxxxxxxxxxxxxxxxxxxxxYYTTGFRSHEMLLGDKGKEIQVADCNLQLPAMADDGMHGMKNWVSRNYATEQAMQQKLLGCMSHNGGESGDISAMPYGDLQSLSLSMSPASQSSCVTGSQQVSHAVSNCAAVERKKRGSEKMDQKQVAHRKSLDTFGQRTSQYRGVTRHRWTGRYEAHLWDNSCKKEGQSRKGRQVYLGGYDMEEKAARAYDLAALKYWGPSTHINFPxxxxxxxxxxxxxxxxxxxxxHLRRKSSGFSRGASIYRGVTRHHQHGRWQARIGRVAGNKDLYLGTFSTQEEAAEAYDIAAIKFRGVTAVTNFDITRYDVERIMASSNLLAGELARRNKEMGPGNDAPNQNPSAHTGNGDLILSQKDNESDPPDWKLVSYQSSQQLEHKAPNMSIINNYNAHLFSLAPDSVIAMDAMGSAQQEVESSAKMGNHLSNASSLVTSLSSSKEGSPDGSSVPIPFAMPRTASKLLTSPTNTVNSWIPSAELRPALSVPHMPVFAAWTDA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
AP2-like ethylene-responsive transcription factor ANT	Transcription activator that recognizes and binds to the DNA consensus sequence 5'-CAC[AG]N[AT]TNCCNANG-3'. Required for the initiation and growth of ovules integumenta, and for the development of female gametophyte. Plays a critical role in the development of gynoecium marginal tissues (e.g. stigma, style and septa), and in the fusion of carpels and of medial ridges leading to ovule primordia. Also involved in organs initiation and development, including floral organs. Maintains the meristematic competence of cells and consequently sustains expression of cell cycle regulators during organogenesis, thus controlling the final size of each organ by controlling their cell number. Regulates INO autoinduction and expression pattern. As ANT promotes petal cell identity and mediates down-regulation of AG in flower whorl 2, it functions as a class A homeotic gene.	probable	Q38914

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 329-397
View the alignment between query and template
View the model in PyMOL

Template: 1GCC, chain A
Confidence level:very confident
Coverage over the Query: 431-491
View the alignment between query and template
View the model in PyMOL

Template: 1U3E, chain M
Confidence level:probable
Coverage over the Query: 377-473
View the alignment between query and template
View the model in PyMOL